NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F033140

Metagenome / Metatranscriptome Family F033140

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F033140
Family Type Metagenome / Metatranscriptome
Number of Sequences 178
Average Sequence Length 40 residues
Representative Sequence SPYSLILLGDDMLLFEREEYDPDRGTWRGLAPGDPGRSNR
Number of Associated Samples 144
Number of Associated Scaffolds 178

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 2.25 %
% of genes near scaffold ends (potentially truncated) 94.94 %
% of genes from short scaffolds (< 2000 bps) 95.51 %
Associated GOLD sequencing projects 136
AlphaFold2 3D model prediction Yes
3D model pTM-score0.50

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (57.865 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(42.135 % of family members)
Environment Ontology (ENVO) Unclassified
(43.258 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(42.697 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 29.41%    Coil/Unstructured: 70.59%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.50
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 178 Family Scaffolds
PF02627CMD 13.48
PF04199Cyclase 7.87
PF07690MFS_1 5.06
PF00175NAD_binding_1 3.93
PF00892EamA 3.37
PF07992Pyr_redox_2 3.37
PF00723Glyco_hydro_15 2.81
PF00106adh_short 1.69
PF08241Methyltransf_11 1.69
PF04185Phosphoesterase 1.12
PF11225DUF3024 1.12
PF11774Lsr2 1.12
PF13401AAA_22 1.12
PF04087DUF389 1.12
PF02922CBM_48 1.12
PF00561Abhydrolase_1 0.56
PF02126PTE 0.56
PF00441Acyl-CoA_dh_1 0.56
PF07883Cupin_2 0.56
PF08044DUF1707 0.56
PF02574S-methyl_trans 0.56
PF00667FAD_binding_1 0.56
PF13649Methyltransf_25 0.56
PF11139SfLAP 0.56
PF10282Lactonase 0.56
PF04672Methyltransf_19 0.56
PF13546DDE_5 0.56
PF13671AAA_33 0.56
PF07592DDE_Tnp_ISAZ013 0.56
PF04978DUF664 0.56
PF00005ABC_tran 0.56
PF03992ABM 0.56
PF00211Guanylate_cyc 0.56
PF04264YceI 0.56
PF01740STAS 0.56
PF13466STAS_2 0.56
PF13826DUF4188 0.56
PF07859Abhydrolase_3 0.56
PF00196GerE 0.56
PF00120Gln-synt_C 0.56

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 178 Family Scaffolds
COG0599Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase familyGeneral function prediction only [R] 13.48
COG2128Alkylhydroperoxidase family enzyme, contains CxxC motifInorganic ion transport and metabolism [P] 13.48
COG1878Kynurenine formamidaseAmino acid transport and metabolism [E] 7.87
COG3387Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 familyCarbohydrate transport and metabolism [G] 2.81
COG1808Uncharacterized membrane protein AF0785, contains DUF389 domainFunction unknown [S] 1.12
COG3511Phospholipase CCell wall/membrane/envelope biogenesis [M] 1.12
COG0369Flavoprotein (flavin reductase) subunit CysJ of sulfite and N-hydroxylaminopurine reductasesNucleotide transport and metabolism [F] 0.56
COG0646Methionine synthase I (cobalamin-dependent), methyltransferase domainAmino acid transport and metabolism [E] 0.56
COG0657Acetyl esterase/lipaseLipid transport and metabolism [I] 0.56
COG1735Predicted metal-dependent hydrolase, phosphotriesterase familyGeneral function prediction only [R] 0.56
COG1960Acyl-CoA dehydrogenase related to the alkylation response protein AidBLipid transport and metabolism [I] 0.56
COG2040Homocysteine/selenocysteine methylase (S-methylmethionine-dependent)Amino acid transport and metabolism [E] 0.56
COG2114Adenylate cyclase, class 3Signal transduction mechanisms [T] 0.56
COG2353Polyisoprenoid-binding periplasmic protein YceIGeneral function prediction only [R] 0.56


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms57.87 %
UnclassifiedrootN/A42.13 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300005329|Ga0070683_100459755All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1215Open in IMG/M
3300005332|Ga0066388_103208188All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia836Open in IMG/M
3300005332|Ga0066388_105338616Not Available652Open in IMG/M
3300005435|Ga0070714_101693841Not Available617Open in IMG/M
3300005436|Ga0070713_101955902All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria569Open in IMG/M
3300005440|Ga0070705_101627967Not Available544Open in IMG/M
3300005441|Ga0070700_101988319Not Available504Open in IMG/M
3300005444|Ga0070694_101081667Not Available668Open in IMG/M
3300005467|Ga0070706_101910115All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia539Open in IMG/M
3300005471|Ga0070698_100278149All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1605Open in IMG/M
3300005548|Ga0070665_102362989All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300005614|Ga0068856_100485423All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1256Open in IMG/M
3300005614|Ga0068856_101574288All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia670Open in IMG/M
3300005764|Ga0066903_106532063All Organisms → cellular organisms → Bacteria607Open in IMG/M
3300005764|Ga0066903_108857655Not Available510Open in IMG/M
3300006028|Ga0070717_11963186Not Available528Open in IMG/M
3300006175|Ga0070712_100994528Not Available726Open in IMG/M
3300006237|Ga0097621_101068603Not Available757Open in IMG/M
3300006358|Ga0068871_100582914Not Available1016Open in IMG/M
3300006604|Ga0074060_11956228All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300006755|Ga0079222_12189230Not Available549Open in IMG/M
3300006806|Ga0079220_10472260Not Available847Open in IMG/M
3300006904|Ga0075424_101091278All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia851Open in IMG/M
3300006904|Ga0075424_102605619All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300006954|Ga0079219_10367573All Organisms → cellular organisms → Bacteria934Open in IMG/M
3300009545|Ga0105237_10915772Not Available884Open in IMG/M
3300009698|Ga0116216_10316685Not Available950Open in IMG/M
3300009792|Ga0126374_11400057All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia569Open in IMG/M
3300010147|Ga0126319_1368393All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii601Open in IMG/M
3300010154|Ga0127503_10998663All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii837Open in IMG/M
3300010341|Ga0074045_10038885All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3520Open in IMG/M
3300010359|Ga0126376_12600880All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia555Open in IMG/M
3300010360|Ga0126372_10299879All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1412Open in IMG/M
3300010360|Ga0126372_11262376All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium766Open in IMG/M
3300010360|Ga0126372_11750425Not Available664Open in IMG/M
3300010379|Ga0136449_102547111Not Available732Open in IMG/M
3300010396|Ga0134126_10826505All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1046Open in IMG/M
3300010398|Ga0126383_12082109Not Available655Open in IMG/M
3300010398|Ga0126383_12274975Not Available628Open in IMG/M
3300010867|Ga0126347_1105239Not Available529Open in IMG/M
3300010869|Ga0126359_1436069All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. Tu60711327Open in IMG/M
3300011107|Ga0151490_1023032All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium688Open in IMG/M
3300012199|Ga0137383_11291626All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii521Open in IMG/M
3300012201|Ga0137365_10121691All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → unclassified Amycolatopsis → Amycolatopsis sp. DSM 1104861963Open in IMG/M
3300012469|Ga0150984_111251184Not Available506Open in IMG/M
3300012948|Ga0126375_11415394All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium590Open in IMG/M
3300012986|Ga0164304_11148035Not Available624Open in IMG/M
3300012989|Ga0164305_12028226All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia526Open in IMG/M
3300013100|Ga0157373_11152059All Organisms → cellular organisms → Bacteria583Open in IMG/M
3300013105|Ga0157369_11599587Not Available663Open in IMG/M
3300013105|Ga0157369_12022152Not Available585Open in IMG/M
3300013306|Ga0163162_11329172All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium817Open in IMG/M
3300015201|Ga0173478_10151279All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia923Open in IMG/M
3300015373|Ga0132257_100282945All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1988Open in IMG/M
3300015373|Ga0132257_101468118All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia869Open in IMG/M
3300015374|Ga0132255_101879152All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium910Open in IMG/M
3300016270|Ga0182036_11622097Not Available545Open in IMG/M
3300016294|Ga0182041_11155395Not Available705Open in IMG/M
3300016294|Ga0182041_11959433Not Available545Open in IMG/M
3300016319|Ga0182033_10519904All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1025Open in IMG/M
3300016341|Ga0182035_10976984All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia750Open in IMG/M
3300016341|Ga0182035_12071121Not Available517Open in IMG/M
3300016371|Ga0182034_11251399All Organisms → cellular organisms → Bacteria646Open in IMG/M
3300016371|Ga0182034_11957315All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300016445|Ga0182038_11360824All Organisms → cellular organisms → Bacteria → Terrabacteria group635Open in IMG/M
3300017932|Ga0187814_10069209All Organisms → cellular organisms → Bacteria1295Open in IMG/M
3300017937|Ga0187809_10294098Not Available597Open in IMG/M
3300018006|Ga0187804_10261395All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Agromyces → Agromyces humatus749Open in IMG/M
3300018023|Ga0187889_10412203All Organisms → cellular organisms → Bacteria → Terrabacteria group583Open in IMG/M
3300020579|Ga0210407_11370836Not Available526Open in IMG/M
3300020581|Ga0210399_10518981All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Hamadaea → Hamadaea flava989Open in IMG/M
3300020581|Ga0210399_11422771All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Tsukamurellaceae → Tsukamurella → unclassified Tsukamurella → Tsukamurella sp. PLM1541Open in IMG/M
3300021401|Ga0210393_10718210All Organisms → cellular organisms → Bacteria815Open in IMG/M
3300021402|Ga0210385_10561735Not Available868Open in IMG/M
3300021405|Ga0210387_10582789All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces994Open in IMG/M
3300021407|Ga0210383_10500778All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Novosphingobium → Novosphingobium flavum1049Open in IMG/M
3300021478|Ga0210402_10566039Not Available1054Open in IMG/M
3300021478|Ga0210402_10633454Not Available990Open in IMG/M
3300021560|Ga0126371_12668373All Organisms → cellular organisms → Bacteria605Open in IMG/M
3300025898|Ga0207692_10815840All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia611Open in IMG/M
3300025910|Ga0207684_10706952Not Available856Open in IMG/M
3300025927|Ga0207687_11665430Not Available547Open in IMG/M
3300025928|Ga0207700_11236957All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium666Open in IMG/M
3300025939|Ga0207665_10495654All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria943Open in IMG/M
3300025939|Ga0207665_11514028All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia533Open in IMG/M
3300026067|Ga0207678_10756268All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia857Open in IMG/M
3300026075|Ga0207708_10903367All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia764Open in IMG/M
3300026291|Ga0209890_10252665Not Available547Open in IMG/M
3300026475|Ga0257147_1045088All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii652Open in IMG/M
3300027824|Ga0209040_10359914Not Available688Open in IMG/M
3300027824|Ga0209040_10451137Not Available585Open in IMG/M
3300027824|Ga0209040_10458337Not Available578Open in IMG/M
3300027910|Ga0209583_10300254All Organisms → cellular organisms → Bacteria → Terrabacteria group729Open in IMG/M
3300028742|Ga0302220_10264653All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia630Open in IMG/M
3300028789|Ga0302232_10229476All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia922Open in IMG/M
3300029636|Ga0222749_10291016All Organisms → cellular organisms → Bacteria842Open in IMG/M
3300029999|Ga0311339_10924663All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia825Open in IMG/M
3300030490|Ga0302184_10123176All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1149Open in IMG/M
3300030580|Ga0311355_10820088Not Available852Open in IMG/M
3300031544|Ga0318534_10093204All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1720Open in IMG/M
3300031546|Ga0318538_10011544All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3690Open in IMG/M
3300031546|Ga0318538_10109665Not Available1433Open in IMG/M
3300031549|Ga0318571_10183599All Organisms → cellular organisms → Bacteria740Open in IMG/M
3300031561|Ga0318528_10138398All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1293Open in IMG/M
3300031572|Ga0318515_10482610All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia662Open in IMG/M
3300031679|Ga0318561_10463541All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia697Open in IMG/M
3300031679|Ga0318561_10485137All Organisms → cellular organisms → Bacteria → Terrabacteria group680Open in IMG/M
3300031681|Ga0318572_10208344All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1143Open in IMG/M
3300031682|Ga0318560_10352362Not Available795Open in IMG/M
3300031713|Ga0318496_10056821All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2037Open in IMG/M
3300031724|Ga0318500_10034684All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2051Open in IMG/M
3300031724|Ga0318500_10550788All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia582Open in IMG/M
3300031747|Ga0318502_10722265Not Available602Open in IMG/M
3300031748|Ga0318492_10128356All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1265Open in IMG/M
3300031754|Ga0307475_11173455Not Available599Open in IMG/M
3300031764|Ga0318535_10137059All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1087Open in IMG/M
3300031764|Ga0318535_10162040Not Available998Open in IMG/M
3300031765|Ga0318554_10246168All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → unclassified Nonomuraea → Nonomuraea sp. H164311018Open in IMG/M
3300031765|Ga0318554_10249899Not Available1010Open in IMG/M
3300031768|Ga0318509_10043826All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2253Open in IMG/M
3300031769|Ga0318526_10175569Not Available874Open in IMG/M
3300031769|Ga0318526_10236576Not Available747Open in IMG/M
3300031770|Ga0318521_10424993Not Available794Open in IMG/M
3300031771|Ga0318546_10066293All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2293Open in IMG/M
3300031771|Ga0318546_10312491All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1089Open in IMG/M
3300031793|Ga0318548_10240064Not Available890Open in IMG/M
3300031794|Ga0318503_10099922Not Available921Open in IMG/M
3300031794|Ga0318503_10305350Not Available517Open in IMG/M
3300031797|Ga0318550_10063961All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1680Open in IMG/M
3300031799|Ga0318565_10122114All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1257Open in IMG/M
3300031819|Ga0318568_10397578Not Available858Open in IMG/M
3300031821|Ga0318567_10547867Not Available657Open in IMG/M
3300031831|Ga0318564_10224558All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia835Open in IMG/M
3300031831|Ga0318564_10535163Not Available507Open in IMG/M
3300031832|Ga0318499_10380632Not Available541Open in IMG/M
3300031833|Ga0310917_10331542Not Available1031Open in IMG/M
3300031846|Ga0318512_10163259All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1079Open in IMG/M
3300031860|Ga0318495_10121462Not Available1177Open in IMG/M
3300031879|Ga0306919_11211496Not Available573Open in IMG/M
3300031890|Ga0306925_11939458Not Available558Open in IMG/M
3300031897|Ga0318520_10140018All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1394Open in IMG/M
3300031910|Ga0306923_12180054All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → unclassified Nonomuraea → Nonomuraea sp. H16431556Open in IMG/M
3300031946|Ga0310910_10965374All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia667Open in IMG/M
3300031946|Ga0310910_11188905Not Available592Open in IMG/M
3300031959|Ga0318530_10229801Not Available763Open in IMG/M
3300032008|Ga0318562_10403084All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia795Open in IMG/M
3300032010|Ga0318569_10102316All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1296Open in IMG/M
3300032010|Ga0318569_10266230Not Available797Open in IMG/M
3300032025|Ga0318507_10315736All Organisms → cellular organisms → Bacteria → Terrabacteria group680Open in IMG/M
3300032025|Ga0318507_10537919All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea508Open in IMG/M
3300032039|Ga0318559_10079324Not Available1427Open in IMG/M
3300032039|Ga0318559_10547554All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300032042|Ga0318545_10158364Not Available806Open in IMG/M
3300032043|Ga0318556_10682100Not Available535Open in IMG/M
3300032044|Ga0318558_10157652All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1095Open in IMG/M
3300032044|Ga0318558_10294837Not Available801Open in IMG/M
3300032055|Ga0318575_10287444Not Available831Open in IMG/M
3300032055|Ga0318575_10458049Not Available648Open in IMG/M
3300032059|Ga0318533_11302456All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → unclassified Amycolatopsis → Amycolatopsis sp. FDAARGOS 1241531Open in IMG/M
3300032060|Ga0318505_10201046All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium933Open in IMG/M
3300032064|Ga0318510_10029561All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1823Open in IMG/M
3300032065|Ga0318513_10535793Not Available573Open in IMG/M
3300032074|Ga0308173_10290754Not Available1401Open in IMG/M
3300032090|Ga0318518_10504060All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia620Open in IMG/M
3300032091|Ga0318577_10314496All Organisms → cellular organisms → Bacteria749Open in IMG/M
3300032094|Ga0318540_10090472Not Available1430Open in IMG/M
3300032160|Ga0311301_10094250All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia5942Open in IMG/M
3300032205|Ga0307472_102663073Not Available510Open in IMG/M
3300032261|Ga0306920_104160633All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia522Open in IMG/M
3300032805|Ga0335078_10801926All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Hamadaea → Hamadaea flava1148Open in IMG/M
3300032805|Ga0335078_11886124All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium645Open in IMG/M
3300032828|Ga0335080_11070950All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia817Open in IMG/M
3300032892|Ga0335081_12357791All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300033134|Ga0335073_10027197All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia7891Open in IMG/M
3300033134|Ga0335073_10793199All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1018Open in IMG/M
3300033158|Ga0335077_11768622Not Available582Open in IMG/M
3300033289|Ga0310914_10785147Not Available850Open in IMG/M
3300033290|Ga0318519_10532699Not Available710Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil42.13%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere7.87%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil7.30%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil5.06%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.93%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.25%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa2.81%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.69%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.69%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.69%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.69%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.69%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.69%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.69%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil1.12%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.12%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.12%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.12%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.12%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere1.12%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.12%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil1.12%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.56%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.56%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.56%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.56%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.56%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.56%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.56%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.56%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.56%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.56%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.56%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.56%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.56%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.56%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006604Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010147Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010154Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010341Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010867Boreal forest soil eukaryotic communities from Alaska, USA - C3-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010869Boreal forest soil eukaryotic communities from Alaska, USA - W4-4 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011107Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300015201Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)EnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017932Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4EnvironmentalOpen in IMG/M
3300017937Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4EnvironmentalOpen in IMG/M
3300018006Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4EnvironmentalOpen in IMG/M
3300018023Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026291Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 (SPAdes)EnvironmentalOpen in IMG/M
3300026475Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-AEnvironmentalOpen in IMG/M
3300027824Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027910Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes)EnvironmentalOpen in IMG/M
3300028742Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_3EnvironmentalOpen in IMG/M
3300028789Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030490Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3EnvironmentalOpen in IMG/M
3300030580II_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031769Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031794Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031831Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20EnvironmentalOpen in IMG/M
3300031832Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031959Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032025Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20EnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032042Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032060Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18EnvironmentalOpen in IMG/M
3300032064Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17EnvironmentalOpen in IMG/M
3300032065Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20EnvironmentalOpen in IMG/M
3300032074Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032091Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25EnvironmentalOpen in IMG/M
3300032094Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0070683_10045975513300005329Corn RhizospherePYSLILLGDDMLLFDREEYDPDRGTWRALPPGDPGRSNR*
Ga0066388_10320818823300005332Tropical Forest SoilPYSLILLGDDMMLFDREEYDPERGTWRALAAGDPGRDNR*
Ga0066388_10533861613300005332Tropical Forest SoilGTGPSPYSLILLGDDMLLFEREEYDAGRGRWRGLAAGDPGRSNR*
Ga0070714_10169384123300005435Agricultural SoilGTGPSPYSLILLGDDMYLFDREEYDPGQGTWRKLAPGDPGQSHR*
Ga0070713_10195590213300005436Corn, Switchgrass And Miscanthus RhizosphereVLGTGPSPYSLILLGDNMYLFERQEYDPEQGMWRSLAPGDEGRSHR*
Ga0070705_10162796713300005440Corn, Switchgrass And Miscanthus RhizosphereSPYSLILLGDDMYLFDREEYDPGQGTWRKLAPGDPGQSHR*
Ga0070700_10198831913300005441Corn, Switchgrass And Miscanthus RhizosphereGLHPLPPLLGRCDGMYVFEREEYDPERGTWRNLAPGDPGRSHR*
Ga0070694_10108166723300005444Corn, Switchgrass And Miscanthus RhizospherePSPYSLILLGDDMLLFEREEYDPDRGRWRGLAAGDPGRSHR*
Ga0070706_10191011513300005467Corn, Switchgrass And Miscanthus RhizospherePSPYSLILLGDDMLLFDREEYDPGRGTWRALAPGNPGRDNR*
Ga0070698_10027814923300005471Corn, Switchgrass And Miscanthus RhizosphereMWPDRVSPYSLILLGDDMLLFDREEYDPERGSWRALAPGNPGRDNR*
Ga0070665_10236298913300005548Switchgrass RhizosphereILLGDDMLVFEREEYDPERGTWQALAPGDPGRSNR*
Ga0068856_10048542333300005614Corn RhizosphereILLGNDMFLFNREEYDPERGTWRALGPGDPGQSDR*
Ga0068856_10157428813300005614Corn RhizosphereGSGPSPYSLILLGDDMLLFDREEYDPERRTWRALAPGNPGRDNR*
Ga0066903_10653206313300005764Tropical Forest SoilPSPYSLILLGDNMLLFEREEYDPERGTWQRLAPGDPGRSNR*
Ga0066903_10885765513300005764Tropical Forest SoilSPYSLILLGDDMLLFEREEYDPDRGRWRGLAAGDPGRSNR*
Ga0070717_1196318613300006028Corn, Switchgrass And Miscanthus RhizospherePYSLILLGDDMYVFEREEYDPEQGTWRNLAPGDPGRSHR*
Ga0070712_10099452813300006175Corn, Switchgrass And Miscanthus RhizosphereILLGDDMLLFEREEYDPGQGTWRGLAPGDPGRPNR*
Ga0097621_10106860323300006237Miscanthus RhizosphereTGPSPYSLILLGDDMYLFDREEYDPGQETWRKLAPGDPGRSHR*
Ga0068871_10058291413300006358Miscanthus RhizosphereGTGPSPYSLILLSDDMYLFDREEYDPGQETWRKLAPGDPGRSHR*
Ga0074060_1195622833300006604SoilPSPYSLILLGDDMLLFEREEYDPERGTWQQLAPGDPGRSHR*
Ga0079222_1218923023300006755Agricultural SoilVLGTGPSPYSLILLGDDMYLFDREEYDPGQETWRKLAPGDPGRSHR*
Ga0079220_1047226033300006806Agricultural SoilYSLILLGDDMYAFEREEYDPAQGTWRNLAPGDPGRSHR*
Ga0075424_10109127813300006904Populus RhizospherePSPYSLILLGDDMLLFDREEYDPERGTWRALAPGNPGRDNR*
Ga0075424_10260561923300006904Populus RhizosphereLLGDDMLLFDREEYDPDRGTWRALAPGDPGRANR*
Ga0079219_1036757313300006954Agricultural SoilLILLGDDMLLFDREEYDPDGGTWRALPPGDPGRANR*
Ga0105237_1091577213300009545Corn RhizosphereYSLILLGDDMYVFEREEYDPEQGIWRKLAPGDPGRSHR*
Ga0116216_1031668533300009698Peatlands SoilLGTGPSPYSLILLGDNMYLFEREEYDPEQGTWRTLAPGDEGRSHR*
Ga0126374_1140005723300009792Tropical Forest SoilPYSLILLGDDMLLFDREEYDPERGTWRALAPGDPGQDNR*
Ga0126319_136839313300010147SoilGPSPYSLILLGENMLVFEREEYDPERGTWRRLAPGDPGRSNR*
Ga0127503_1099866313300010154SoilILLGDNMLAFEREEYDPERGTWRRLAPGDPGRSNR*
Ga0074045_1003888513300010341Bog Forest SoilPYSLILLGDDMYLYEREEYDPQQRTWRKLAPGDPGRSHR*
Ga0126376_1260088013300010359Tropical Forest SoilSPYSLILLGDDMLLFDREEYDPGRGTWRALAPGDPGRDNR*
Ga0126372_1029987913300010360Tropical Forest SoilLILLGDDMLLFEREEYDPDRGRWRGLAAGDPGRSHR*
Ga0126372_1126237633300010360Tropical Forest SoilGPSPYSLILLGDNMLLFEREEYDPEQGTWQRLAPGDPGRSNR*
Ga0126372_1175042513300010360Tropical Forest SoilLILLGDDMLLFEREEYDPARGRWRGLAAGDPGRSHR*
Ga0136449_10254711113300010379Peatlands SoilILLGDDMYLYEREEYDPQQGTWRKLAPGNPGRSHR*
Ga0134126_1082650523300010396Terrestrial SoilPYFLILLGDDMLLFSRKEYDPGQGTWHALSPGDPGRSNR*
Ga0126383_1208210913300010398Tropical Forest SoilSLILLGDDMLLFEREEYDPERGTWQGLAPGDPGRANR*
Ga0126383_1227497523300010398Tropical Forest SoilPTPYSLILLGDNMLVFEREEYDPDRGTWRRLAPGDPGRSNR*
Ga0126347_110523913300010867Boreal Forest SoilMTPAHCATSFILLGDDMYLFERKEYDPEQGTWRKLAPGDPGRPHR*
Ga0126359_143606923300010869Boreal Forest SoilMVERWALTMTPAHCATSFILLGDDMYLFERKEYDPEQGTWRKLAPGDPGRPHR*
Ga0151490_102303233300011107SoilSPYSLILLGDDMLLFEREEYDPERGTWQQLAPGDPGRSHR*
Ga0137383_1129162613300012199Vadose Zone SoilYSLILLGDNMLAFEREEYDPERGTWRRLAPGDPGRSNR*
Ga0137365_1012169133300012201Vadose Zone SoilMVMSPARPSPYSLILLGDDMLLFEREECDPERGTWRGLAPGDPGRANR*
Ga0150984_11125118413300012469Avena Fatua RhizosphereLGSGPSPYSLILLGDDMYLFEREEYDLEQGTWRQLAPGDPGRSHR*
Ga0126375_1141539413300012948Tropical Forest SoilYSLILLVNDMFLFERQEYDPERGTWRALAPGDPGRSNR*
Ga0164304_1114803513300012986SoilLLGDDMYLFDREEYDPGQGTWRKLAPGDPGQSHR*
Ga0164305_1202822613300012989SoilYSLILLGDDMLLFSRKEYDPGQGTWRALAPGDPGRSNR*
Ga0157373_1115205913300013100Corn RhizosphereYSLILLGDDMLLFDREEYDPDGGTWRPLAPGDPGRANR*
Ga0157369_1159958723300013105Corn RhizosphereSLILLGDDMYAFEREEYDPAQGTWRNLAPGDPGRSHR*
Ga0157369_1202215213300013105Corn RhizospherePSPYSLILLGDDMYLFERKEYDPEKGTWRKLAPGDPGRSHR*
Ga0163162_1132917213300013306Switchgrass RhizospherePSPYSLILLGDDMLLFEREEYDPERGKWQALAPGDPGRSNR*
Ga0173478_1015127913300015201SoilSLILLGDDMYVFEREEYDPDQGTWRTLAPGDPGRSHR*
Ga0132257_10028294533300015373Arabidopsis RhizosphereYSLILLGDDHVPLEREEYDAERGTWRNLAPGDPGRSHR*
Ga0132257_10146811823300015373Arabidopsis RhizosphereSPYSLILLGDDMLLFDREEYDPVRGTWRALAPGNPGRDNR*
Ga0132255_10187915213300015374Arabidopsis RhizosphereLLGDDMLVFEREEYDPERGTWQALAPGDPGRSNR*
Ga0182036_1162209723300016270SoilYSLILLGNDMFLFNREEYDPEQGTWRALGPGDPGRSNR
Ga0182041_1115539523300016294SoilYSLILLGNDMFLFERQEYDPDRGTWRALAPGDPGRSNR
Ga0182041_1195943313300016294SoilYSLILLGNDMFLFERQEYDPERGTWRALAPGDPGRSNR
Ga0182033_1051990433300016319SoilGTGPSPYSLILLGDDMLVFEREEYDPEQRTWQRLAPGDPGRSNR
Ga0182035_1097698413300016341SoilIGSGPSPYSLVLLGDDMMLFDREEYDPEQGTWRALAAGDPGRDNR
Ga0182035_1207112113300016341SoilGTGPSPYSLILLGDDMLLFEREEYDPDRGRWRGLAAGDPGRSNR
Ga0182034_1125139913300016371SoilRPCRRLRPNPYSLILFGDDILQFDREEYDPEQGTWRALGPGDPGWSNR
Ga0182034_1195731513300016371SoilSLILLGDDMLLFEREEYDPQQGTWRGLAPGDPGRSNR
Ga0182038_1136082413300016445SoilPSPYSLILLGNDMFLFNREEYDTEQATWRALGPGDPGRSNR
Ga0187814_1006920923300017932Freshwater SedimentLILLGNDMLLFDREEYDPEQGTWRALAPGDPGRSNR
Ga0187809_1029409813300017937Freshwater SedimentTGPTPYSLILLGDNMFVFEREEYDPDEGTCWTLAPGDPGKDNRPSPLHPR
Ga0187804_1026139523300018006Freshwater SedimentSLILLGDDMLLFDRQEYDPERGTWRALAPGDPGRDNR
Ga0187889_1041220313300018023PeatlandYSLILLGDDMYLFERKEYDPGQGTWRKLAPGDPGRSHR
Ga0210407_1137083613300020579SoilLILLGDDMYLFERKEYDAEKGTWRKLAPGDPGRSHR
Ga0210399_1051898123300020581SoilGTGPAPYSLILLGDNMFVFERQEYDPDEGTCWTLAPGDPGKDNRPSPLHPR
Ga0210399_1142277113300020581SoilLILLGDDMLLFGREEYDPERGTWRALPPGDPGRDNR
Ga0210393_1071821013300021401SoilSLILLGDDMYLFERKEYNPQQGTWQALAPGDPGRSHR
Ga0210385_1056173513300021402SoilGSGPSPYSLILLADNMYLFERKEYDPERGTWQPLHPGDPGRSHR
Ga0210387_1058278923300021405SoilGPSPYSLILLADNMYLFERREYDPQQGTWRTLAPGDPGRSHR
Ga0210383_1050077823300021407SoilMAMSPGSGPSPYSLILLGDDMLLFNREEYDLDQGTWHALAPGDPGRDNR
Ga0210402_1056603933300021478SoilPYSLILLGDDMLLFDREEYDPERGTWQALAPGDPGRDNR
Ga0210402_1063345443300021478SoilSLILLGDDMLLFEREEYDPDRGRWRGLAAGDPGRSHR
Ga0126371_1266837313300021560Tropical Forest SoilSPYSLILLGNDMLLFERQEYDPERGTWHALAPGDPGRSNR
Ga0207692_1081584013300025898Corn, Switchgrass And Miscanthus RhizosphereLILLGDNMYLFERQEYDSEQGMWRSLAPGDEGRSHR
Ga0207684_1070695213300025910Corn, Switchgrass And Miscanthus RhizosphereYSLILLGDDMYLFDREEYDPGQETWRKLAPGDPGQSHR
Ga0207687_1166543013300025927Miscanthus RhizospherePSPYSLILLGDDMYLFEREEYDPEKGTWRKLAPGDPGRSHR
Ga0207700_1123695713300025928Corn, Switchgrass And Miscanthus RhizosphereILLGDDMLLFQRAEYDPERGTWRALAPGDPGRAHR
Ga0207665_1049565413300025939Corn, Switchgrass And Miscanthus RhizospherePYSLILLGDDMLLFEREEYDPQLGTWRGLAPGDPGRSHR
Ga0207665_1151402813300025939Corn, Switchgrass And Miscanthus RhizosphereYSLILLGDDMLLFSRKEYDPGQGTWRALAPGDPGRSNR
Ga0207678_1075626813300026067Corn RhizosphereSPYSLILLGDDMLLFDREEYDPGQGTWRALAPGDPGRDNR
Ga0207708_1090336713300026075Corn, Switchgrass And Miscanthus RhizosphereVAGSGPSPYSLILLGDDMLLFDREEYDPGRGTWRALAPGNPGRDNR
Ga0209890_1025266523300026291SoilLILLGDDMLLFDREEYDPERATWRALTPGNPGRDNR
Ga0257147_104508813300026475SoilLILLGDNMLVFEREEYDPERGTWRRLAPGDPGRSNR
Ga0209040_1035991423300027824Bog Forest SoilTGPAPYTLVLLGDNMYLFERQEYDPAAGTWQALEPGDPGRSNR
Ga0209040_1045113713300027824Bog Forest SoilTGPSPYSLILLGDNMYLFEREEYDPQQGTWRKLAPGDPGHSHR
Ga0209040_1045833713300027824Bog Forest SoilTGPSPYSLILLGDNMYLFEREEYDPQQGTWRKRAPGDPGHSHR
Ga0209583_1030025423300027910WatershedsPYSLILLGDDMLLFERQEYDPELGTWHALRPGDPGRSHR
Ga0302220_1026465313300028742PalsaSLILLGDNMYLYERKEYDPEEGIWRKLAPGDPGRSHR
Ga0302232_1022947623300028789PalsaILLGDDMYLFERKEYDPDQGTWRTLAPGDPGRPHR
Ga0222749_1029101633300029636SoilYSIILLGDEMLLFEREEYDPERGTWRRLAPGDPGRSNR
Ga0311339_1092466323300029999PalsaLILLGDDMYLFERKEYDPDQGTWRTLAPGDPGRPHR
Ga0302184_1012317613300030490PalsaYSLILLGDDQLLFEREEFDLEQGTWRLLPPADPGQTNR
Ga0311355_1082008813300030580PalsaILLGDNMYLYEREEYDPQQGTWRKLAPGDEGRSHR
Ga0318534_1009320413300031544SoilPTPYSLILLGDDMLLFEREEYDPDRGRWRGLAAGDPGRSHR
Ga0318538_1001154453300031546SoilPYSLILLGDNMLVFEREEYDPERGTWQRLAPGDPGRSNR
Ga0318538_1010966523300031546SoilGPSPYSLILLGNDMYLFERQEYDPDQGTWRTLAPGDPGRPNR
Ga0318571_1018359933300031549SoilPSPYSLILLGNDMFLFERQEYDPERGTWRALAPGDPGRPNR
Ga0318528_1013839813300031561SoilVRGSGPTPYSLILLGDDMLLFEREEYDPDRGRWRGLAAGDPGRSHR
Ga0318515_1048261023300031572SoilMGSGPSPYSLILLGDDMMLFDREEYDPERGTWHALAAGDPGRDNR
Ga0318561_1046354113300031679SoilTPYSLILLGDDMLLFGREEYDPEQGTCRPLAPGNPGRDNR
Ga0318561_1048513713300031679SoilPSPYSLILLGNDMFLFNREEYDPQRGTWRALGPGDLGQSNR
Ga0318572_1020834433300031681SoilIGTGPSPYSLILLGDDMLVFEREEYDPEQRTWQRLAPGDPGRSNR
Ga0318560_1035236223300031682SoilILLGDDMLLFDREEYDPEQGTWQALAPGDPGRDNR
Ga0318496_1005682133300031713SoilIRGTGPSPYSLILLGDDMLLFEREEYDPDRGRWRGLAAGDPGRSNR
Ga0318500_1003468413300031724SoilGPSPYSLILLGDDMLLFEREEYDPDRGRWRGLAAGDPGRSNR
Ga0318500_1055078813300031724SoilGPSPYSLILLGDNMLLFEREEYDPQQGTWGALAPGDPGRSNR
Ga0318502_1072226523300031747SoilPYSLILLGDDMLLFEREEYDPDRGRWRGLAAGDPGRSNR
Ga0318492_1012835613300031748SoilHVTGTGPSPYSLILLGNDMLLFERQEYDPERGTWRALAPGDQGRSNR
Ga0307475_1117345513300031754Hardwood Forest SoilLILLGDNMYLYEREEYDPERGTWRRLAPGDEGRSHR
Ga0318535_1013705933300031764SoilASPYSLILLGDDMLLFDREEYDPEQGTWQALAPGDPGRADR
Ga0318535_1016204013300031764SoilYSLILLGDDMLLFGREEYDPEQGTCRPLAPGNPGRDNR
Ga0318554_1024616833300031765SoilVLGTGPSPYSIILLGDDMLVFEREEYDPELGTWLRLAPGDAGRENR
Ga0318554_1024989913300031765SoilPYSLILLGDDMLLFDREEYDPGQGTWRELAPGDPGRSHR
Ga0318509_1004382633300031768SoilRGTGPSPYSLILLGDDMLLFEREEYDPDRGRWRGLAAGDPGRSNR
Ga0318526_1017556913300031769SoilPYTLVLLGDNMYLFERQEYDPAEGTWQALEPGDPGRSNR
Ga0318526_1023657623300031769SoilSPYSLIMLGDDMLLFDREEYDPEQGTWRALGPGDPGWSNR
Ga0318521_1042499313300031770SoilPYSLILLGDDMLLFEREEYDPDRGRWRGLAAGDPGRSHR
Ga0318546_1006629333300031771SoilILLCDDMLLFEREEYDPYLGTWGRLAPGDPGRSHR
Ga0318546_1031249113300031771SoilILLGDDMLLFGREEYDPEQGTCRPLAPGDPGRDNR
Ga0318548_1024006423300031793SoilSPYSLIMLGDDMLLFDREEYDPEQGTWRALGPGDPGRSNR
Ga0318503_1009992223300031794SoilPYSLILLGDDMLLFERHEYDPELGTWRELAPGDPGRPNR
Ga0318503_1030535013300031794SoilSLILLGNDMYLFERQEYDPDQGTWRTLAPGDPGRPNR
Ga0318550_1006396133300031797SoilVTESGATPYSLILLGDDMLLFGREEYDPEQGTCRPLAPGNPGRDNR
Ga0318565_1012211433300031799SoilTPYSLILLGDDMLLFEREEYDPDRGRWRGLAAGDPGRSHR
Ga0318568_1039757823300031819SoilPYSLILLGDDMLLFGREEYDPEQGTCRPLAPGDPGRDNR
Ga0318567_1054786733300031821SoilILLGDDMLLFDREEYDPERGTWRELAPGDPGRDNR
Ga0318564_1022455813300031831SoilPYSLILLGDDMLLFDREEYDPEQGTWQALAPGDPGRPNR
Ga0318564_1053516313300031831SoilSPYSLILLGDDMLLFERHEYDPELGTWRELAPGDPGRPNR
Ga0318499_1038063213300031832SoilTGPSPYSLILLGDDMLLFQREEYDPDLGTWQELAPGDPGRSNR
Ga0310917_1033154223300031833SoilTGPSPYSLILLGDDMLLFEREEYDSDRGRWRGLAAGDPGRSNR
Ga0318512_1016325913300031846SoilGPTPYSLILLGDDMLLFEREEYDPDRGRWRGLAAGDPGRSHR
Ga0318495_1012146223300031860SoilTPYSLILLGDDMLLFGREEYDPEQGTCRPLAPGDPGRDNR
Ga0306919_1121149623300031879SoilGPSPYSLILLGDDMLLFEREEYDPDLGTWRGLAPGDPGRSHR
Ga0306925_1193945823300031890SoilTGPSPYSLILLGNDMFLFNREEYDLQRGTWRTLGPGDPGQSNR
Ga0318520_1014001843300031897SoilGPSPYSLILLGNDMFLFNREEYDTEQATWRALGPGDPGRSNR
Ga0306923_1218005423300031910SoilSIILLGDDMLRFEREEYDPEEGTWQRLAPGDPGQENR
Ga0310910_1096537423300031946SoilNHGHVIGSGPSPYSLVLLGDDMMLFDREEYDPEQGTWRALAAGDPGRDNR
Ga0310910_1118890523300031946SoilYSLILLGDDMLLFEREEYDPGRGRWRGLAAGDPGRSHR
Ga0318530_1022980113300031959SoilLILLGDDMLLFEREEYDPDRGRWRGLAAGDPGRSHR
Ga0318562_1040308413300032008SoilLVLLGDDMMLFDREEYDPERGTWRALAAGDPGRDNR
Ga0318569_1010231613300032010SoilVLGTGPSPYSLILLCDDMLLFEREEYDPYLGTWGRLAPGDPGRSHR
Ga0318569_1026623013300032010SoilHVAGTGPSPYSLILLGNDMFLFNREEYDPQRGTWRALGPGDPGQSNR
Ga0318507_1031573613300032025SoilTGASPYSLILLGNDMFLFNREEYDPQRGTWRALAPGDLGQSNR
Ga0318507_1053791913300032025SoilPYSIILLGDDMLVFEREEYDPELGTWLRLAPGDAGRENR
Ga0318559_1007932413300032039SoilPSPYSLILLGNDMYLFERQEYDPDQGTWRTLAPGDPGRPNR
Ga0318559_1054755413300032039SoilGHVVGSGPSPYSLIMLGDDMLLFDREEYDPEQGTWRALGPGDPGWSNR
Ga0318545_1015836423300032042SoilGSGPTPYSLILLGDDMLLFEREEYDPDRGRWRGLAAGDPGRSHR
Ga0318556_1068210033300032043SoilSPYSLILLGDDMLLFDREEYDAERGTWRELAPGDPGRDNR
Ga0318558_1015765213300032044SoilSPYSLILLGDDMLLFQREEYDPDLGTWQELAPGDPGRSNR
Ga0318558_1029483723300032044SoilPAPYSLILLGDDMLLFEREEYDPDRGRWRGLAAGDPGRSHR
Ga0318575_1028744413300032055SoilVTGTGPSPYSLILLGNDMFLFNREEYDLQRGTWRTLGPGDPGQSNR
Ga0318575_1045804923300032055SoilSPYSLILLGDDMLLFEREEYDPQRGTWRGLAPGDPGRSNR
Ga0318533_1130245613300032059SoilSPYSLILLGDNMLLFEREEYDPQQGTWGALAPGDPGRSNR
Ga0318505_1020104633300032060SoilTGPSPYSLILLGDDMLVFEREEYDPEQRTWQRLAPGDPGRSNR
Ga0318510_1002956113300032064SoilSPYSLILLGDDMLLFEREEYDPDRGTWRGLAPGDPGRSNR
Ga0318513_1053579313300032065SoilILLGDDMLLFNREEYDPERGTWHPLAPGDPGRDNR
Ga0308173_1029075413300032074SoilMKQVGQVLPGDDMLLFDQEEYDPERGTWRALAPGDPARDNR
Ga0318518_1050406023300032090SoilPSPYSLILLGDDMLLFDREEYDPEQGTWQALAPGDPGRPNR
Ga0318577_1031449623300032091SoilHGHVTGTGPSPYSLILLGNDMFLFERQEYDPERGTWRALASGDPGRSNR
Ga0318540_1009047213300032094SoilPSPYSLIPLGDDMLLFERHEYDPELGTWRELAPGDPGRPNR
Ga0311301_1009425073300032160Peatlands SoilSLILLGDDMYLYEREEYDPQQRTWRKLAPGDPGRSHR
Ga0307472_10266307313300032205Hardwood Forest SoilYSLILLGNDMFLFNREEYDPERGTWRALGPGDPGQSDR
Ga0306920_10416063323300032261SoilGHVPGSGPSPYSLVLLGDDMMLFDREEYDPERGTWHALAAGDPGRDNR
Ga0335078_1080192613300032805SoilTGPAPYSLILLGDNMFVFEREEYDPGEGTCWTLAPGDPGKDNRPSPLHPR
Ga0335078_1188612433300032805SoilILLGDDMLLFEREEYDPEQGTWRRLAPGDPGRPNR
Ga0335080_1107095013300032828SoilAGTGPSPHSLILLGDDMLLFDREEYDPEQGTWQPLASGDPGRADR
Ga0335081_1235779113300032892SoilVLLGDDMLLFSRKEYDPGQGTWRALSPGDPGRSDR
Ga0335073_1002719773300033134SoilMFPGTGSSPYSLILLGDDILLFDREEYDLEQGTWRALAPGARH
Ga0335073_1079319923300033134SoilTGASPYSLILLGDDMLLFDREEYDVQTGTWKALAAGDPGRSNRGLSR
Ga0335077_1176862213300033158SoilSPYSLILLGDNMLLFRREEYDTDRGTWQALVPGDPGRDNR
Ga0310914_1078514713300033289SoilLILLGNDMFLFNREEYDLQRGTWRTLGPGDPGQSNR
Ga0318519_1053269923300033290SoilYSLILLGDDMLLFEREEYDPARGTWRGLAPGDPGRSNR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.