Basic Information | |
---|---|
Family ID | F033140 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 178 |
Average Sequence Length | 40 residues |
Representative Sequence | SPYSLILLGDDMLLFEREEYDPDRGTWRGLAPGDPGRSNR |
Number of Associated Samples | 144 |
Number of Associated Scaffolds | 178 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 2.25 % |
% of genes near scaffold ends (potentially truncated) | 94.94 % |
% of genes from short scaffolds (< 2000 bps) | 95.51 % |
Associated GOLD sequencing projects | 136 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.50 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (57.865 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (42.135 % of family members) |
Environment Ontology (ENVO) | Unclassified (43.258 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Unclassified (42.697 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 29.41% Coil/Unstructured: 70.59% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 178 Family Scaffolds |
---|---|---|
PF02627 | CMD | 13.48 |
PF04199 | Cyclase | 7.87 |
PF07690 | MFS_1 | 5.06 |
PF00175 | NAD_binding_1 | 3.93 |
PF00892 | EamA | 3.37 |
PF07992 | Pyr_redox_2 | 3.37 |
PF00723 | Glyco_hydro_15 | 2.81 |
PF00106 | adh_short | 1.69 |
PF08241 | Methyltransf_11 | 1.69 |
PF04185 | Phosphoesterase | 1.12 |
PF11225 | DUF3024 | 1.12 |
PF11774 | Lsr2 | 1.12 |
PF13401 | AAA_22 | 1.12 |
PF04087 | DUF389 | 1.12 |
PF02922 | CBM_48 | 1.12 |
PF00561 | Abhydrolase_1 | 0.56 |
PF02126 | PTE | 0.56 |
PF00441 | Acyl-CoA_dh_1 | 0.56 |
PF07883 | Cupin_2 | 0.56 |
PF08044 | DUF1707 | 0.56 |
PF02574 | S-methyl_trans | 0.56 |
PF00667 | FAD_binding_1 | 0.56 |
PF13649 | Methyltransf_25 | 0.56 |
PF11139 | SfLAP | 0.56 |
PF10282 | Lactonase | 0.56 |
PF04672 | Methyltransf_19 | 0.56 |
PF13546 | DDE_5 | 0.56 |
PF13671 | AAA_33 | 0.56 |
PF07592 | DDE_Tnp_ISAZ013 | 0.56 |
PF04978 | DUF664 | 0.56 |
PF00005 | ABC_tran | 0.56 |
PF03992 | ABM | 0.56 |
PF00211 | Guanylate_cyc | 0.56 |
PF04264 | YceI | 0.56 |
PF01740 | STAS | 0.56 |
PF13466 | STAS_2 | 0.56 |
PF13826 | DUF4188 | 0.56 |
PF07859 | Abhydrolase_3 | 0.56 |
PF00196 | GerE | 0.56 |
PF00120 | Gln-synt_C | 0.56 |
COG ID | Name | Functional Category | % Frequency in 178 Family Scaffolds |
---|---|---|---|
COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 13.48 |
COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 13.48 |
COG1878 | Kynurenine formamidase | Amino acid transport and metabolism [E] | 7.87 |
COG3387 | Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 family | Carbohydrate transport and metabolism [G] | 2.81 |
COG1808 | Uncharacterized membrane protein AF0785, contains DUF389 domain | Function unknown [S] | 1.12 |
COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 1.12 |
COG0369 | Flavoprotein (flavin reductase) subunit CysJ of sulfite and N-hydroxylaminopurine reductases | Nucleotide transport and metabolism [F] | 0.56 |
COG0646 | Methionine synthase I (cobalamin-dependent), methyltransferase domain | Amino acid transport and metabolism [E] | 0.56 |
COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 0.56 |
COG1735 | Predicted metal-dependent hydrolase, phosphotriesterase family | General function prediction only [R] | 0.56 |
COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.56 |
COG2040 | Homocysteine/selenocysteine methylase (S-methylmethionine-dependent) | Amino acid transport and metabolism [E] | 0.56 |
COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.56 |
COG2353 | Polyisoprenoid-binding periplasmic protein YceI | General function prediction only [R] | 0.56 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 57.87 % |
Unclassified | root | N/A | 42.13 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300005329|Ga0070683_100459755 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1215 | Open in IMG/M |
3300005332|Ga0066388_103208188 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 836 | Open in IMG/M |
3300005332|Ga0066388_105338616 | Not Available | 652 | Open in IMG/M |
3300005435|Ga0070714_101693841 | Not Available | 617 | Open in IMG/M |
3300005436|Ga0070713_101955902 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 569 | Open in IMG/M |
3300005440|Ga0070705_101627967 | Not Available | 544 | Open in IMG/M |
3300005441|Ga0070700_101988319 | Not Available | 504 | Open in IMG/M |
3300005444|Ga0070694_101081667 | Not Available | 668 | Open in IMG/M |
3300005467|Ga0070706_101910115 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 539 | Open in IMG/M |
3300005471|Ga0070698_100278149 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1605 | Open in IMG/M |
3300005548|Ga0070665_102362989 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
3300005614|Ga0068856_100485423 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1256 | Open in IMG/M |
3300005614|Ga0068856_101574288 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 670 | Open in IMG/M |
3300005764|Ga0066903_106532063 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
3300005764|Ga0066903_108857655 | Not Available | 510 | Open in IMG/M |
3300006028|Ga0070717_11963186 | Not Available | 528 | Open in IMG/M |
3300006175|Ga0070712_100994528 | Not Available | 726 | Open in IMG/M |
3300006237|Ga0097621_101068603 | Not Available | 757 | Open in IMG/M |
3300006358|Ga0068871_100582914 | Not Available | 1016 | Open in IMG/M |
3300006604|Ga0074060_11956228 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
3300006755|Ga0079222_12189230 | Not Available | 549 | Open in IMG/M |
3300006806|Ga0079220_10472260 | Not Available | 847 | Open in IMG/M |
3300006904|Ga0075424_101091278 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 851 | Open in IMG/M |
3300006904|Ga0075424_102605619 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
3300006954|Ga0079219_10367573 | All Organisms → cellular organisms → Bacteria | 934 | Open in IMG/M |
3300009545|Ga0105237_10915772 | Not Available | 884 | Open in IMG/M |
3300009698|Ga0116216_10316685 | Not Available | 950 | Open in IMG/M |
3300009792|Ga0126374_11400057 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 569 | Open in IMG/M |
3300010147|Ga0126319_1368393 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 601 | Open in IMG/M |
3300010154|Ga0127503_10998663 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 837 | Open in IMG/M |
3300010341|Ga0074045_10038885 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3520 | Open in IMG/M |
3300010359|Ga0126376_12600880 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 555 | Open in IMG/M |
3300010360|Ga0126372_10299879 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1412 | Open in IMG/M |
3300010360|Ga0126372_11262376 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 766 | Open in IMG/M |
3300010360|Ga0126372_11750425 | Not Available | 664 | Open in IMG/M |
3300010379|Ga0136449_102547111 | Not Available | 732 | Open in IMG/M |
3300010396|Ga0134126_10826505 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1046 | Open in IMG/M |
3300010398|Ga0126383_12082109 | Not Available | 655 | Open in IMG/M |
3300010398|Ga0126383_12274975 | Not Available | 628 | Open in IMG/M |
3300010867|Ga0126347_1105239 | Not Available | 529 | Open in IMG/M |
3300010869|Ga0126359_1436069 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. Tu6071 | 1327 | Open in IMG/M |
3300011107|Ga0151490_1023032 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 688 | Open in IMG/M |
3300012199|Ga0137383_11291626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 521 | Open in IMG/M |
3300012201|Ga0137365_10121691 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → unclassified Amycolatopsis → Amycolatopsis sp. DSM 110486 | 1963 | Open in IMG/M |
3300012469|Ga0150984_111251184 | Not Available | 506 | Open in IMG/M |
3300012948|Ga0126375_11415394 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 590 | Open in IMG/M |
3300012986|Ga0164304_11148035 | Not Available | 624 | Open in IMG/M |
3300012989|Ga0164305_12028226 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 526 | Open in IMG/M |
3300013100|Ga0157373_11152059 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
3300013105|Ga0157369_11599587 | Not Available | 663 | Open in IMG/M |
3300013105|Ga0157369_12022152 | Not Available | 585 | Open in IMG/M |
3300013306|Ga0163162_11329172 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 817 | Open in IMG/M |
3300015201|Ga0173478_10151279 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 923 | Open in IMG/M |
3300015373|Ga0132257_100282945 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1988 | Open in IMG/M |
3300015373|Ga0132257_101468118 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 869 | Open in IMG/M |
3300015374|Ga0132255_101879152 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 910 | Open in IMG/M |
3300016270|Ga0182036_11622097 | Not Available | 545 | Open in IMG/M |
3300016294|Ga0182041_11155395 | Not Available | 705 | Open in IMG/M |
3300016294|Ga0182041_11959433 | Not Available | 545 | Open in IMG/M |
3300016319|Ga0182033_10519904 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1025 | Open in IMG/M |
3300016341|Ga0182035_10976984 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 750 | Open in IMG/M |
3300016341|Ga0182035_12071121 | Not Available | 517 | Open in IMG/M |
3300016371|Ga0182034_11251399 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
3300016371|Ga0182034_11957315 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
3300016445|Ga0182038_11360824 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 635 | Open in IMG/M |
3300017932|Ga0187814_10069209 | All Organisms → cellular organisms → Bacteria | 1295 | Open in IMG/M |
3300017937|Ga0187809_10294098 | Not Available | 597 | Open in IMG/M |
3300018006|Ga0187804_10261395 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Agromyces → Agromyces humatus | 749 | Open in IMG/M |
3300018023|Ga0187889_10412203 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 583 | Open in IMG/M |
3300020579|Ga0210407_11370836 | Not Available | 526 | Open in IMG/M |
3300020581|Ga0210399_10518981 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Hamadaea → Hamadaea flava | 989 | Open in IMG/M |
3300020581|Ga0210399_11422771 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Tsukamurellaceae → Tsukamurella → unclassified Tsukamurella → Tsukamurella sp. PLM1 | 541 | Open in IMG/M |
3300021401|Ga0210393_10718210 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
3300021402|Ga0210385_10561735 | Not Available | 868 | Open in IMG/M |
3300021405|Ga0210387_10582789 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 994 | Open in IMG/M |
3300021407|Ga0210383_10500778 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Novosphingobium → Novosphingobium flavum | 1049 | Open in IMG/M |
3300021478|Ga0210402_10566039 | Not Available | 1054 | Open in IMG/M |
3300021478|Ga0210402_10633454 | Not Available | 990 | Open in IMG/M |
3300021560|Ga0126371_12668373 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
3300025898|Ga0207692_10815840 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 611 | Open in IMG/M |
3300025910|Ga0207684_10706952 | Not Available | 856 | Open in IMG/M |
3300025927|Ga0207687_11665430 | Not Available | 547 | Open in IMG/M |
3300025928|Ga0207700_11236957 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 666 | Open in IMG/M |
3300025939|Ga0207665_10495654 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 943 | Open in IMG/M |
3300025939|Ga0207665_11514028 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 533 | Open in IMG/M |
3300026067|Ga0207678_10756268 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 857 | Open in IMG/M |
3300026075|Ga0207708_10903367 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 764 | Open in IMG/M |
3300026291|Ga0209890_10252665 | Not Available | 547 | Open in IMG/M |
3300026475|Ga0257147_1045088 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 652 | Open in IMG/M |
3300027824|Ga0209040_10359914 | Not Available | 688 | Open in IMG/M |
3300027824|Ga0209040_10451137 | Not Available | 585 | Open in IMG/M |
3300027824|Ga0209040_10458337 | Not Available | 578 | Open in IMG/M |
3300027910|Ga0209583_10300254 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 729 | Open in IMG/M |
3300028742|Ga0302220_10264653 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 630 | Open in IMG/M |
3300028789|Ga0302232_10229476 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 922 | Open in IMG/M |
3300029636|Ga0222749_10291016 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
3300029999|Ga0311339_10924663 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 825 | Open in IMG/M |
3300030490|Ga0302184_10123176 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1149 | Open in IMG/M |
3300030580|Ga0311355_10820088 | Not Available | 852 | Open in IMG/M |
3300031544|Ga0318534_10093204 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1720 | Open in IMG/M |
3300031546|Ga0318538_10011544 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3690 | Open in IMG/M |
3300031546|Ga0318538_10109665 | Not Available | 1433 | Open in IMG/M |
3300031549|Ga0318571_10183599 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
3300031561|Ga0318528_10138398 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1293 | Open in IMG/M |
3300031572|Ga0318515_10482610 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 662 | Open in IMG/M |
3300031679|Ga0318561_10463541 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 697 | Open in IMG/M |
3300031679|Ga0318561_10485137 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 680 | Open in IMG/M |
3300031681|Ga0318572_10208344 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1143 | Open in IMG/M |
3300031682|Ga0318560_10352362 | Not Available | 795 | Open in IMG/M |
3300031713|Ga0318496_10056821 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2037 | Open in IMG/M |
3300031724|Ga0318500_10034684 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2051 | Open in IMG/M |
3300031724|Ga0318500_10550788 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 582 | Open in IMG/M |
3300031747|Ga0318502_10722265 | Not Available | 602 | Open in IMG/M |
3300031748|Ga0318492_10128356 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1265 | Open in IMG/M |
3300031754|Ga0307475_11173455 | Not Available | 599 | Open in IMG/M |
3300031764|Ga0318535_10137059 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1087 | Open in IMG/M |
3300031764|Ga0318535_10162040 | Not Available | 998 | Open in IMG/M |
3300031765|Ga0318554_10246168 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → unclassified Nonomuraea → Nonomuraea sp. H16431 | 1018 | Open in IMG/M |
3300031765|Ga0318554_10249899 | Not Available | 1010 | Open in IMG/M |
3300031768|Ga0318509_10043826 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2253 | Open in IMG/M |
3300031769|Ga0318526_10175569 | Not Available | 874 | Open in IMG/M |
3300031769|Ga0318526_10236576 | Not Available | 747 | Open in IMG/M |
3300031770|Ga0318521_10424993 | Not Available | 794 | Open in IMG/M |
3300031771|Ga0318546_10066293 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2293 | Open in IMG/M |
3300031771|Ga0318546_10312491 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1089 | Open in IMG/M |
3300031793|Ga0318548_10240064 | Not Available | 890 | Open in IMG/M |
3300031794|Ga0318503_10099922 | Not Available | 921 | Open in IMG/M |
3300031794|Ga0318503_10305350 | Not Available | 517 | Open in IMG/M |
3300031797|Ga0318550_10063961 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1680 | Open in IMG/M |
3300031799|Ga0318565_10122114 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1257 | Open in IMG/M |
3300031819|Ga0318568_10397578 | Not Available | 858 | Open in IMG/M |
3300031821|Ga0318567_10547867 | Not Available | 657 | Open in IMG/M |
3300031831|Ga0318564_10224558 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 835 | Open in IMG/M |
3300031831|Ga0318564_10535163 | Not Available | 507 | Open in IMG/M |
3300031832|Ga0318499_10380632 | Not Available | 541 | Open in IMG/M |
3300031833|Ga0310917_10331542 | Not Available | 1031 | Open in IMG/M |
3300031846|Ga0318512_10163259 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1079 | Open in IMG/M |
3300031860|Ga0318495_10121462 | Not Available | 1177 | Open in IMG/M |
3300031879|Ga0306919_11211496 | Not Available | 573 | Open in IMG/M |
3300031890|Ga0306925_11939458 | Not Available | 558 | Open in IMG/M |
3300031897|Ga0318520_10140018 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1394 | Open in IMG/M |
3300031910|Ga0306923_12180054 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → unclassified Nonomuraea → Nonomuraea sp. H16431 | 556 | Open in IMG/M |
3300031946|Ga0310910_10965374 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 667 | Open in IMG/M |
3300031946|Ga0310910_11188905 | Not Available | 592 | Open in IMG/M |
3300031959|Ga0318530_10229801 | Not Available | 763 | Open in IMG/M |
3300032008|Ga0318562_10403084 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 795 | Open in IMG/M |
3300032010|Ga0318569_10102316 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1296 | Open in IMG/M |
3300032010|Ga0318569_10266230 | Not Available | 797 | Open in IMG/M |
3300032025|Ga0318507_10315736 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 680 | Open in IMG/M |
3300032025|Ga0318507_10537919 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea | 508 | Open in IMG/M |
3300032039|Ga0318559_10079324 | Not Available | 1427 | Open in IMG/M |
3300032039|Ga0318559_10547554 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
3300032042|Ga0318545_10158364 | Not Available | 806 | Open in IMG/M |
3300032043|Ga0318556_10682100 | Not Available | 535 | Open in IMG/M |
3300032044|Ga0318558_10157652 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1095 | Open in IMG/M |
3300032044|Ga0318558_10294837 | Not Available | 801 | Open in IMG/M |
3300032055|Ga0318575_10287444 | Not Available | 831 | Open in IMG/M |
3300032055|Ga0318575_10458049 | Not Available | 648 | Open in IMG/M |
3300032059|Ga0318533_11302456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → unclassified Amycolatopsis → Amycolatopsis sp. FDAARGOS 1241 | 531 | Open in IMG/M |
3300032060|Ga0318505_10201046 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 933 | Open in IMG/M |
3300032064|Ga0318510_10029561 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1823 | Open in IMG/M |
3300032065|Ga0318513_10535793 | Not Available | 573 | Open in IMG/M |
3300032074|Ga0308173_10290754 | Not Available | 1401 | Open in IMG/M |
3300032090|Ga0318518_10504060 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 620 | Open in IMG/M |
3300032091|Ga0318577_10314496 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
3300032094|Ga0318540_10090472 | Not Available | 1430 | Open in IMG/M |
3300032160|Ga0311301_10094250 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia | 5942 | Open in IMG/M |
3300032205|Ga0307472_102663073 | Not Available | 510 | Open in IMG/M |
3300032261|Ga0306920_104160633 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 522 | Open in IMG/M |
3300032805|Ga0335078_10801926 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Hamadaea → Hamadaea flava | 1148 | Open in IMG/M |
3300032805|Ga0335078_11886124 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 645 | Open in IMG/M |
3300032828|Ga0335080_11070950 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 817 | Open in IMG/M |
3300032892|Ga0335081_12357791 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
3300033134|Ga0335073_10027197 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 7891 | Open in IMG/M |
3300033134|Ga0335073_10793199 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1018 | Open in IMG/M |
3300033158|Ga0335077_11768622 | Not Available | 582 | Open in IMG/M |
3300033289|Ga0310914_10785147 | Not Available | 850 | Open in IMG/M |
3300033290|Ga0318519_10532699 | Not Available | 710 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 42.13% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.87% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.30% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.06% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.93% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.25% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.81% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.69% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.69% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.69% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.69% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.69% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.69% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.69% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 1.12% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.12% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.12% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.12% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.12% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.12% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.12% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.12% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.56% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.56% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.56% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.56% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.56% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.56% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.56% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.56% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.56% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.56% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.56% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.56% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.56% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.56% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006604 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010147 | Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010867 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010869 | Boreal forest soil eukaryotic communities from Alaska, USA - W4-4 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011107 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300015201 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2) | Environmental | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
3300018023 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100 | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026291 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 (SPAdes) | Environmental | Open in IMG/M |
3300026475 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-A | Environmental | Open in IMG/M |
3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
3300028742 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_3 | Environmental | Open in IMG/M |
3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030490 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3 | Environmental | Open in IMG/M |
3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0070683_1004597551 | 3300005329 | Corn Rhizosphere | PYSLILLGDDMLLFDREEYDPDRGTWRALPPGDPGRSNR* |
Ga0066388_1032081882 | 3300005332 | Tropical Forest Soil | PYSLILLGDDMMLFDREEYDPERGTWRALAAGDPGRDNR* |
Ga0066388_1053386161 | 3300005332 | Tropical Forest Soil | GTGPSPYSLILLGDDMLLFEREEYDAGRGRWRGLAAGDPGRSNR* |
Ga0070714_1016938412 | 3300005435 | Agricultural Soil | GTGPSPYSLILLGDDMYLFDREEYDPGQGTWRKLAPGDPGQSHR* |
Ga0070713_1019559021 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | VLGTGPSPYSLILLGDNMYLFERQEYDPEQGMWRSLAPGDEGRSHR* |
Ga0070705_1016279671 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | SPYSLILLGDDMYLFDREEYDPGQGTWRKLAPGDPGQSHR* |
Ga0070700_1019883191 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | GLHPLPPLLGRCDGMYVFEREEYDPERGTWRNLAPGDPGRSHR* |
Ga0070694_1010816672 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | PSPYSLILLGDDMLLFEREEYDPDRGRWRGLAAGDPGRSHR* |
Ga0070706_1019101151 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | PSPYSLILLGDDMLLFDREEYDPGRGTWRALAPGNPGRDNR* |
Ga0070698_1002781492 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MWPDRVSPYSLILLGDDMLLFDREEYDPERGSWRALAPGNPGRDNR* |
Ga0070665_1023629891 | 3300005548 | Switchgrass Rhizosphere | ILLGDDMLVFEREEYDPERGTWQALAPGDPGRSNR* |
Ga0068856_1004854233 | 3300005614 | Corn Rhizosphere | ILLGNDMFLFNREEYDPERGTWRALGPGDPGQSDR* |
Ga0068856_1015742881 | 3300005614 | Corn Rhizosphere | GSGPSPYSLILLGDDMLLFDREEYDPERRTWRALAPGNPGRDNR* |
Ga0066903_1065320631 | 3300005764 | Tropical Forest Soil | PSPYSLILLGDNMLLFEREEYDPERGTWQRLAPGDPGRSNR* |
Ga0066903_1088576551 | 3300005764 | Tropical Forest Soil | SPYSLILLGDDMLLFEREEYDPDRGRWRGLAAGDPGRSNR* |
Ga0070717_119631861 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | PYSLILLGDDMYVFEREEYDPEQGTWRNLAPGDPGRSHR* |
Ga0070712_1009945281 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | ILLGDDMLLFEREEYDPGQGTWRGLAPGDPGRPNR* |
Ga0097621_1010686032 | 3300006237 | Miscanthus Rhizosphere | TGPSPYSLILLGDDMYLFDREEYDPGQETWRKLAPGDPGRSHR* |
Ga0068871_1005829141 | 3300006358 | Miscanthus Rhizosphere | GTGPSPYSLILLSDDMYLFDREEYDPGQETWRKLAPGDPGRSHR* |
Ga0074060_119562283 | 3300006604 | Soil | PSPYSLILLGDDMLLFEREEYDPERGTWQQLAPGDPGRSHR* |
Ga0079222_121892302 | 3300006755 | Agricultural Soil | VLGTGPSPYSLILLGDDMYLFDREEYDPGQETWRKLAPGDPGRSHR* |
Ga0079220_104722603 | 3300006806 | Agricultural Soil | YSLILLGDDMYAFEREEYDPAQGTWRNLAPGDPGRSHR* |
Ga0075424_1010912781 | 3300006904 | Populus Rhizosphere | PSPYSLILLGDDMLLFDREEYDPERGTWRALAPGNPGRDNR* |
Ga0075424_1026056192 | 3300006904 | Populus Rhizosphere | LLGDDMLLFDREEYDPDRGTWRALAPGDPGRANR* |
Ga0079219_103675731 | 3300006954 | Agricultural Soil | LILLGDDMLLFDREEYDPDGGTWRALPPGDPGRANR* |
Ga0105237_109157721 | 3300009545 | Corn Rhizosphere | YSLILLGDDMYVFEREEYDPEQGIWRKLAPGDPGRSHR* |
Ga0116216_103166853 | 3300009698 | Peatlands Soil | LGTGPSPYSLILLGDNMYLFEREEYDPEQGTWRTLAPGDEGRSHR* |
Ga0126374_114000572 | 3300009792 | Tropical Forest Soil | PYSLILLGDDMLLFDREEYDPERGTWRALAPGDPGQDNR* |
Ga0126319_13683931 | 3300010147 | Soil | GPSPYSLILLGENMLVFEREEYDPERGTWRRLAPGDPGRSNR* |
Ga0127503_109986631 | 3300010154 | Soil | ILLGDNMLAFEREEYDPERGTWRRLAPGDPGRSNR* |
Ga0074045_100388851 | 3300010341 | Bog Forest Soil | PYSLILLGDDMYLYEREEYDPQQRTWRKLAPGDPGRSHR* |
Ga0126376_126008801 | 3300010359 | Tropical Forest Soil | SPYSLILLGDDMLLFDREEYDPGRGTWRALAPGDPGRDNR* |
Ga0126372_102998791 | 3300010360 | Tropical Forest Soil | LILLGDDMLLFEREEYDPDRGRWRGLAAGDPGRSHR* |
Ga0126372_112623763 | 3300010360 | Tropical Forest Soil | GPSPYSLILLGDNMLLFEREEYDPEQGTWQRLAPGDPGRSNR* |
Ga0126372_117504251 | 3300010360 | Tropical Forest Soil | LILLGDDMLLFEREEYDPARGRWRGLAAGDPGRSHR* |
Ga0136449_1025471111 | 3300010379 | Peatlands Soil | ILLGDDMYLYEREEYDPQQGTWRKLAPGNPGRSHR* |
Ga0134126_108265052 | 3300010396 | Terrestrial Soil | PYFLILLGDDMLLFSRKEYDPGQGTWHALSPGDPGRSNR* |
Ga0126383_120821091 | 3300010398 | Tropical Forest Soil | SLILLGDDMLLFEREEYDPERGTWQGLAPGDPGRANR* |
Ga0126383_122749752 | 3300010398 | Tropical Forest Soil | PTPYSLILLGDNMLVFEREEYDPDRGTWRRLAPGDPGRSNR* |
Ga0126347_11052391 | 3300010867 | Boreal Forest Soil | MTPAHCATSFILLGDDMYLFERKEYDPEQGTWRKLAPGDPGRPHR* |
Ga0126359_14360692 | 3300010869 | Boreal Forest Soil | MVERWALTMTPAHCATSFILLGDDMYLFERKEYDPEQGTWRKLAPGDPGRPHR* |
Ga0151490_10230323 | 3300011107 | Soil | SPYSLILLGDDMLLFEREEYDPERGTWQQLAPGDPGRSHR* |
Ga0137383_112916261 | 3300012199 | Vadose Zone Soil | YSLILLGDNMLAFEREEYDPERGTWRRLAPGDPGRSNR* |
Ga0137365_101216913 | 3300012201 | Vadose Zone Soil | MVMSPARPSPYSLILLGDDMLLFEREECDPERGTWRGLAPGDPGRANR* |
Ga0150984_1112511841 | 3300012469 | Avena Fatua Rhizosphere | LGSGPSPYSLILLGDDMYLFEREEYDLEQGTWRQLAPGDPGRSHR* |
Ga0126375_114153941 | 3300012948 | Tropical Forest Soil | YSLILLVNDMFLFERQEYDPERGTWRALAPGDPGRSNR* |
Ga0164304_111480351 | 3300012986 | Soil | LLGDDMYLFDREEYDPGQGTWRKLAPGDPGQSHR* |
Ga0164305_120282261 | 3300012989 | Soil | YSLILLGDDMLLFSRKEYDPGQGTWRALAPGDPGRSNR* |
Ga0157373_111520591 | 3300013100 | Corn Rhizosphere | YSLILLGDDMLLFDREEYDPDGGTWRPLAPGDPGRANR* |
Ga0157369_115995872 | 3300013105 | Corn Rhizosphere | SLILLGDDMYAFEREEYDPAQGTWRNLAPGDPGRSHR* |
Ga0157369_120221521 | 3300013105 | Corn Rhizosphere | PSPYSLILLGDDMYLFERKEYDPEKGTWRKLAPGDPGRSHR* |
Ga0163162_113291721 | 3300013306 | Switchgrass Rhizosphere | PSPYSLILLGDDMLLFEREEYDPERGKWQALAPGDPGRSNR* |
Ga0173478_101512791 | 3300015201 | Soil | SLILLGDDMYVFEREEYDPDQGTWRTLAPGDPGRSHR* |
Ga0132257_1002829453 | 3300015373 | Arabidopsis Rhizosphere | YSLILLGDDHVPLEREEYDAERGTWRNLAPGDPGRSHR* |
Ga0132257_1014681182 | 3300015373 | Arabidopsis Rhizosphere | SPYSLILLGDDMLLFDREEYDPVRGTWRALAPGNPGRDNR* |
Ga0132255_1018791521 | 3300015374 | Arabidopsis Rhizosphere | LLGDDMLVFEREEYDPERGTWQALAPGDPGRSNR* |
Ga0182036_116220972 | 3300016270 | Soil | YSLILLGNDMFLFNREEYDPEQGTWRALGPGDPGRSNR |
Ga0182041_111553952 | 3300016294 | Soil | YSLILLGNDMFLFERQEYDPDRGTWRALAPGDPGRSNR |
Ga0182041_119594331 | 3300016294 | Soil | YSLILLGNDMFLFERQEYDPERGTWRALAPGDPGRSNR |
Ga0182033_105199043 | 3300016319 | Soil | GTGPSPYSLILLGDDMLVFEREEYDPEQRTWQRLAPGDPGRSNR |
Ga0182035_109769841 | 3300016341 | Soil | IGSGPSPYSLVLLGDDMMLFDREEYDPEQGTWRALAAGDPGRDNR |
Ga0182035_120711211 | 3300016341 | Soil | GTGPSPYSLILLGDDMLLFEREEYDPDRGRWRGLAAGDPGRSNR |
Ga0182034_112513991 | 3300016371 | Soil | RPCRRLRPNPYSLILFGDDILQFDREEYDPEQGTWRALGPGDPGWSNR |
Ga0182034_119573151 | 3300016371 | Soil | SLILLGDDMLLFEREEYDPQQGTWRGLAPGDPGRSNR |
Ga0182038_113608241 | 3300016445 | Soil | PSPYSLILLGNDMFLFNREEYDTEQATWRALGPGDPGRSNR |
Ga0187814_100692092 | 3300017932 | Freshwater Sediment | LILLGNDMLLFDREEYDPEQGTWRALAPGDPGRSNR |
Ga0187809_102940981 | 3300017937 | Freshwater Sediment | TGPTPYSLILLGDNMFVFEREEYDPDEGTCWTLAPGDPGKDNRPSPLHPR |
Ga0187804_102613952 | 3300018006 | Freshwater Sediment | SLILLGDDMLLFDRQEYDPERGTWRALAPGDPGRDNR |
Ga0187889_104122031 | 3300018023 | Peatland | YSLILLGDDMYLFERKEYDPGQGTWRKLAPGDPGRSHR |
Ga0210407_113708361 | 3300020579 | Soil | LILLGDDMYLFERKEYDAEKGTWRKLAPGDPGRSHR |
Ga0210399_105189812 | 3300020581 | Soil | GTGPAPYSLILLGDNMFVFERQEYDPDEGTCWTLAPGDPGKDNRPSPLHPR |
Ga0210399_114227711 | 3300020581 | Soil | LILLGDDMLLFGREEYDPERGTWRALPPGDPGRDNR |
Ga0210393_107182101 | 3300021401 | Soil | SLILLGDDMYLFERKEYNPQQGTWQALAPGDPGRSHR |
Ga0210385_105617351 | 3300021402 | Soil | GSGPSPYSLILLADNMYLFERKEYDPERGTWQPLHPGDPGRSHR |
Ga0210387_105827892 | 3300021405 | Soil | GPSPYSLILLADNMYLFERREYDPQQGTWRTLAPGDPGRSHR |
Ga0210383_105007782 | 3300021407 | Soil | MAMSPGSGPSPYSLILLGDDMLLFNREEYDLDQGTWHALAPGDPGRDNR |
Ga0210402_105660393 | 3300021478 | Soil | PYSLILLGDDMLLFDREEYDPERGTWQALAPGDPGRDNR |
Ga0210402_106334544 | 3300021478 | Soil | SLILLGDDMLLFEREEYDPDRGRWRGLAAGDPGRSHR |
Ga0126371_126683731 | 3300021560 | Tropical Forest Soil | SPYSLILLGNDMLLFERQEYDPERGTWHALAPGDPGRSNR |
Ga0207692_108158401 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | LILLGDNMYLFERQEYDSEQGMWRSLAPGDEGRSHR |
Ga0207684_107069521 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | YSLILLGDDMYLFDREEYDPGQETWRKLAPGDPGQSHR |
Ga0207687_116654301 | 3300025927 | Miscanthus Rhizosphere | PSPYSLILLGDDMYLFEREEYDPEKGTWRKLAPGDPGRSHR |
Ga0207700_112369571 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | ILLGDDMLLFQRAEYDPERGTWRALAPGDPGRAHR |
Ga0207665_104956541 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | PYSLILLGDDMLLFEREEYDPQLGTWRGLAPGDPGRSHR |
Ga0207665_115140281 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | YSLILLGDDMLLFSRKEYDPGQGTWRALAPGDPGRSNR |
Ga0207678_107562681 | 3300026067 | Corn Rhizosphere | SPYSLILLGDDMLLFDREEYDPGQGTWRALAPGDPGRDNR |
Ga0207708_109033671 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | VAGSGPSPYSLILLGDDMLLFDREEYDPGRGTWRALAPGNPGRDNR |
Ga0209890_102526652 | 3300026291 | Soil | LILLGDDMLLFDREEYDPERATWRALTPGNPGRDNR |
Ga0257147_10450881 | 3300026475 | Soil | LILLGDNMLVFEREEYDPERGTWRRLAPGDPGRSNR |
Ga0209040_103599142 | 3300027824 | Bog Forest Soil | TGPAPYTLVLLGDNMYLFERQEYDPAAGTWQALEPGDPGRSNR |
Ga0209040_104511371 | 3300027824 | Bog Forest Soil | TGPSPYSLILLGDNMYLFEREEYDPQQGTWRKLAPGDPGHSHR |
Ga0209040_104583371 | 3300027824 | Bog Forest Soil | TGPSPYSLILLGDNMYLFEREEYDPQQGTWRKRAPGDPGHSHR |
Ga0209583_103002542 | 3300027910 | Watersheds | PYSLILLGDDMLLFERQEYDPELGTWHALRPGDPGRSHR |
Ga0302220_102646531 | 3300028742 | Palsa | SLILLGDNMYLYERKEYDPEEGIWRKLAPGDPGRSHR |
Ga0302232_102294762 | 3300028789 | Palsa | ILLGDDMYLFERKEYDPDQGTWRTLAPGDPGRPHR |
Ga0222749_102910163 | 3300029636 | Soil | YSIILLGDEMLLFEREEYDPERGTWRRLAPGDPGRSNR |
Ga0311339_109246632 | 3300029999 | Palsa | LILLGDDMYLFERKEYDPDQGTWRTLAPGDPGRPHR |
Ga0302184_101231761 | 3300030490 | Palsa | YSLILLGDDQLLFEREEFDLEQGTWRLLPPADPGQTNR |
Ga0311355_108200881 | 3300030580 | Palsa | ILLGDNMYLYEREEYDPQQGTWRKLAPGDEGRSHR |
Ga0318534_100932041 | 3300031544 | Soil | PTPYSLILLGDDMLLFEREEYDPDRGRWRGLAAGDPGRSHR |
Ga0318538_100115445 | 3300031546 | Soil | PYSLILLGDNMLVFEREEYDPERGTWQRLAPGDPGRSNR |
Ga0318538_101096652 | 3300031546 | Soil | GPSPYSLILLGNDMYLFERQEYDPDQGTWRTLAPGDPGRPNR |
Ga0318571_101835993 | 3300031549 | Soil | PSPYSLILLGNDMFLFERQEYDPERGTWRALAPGDPGRPNR |
Ga0318528_101383981 | 3300031561 | Soil | VRGSGPTPYSLILLGDDMLLFEREEYDPDRGRWRGLAAGDPGRSHR |
Ga0318515_104826102 | 3300031572 | Soil | MGSGPSPYSLILLGDDMMLFDREEYDPERGTWHALAAGDPGRDNR |
Ga0318561_104635411 | 3300031679 | Soil | TPYSLILLGDDMLLFGREEYDPEQGTCRPLAPGNPGRDNR |
Ga0318561_104851371 | 3300031679 | Soil | PSPYSLILLGNDMFLFNREEYDPQRGTWRALGPGDLGQSNR |
Ga0318572_102083443 | 3300031681 | Soil | IGTGPSPYSLILLGDDMLVFEREEYDPEQRTWQRLAPGDPGRSNR |
Ga0318560_103523622 | 3300031682 | Soil | ILLGDDMLLFDREEYDPEQGTWQALAPGDPGRDNR |
Ga0318496_100568213 | 3300031713 | Soil | IRGTGPSPYSLILLGDDMLLFEREEYDPDRGRWRGLAAGDPGRSNR |
Ga0318500_100346841 | 3300031724 | Soil | GPSPYSLILLGDDMLLFEREEYDPDRGRWRGLAAGDPGRSNR |
Ga0318500_105507881 | 3300031724 | Soil | GPSPYSLILLGDNMLLFEREEYDPQQGTWGALAPGDPGRSNR |
Ga0318502_107222652 | 3300031747 | Soil | PYSLILLGDDMLLFEREEYDPDRGRWRGLAAGDPGRSNR |
Ga0318492_101283561 | 3300031748 | Soil | HVTGTGPSPYSLILLGNDMLLFERQEYDPERGTWRALAPGDQGRSNR |
Ga0307475_111734551 | 3300031754 | Hardwood Forest Soil | LILLGDNMYLYEREEYDPERGTWRRLAPGDEGRSHR |
Ga0318535_101370593 | 3300031764 | Soil | ASPYSLILLGDDMLLFDREEYDPEQGTWQALAPGDPGRADR |
Ga0318535_101620401 | 3300031764 | Soil | YSLILLGDDMLLFGREEYDPEQGTCRPLAPGNPGRDNR |
Ga0318554_102461683 | 3300031765 | Soil | VLGTGPSPYSIILLGDDMLVFEREEYDPELGTWLRLAPGDAGRENR |
Ga0318554_102498991 | 3300031765 | Soil | PYSLILLGDDMLLFDREEYDPGQGTWRELAPGDPGRSHR |
Ga0318509_100438263 | 3300031768 | Soil | RGTGPSPYSLILLGDDMLLFEREEYDPDRGRWRGLAAGDPGRSNR |
Ga0318526_101755691 | 3300031769 | Soil | PYTLVLLGDNMYLFERQEYDPAEGTWQALEPGDPGRSNR |
Ga0318526_102365762 | 3300031769 | Soil | SPYSLIMLGDDMLLFDREEYDPEQGTWRALGPGDPGWSNR |
Ga0318521_104249931 | 3300031770 | Soil | PYSLILLGDDMLLFEREEYDPDRGRWRGLAAGDPGRSHR |
Ga0318546_100662933 | 3300031771 | Soil | ILLCDDMLLFEREEYDPYLGTWGRLAPGDPGRSHR |
Ga0318546_103124911 | 3300031771 | Soil | ILLGDDMLLFGREEYDPEQGTCRPLAPGDPGRDNR |
Ga0318548_102400642 | 3300031793 | Soil | SPYSLIMLGDDMLLFDREEYDPEQGTWRALGPGDPGRSNR |
Ga0318503_100999222 | 3300031794 | Soil | PYSLILLGDDMLLFERHEYDPELGTWRELAPGDPGRPNR |
Ga0318503_103053501 | 3300031794 | Soil | SLILLGNDMYLFERQEYDPDQGTWRTLAPGDPGRPNR |
Ga0318550_100639613 | 3300031797 | Soil | VTESGATPYSLILLGDDMLLFGREEYDPEQGTCRPLAPGNPGRDNR |
Ga0318565_101221143 | 3300031799 | Soil | TPYSLILLGDDMLLFEREEYDPDRGRWRGLAAGDPGRSHR |
Ga0318568_103975782 | 3300031819 | Soil | PYSLILLGDDMLLFGREEYDPEQGTCRPLAPGDPGRDNR |
Ga0318567_105478673 | 3300031821 | Soil | ILLGDDMLLFDREEYDPERGTWRELAPGDPGRDNR |
Ga0318564_102245581 | 3300031831 | Soil | PYSLILLGDDMLLFDREEYDPEQGTWQALAPGDPGRPNR |
Ga0318564_105351631 | 3300031831 | Soil | SPYSLILLGDDMLLFERHEYDPELGTWRELAPGDPGRPNR |
Ga0318499_103806321 | 3300031832 | Soil | TGPSPYSLILLGDDMLLFQREEYDPDLGTWQELAPGDPGRSNR |
Ga0310917_103315422 | 3300031833 | Soil | TGPSPYSLILLGDDMLLFEREEYDSDRGRWRGLAAGDPGRSNR |
Ga0318512_101632591 | 3300031846 | Soil | GPTPYSLILLGDDMLLFEREEYDPDRGRWRGLAAGDPGRSHR |
Ga0318495_101214622 | 3300031860 | Soil | TPYSLILLGDDMLLFGREEYDPEQGTCRPLAPGDPGRDNR |
Ga0306919_112114962 | 3300031879 | Soil | GPSPYSLILLGDDMLLFEREEYDPDLGTWRGLAPGDPGRSHR |
Ga0306925_119394582 | 3300031890 | Soil | TGPSPYSLILLGNDMFLFNREEYDLQRGTWRTLGPGDPGQSNR |
Ga0318520_101400184 | 3300031897 | Soil | GPSPYSLILLGNDMFLFNREEYDTEQATWRALGPGDPGRSNR |
Ga0306923_121800542 | 3300031910 | Soil | SIILLGDDMLRFEREEYDPEEGTWQRLAPGDPGQENR |
Ga0310910_109653742 | 3300031946 | Soil | NHGHVIGSGPSPYSLVLLGDDMMLFDREEYDPEQGTWRALAAGDPGRDNR |
Ga0310910_111889052 | 3300031946 | Soil | YSLILLGDDMLLFEREEYDPGRGRWRGLAAGDPGRSHR |
Ga0318530_102298011 | 3300031959 | Soil | LILLGDDMLLFEREEYDPDRGRWRGLAAGDPGRSHR |
Ga0318562_104030841 | 3300032008 | Soil | LVLLGDDMMLFDREEYDPERGTWRALAAGDPGRDNR |
Ga0318569_101023161 | 3300032010 | Soil | VLGTGPSPYSLILLCDDMLLFEREEYDPYLGTWGRLAPGDPGRSHR |
Ga0318569_102662301 | 3300032010 | Soil | HVAGTGPSPYSLILLGNDMFLFNREEYDPQRGTWRALGPGDPGQSNR |
Ga0318507_103157361 | 3300032025 | Soil | TGASPYSLILLGNDMFLFNREEYDPQRGTWRALAPGDLGQSNR |
Ga0318507_105379191 | 3300032025 | Soil | PYSIILLGDDMLVFEREEYDPELGTWLRLAPGDAGRENR |
Ga0318559_100793241 | 3300032039 | Soil | PSPYSLILLGNDMYLFERQEYDPDQGTWRTLAPGDPGRPNR |
Ga0318559_105475541 | 3300032039 | Soil | GHVVGSGPSPYSLIMLGDDMLLFDREEYDPEQGTWRALGPGDPGWSNR |
Ga0318545_101583642 | 3300032042 | Soil | GSGPTPYSLILLGDDMLLFEREEYDPDRGRWRGLAAGDPGRSHR |
Ga0318556_106821003 | 3300032043 | Soil | SPYSLILLGDDMLLFDREEYDAERGTWRELAPGDPGRDNR |
Ga0318558_101576521 | 3300032044 | Soil | SPYSLILLGDDMLLFQREEYDPDLGTWQELAPGDPGRSNR |
Ga0318558_102948372 | 3300032044 | Soil | PAPYSLILLGDDMLLFEREEYDPDRGRWRGLAAGDPGRSHR |
Ga0318575_102874441 | 3300032055 | Soil | VTGTGPSPYSLILLGNDMFLFNREEYDLQRGTWRTLGPGDPGQSNR |
Ga0318575_104580492 | 3300032055 | Soil | SPYSLILLGDDMLLFEREEYDPQRGTWRGLAPGDPGRSNR |
Ga0318533_113024561 | 3300032059 | Soil | SPYSLILLGDNMLLFEREEYDPQQGTWGALAPGDPGRSNR |
Ga0318505_102010463 | 3300032060 | Soil | TGPSPYSLILLGDDMLVFEREEYDPEQRTWQRLAPGDPGRSNR |
Ga0318510_100295611 | 3300032064 | Soil | SPYSLILLGDDMLLFEREEYDPDRGTWRGLAPGDPGRSNR |
Ga0318513_105357931 | 3300032065 | Soil | ILLGDDMLLFNREEYDPERGTWHPLAPGDPGRDNR |
Ga0308173_102907541 | 3300032074 | Soil | MKQVGQVLPGDDMLLFDQEEYDPERGTWRALAPGDPARDNR |
Ga0318518_105040602 | 3300032090 | Soil | PSPYSLILLGDDMLLFDREEYDPEQGTWQALAPGDPGRPNR |
Ga0318577_103144962 | 3300032091 | Soil | HGHVTGTGPSPYSLILLGNDMFLFERQEYDPERGTWRALASGDPGRSNR |
Ga0318540_100904721 | 3300032094 | Soil | PSPYSLIPLGDDMLLFERHEYDPELGTWRELAPGDPGRPNR |
Ga0311301_100942507 | 3300032160 | Peatlands Soil | SLILLGDDMYLYEREEYDPQQRTWRKLAPGDPGRSHR |
Ga0307472_1026630731 | 3300032205 | Hardwood Forest Soil | YSLILLGNDMFLFNREEYDPERGTWRALGPGDPGQSDR |
Ga0306920_1041606332 | 3300032261 | Soil | GHVPGSGPSPYSLVLLGDDMMLFDREEYDPERGTWHALAAGDPGRDNR |
Ga0335078_108019261 | 3300032805 | Soil | TGPAPYSLILLGDNMFVFEREEYDPGEGTCWTLAPGDPGKDNRPSPLHPR |
Ga0335078_118861243 | 3300032805 | Soil | ILLGDDMLLFEREEYDPEQGTWRRLAPGDPGRPNR |
Ga0335080_110709501 | 3300032828 | Soil | AGTGPSPHSLILLGDDMLLFDREEYDPEQGTWQPLASGDPGRADR |
Ga0335081_123577911 | 3300032892 | Soil | VLLGDDMLLFSRKEYDPGQGTWRALSPGDPGRSDR |
Ga0335073_100271977 | 3300033134 | Soil | MFPGTGSSPYSLILLGDDILLFDREEYDLEQGTWRALAPGARH |
Ga0335073_107931992 | 3300033134 | Soil | TGASPYSLILLGDDMLLFDREEYDVQTGTWKALAAGDPGRSNRGLSR |
Ga0335077_117686221 | 3300033158 | Soil | SPYSLILLGDNMLLFRREEYDTDRGTWQALVPGDPGRDNR |
Ga0310914_107851471 | 3300033289 | Soil | LILLGNDMFLFNREEYDLQRGTWRTLGPGDPGQSNR |
Ga0318519_105326992 | 3300033290 | Soil | YSLILLGDDMLLFEREEYDPARGTWRGLAPGDPGRSNR |
⦗Top⦘ |