| Basic Information | |
|---|---|
| Family ID | F033121 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 178 |
| Average Sequence Length | 42 residues |
| Representative Sequence | DGVVELRHVIQRYPKSNEALQARERLRKLGVATRPGE |
| Number of Associated Samples | 152 |
| Number of Associated Scaffolds | 178 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.56 % |
| % of genes near scaffold ends (potentially truncated) | 98.88 % |
| % of genes from short scaffolds (< 2000 bps) | 93.82 % |
| Associated GOLD sequencing projects | 146 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.53 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (90.449 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (15.168 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.528 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (56.180 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 36.92% β-sheet: 0.00% Coil/Unstructured: 63.08% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 178 Family Scaffolds |
|---|---|---|
| PF12838 | Fer4_7 | 10.67 |
| PF12367 | PFO_beta_C | 10.67 |
| PF03544 | TonB_C | 3.93 |
| PF00793 | DAHP_synth_1 | 2.81 |
| PF13510 | Fer2_4 | 2.81 |
| PF00326 | Peptidase_S9 | 2.25 |
| PF06537 | DHOR | 1.69 |
| PF00436 | SSB | 1.12 |
| PF13442 | Cytochrome_CBB3 | 1.12 |
| PF02577 | BFN_dom | 0.56 |
| PF02401 | LYTB | 0.56 |
| PF00857 | Isochorismatase | 0.56 |
| PF16268 | DUF4921 | 0.56 |
| PF13502 | AsmA_2 | 0.56 |
| PF12704 | MacB_PCD | 0.56 |
| PF13649 | Methyltransf_25 | 0.56 |
| PF06723 | MreB_Mbl | 0.56 |
| PF08899 | DUF1844 | 0.56 |
| PF12779 | WXXGXW | 0.56 |
| PF14060 | DUF4252 | 0.56 |
| PF12695 | Abhydrolase_5 | 0.56 |
| PF02744 | GalP_UDP_tr_C | 0.56 |
| COG ID | Name | Functional Category | % Frequency in 178 Family Scaffolds |
|---|---|---|---|
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 3.93 |
| COG3488 | Uncharacterized conserved protein with two CxxC motifs, DUF1111 family | General function prediction only [R] | 1.69 |
| COG0629 | Single-stranded DNA-binding protein | Replication, recombination and repair [L] | 1.12 |
| COG0761 | 4-Hydroxy-3-methylbut-2-enyl diphosphate reductase IspH | Lipid transport and metabolism [I] | 1.12 |
| COG2965 | Primosomal replication protein N | Replication, recombination and repair [L] | 1.12 |
| COG1077 | Cell shape-determining ATPase MreB, actin-like superfamily | Cell cycle control, cell division, chromosome partitioning [D] | 0.56 |
| COG1259 | Bifunctional DNase/RNase | General function prediction only [R] | 0.56 |
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.56 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.56 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 90.45 % |
| Unclassified | root | N/A | 9.55 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_101265023 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 777 | Open in IMG/M |
| 3300000789|JGI1027J11758_12093586 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 596 | Open in IMG/M |
| 3300001305|C688J14111_10014730 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2262 | Open in IMG/M |
| 3300001546|JGI12659J15293_10153636 | Not Available | 503 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100208334 | All Organisms → cellular organisms → Bacteria | 1847 | Open in IMG/M |
| 3300004092|Ga0062389_104978480 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 500 | Open in IMG/M |
| 3300004268|Ga0066398_10074794 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 739 | Open in IMG/M |
| 3300004468|Ga0068977_1180486 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 704 | Open in IMG/M |
| 3300004601|Ga0068934_1209914 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 783 | Open in IMG/M |
| 3300005179|Ga0066684_10623878 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 724 | Open in IMG/M |
| 3300005437|Ga0070710_10365162 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 959 | Open in IMG/M |
| 3300005451|Ga0066681_10243888 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1088 | Open in IMG/M |
| 3300005529|Ga0070741_11221500 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 633 | Open in IMG/M |
| 3300005541|Ga0070733_10124537 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1659 | Open in IMG/M |
| 3300005542|Ga0070732_10717448 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300005555|Ga0066692_10306591 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1007 | Open in IMG/M |
| 3300005563|Ga0068855_101279969 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 760 | Open in IMG/M |
| 3300005569|Ga0066705_10224418 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1185 | Open in IMG/M |
| 3300005587|Ga0066654_10462325 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 694 | Open in IMG/M |
| 3300005591|Ga0070761_10219378 | All Organisms → cellular organisms → Bacteria | 1131 | Open in IMG/M |
| 3300005610|Ga0070763_10369240 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 801 | Open in IMG/M |
| 3300005610|Ga0070763_10874881 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 534 | Open in IMG/M |
| 3300005764|Ga0066903_101119626 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1453 | Open in IMG/M |
| 3300006028|Ga0070717_10444816 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1167 | Open in IMG/M |
| 3300006028|Ga0070717_10584482 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1013 | Open in IMG/M |
| 3300006028|Ga0070717_10736621 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
| 3300006086|Ga0075019_10075762 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1911 | Open in IMG/M |
| 3300006102|Ga0075015_100551724 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 669 | Open in IMG/M |
| 3300006176|Ga0070765_100725886 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
| 3300006176|Ga0070765_101428730 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300006796|Ga0066665_11025780 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300006893|Ga0073928_10158342 | All Organisms → cellular organisms → Bacteria | 1819 | Open in IMG/M |
| 3300009012|Ga0066710_100986816 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1299 | Open in IMG/M |
| 3300009088|Ga0099830_11885173 | Not Available | 500 | Open in IMG/M |
| 3300009093|Ga0105240_10786943 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1031 | Open in IMG/M |
| 3300009137|Ga0066709_101585788 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 938 | Open in IMG/M |
| 3300009137|Ga0066709_103424070 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 576 | Open in IMG/M |
| 3300009174|Ga0105241_11697283 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 614 | Open in IMG/M |
| 3300009518|Ga0116128_1144416 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 683 | Open in IMG/M |
| 3300009520|Ga0116214_1012536 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3002 | Open in IMG/M |
| 3300009522|Ga0116218_1122507 | All Organisms → cellular organisms → Bacteria | 1183 | Open in IMG/M |
| 3300009522|Ga0116218_1371848 | Not Available | 638 | Open in IMG/M |
| 3300009545|Ga0105237_12544776 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300009635|Ga0116117_1004459 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3724 | Open in IMG/M |
| 3300009665|Ga0116135_1337721 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300009824|Ga0116219_10249764 | All Organisms → cellular organisms → Bacteria | 1007 | Open in IMG/M |
| 3300010049|Ga0123356_11164973 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 938 | Open in IMG/M |
| 3300010341|Ga0074045_10060359 | All Organisms → cellular organisms → Bacteria | 2710 | Open in IMG/M |
| 3300010359|Ga0126376_12197410 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 597 | Open in IMG/M |
| 3300010360|Ga0126372_10001036 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 10868 | Open in IMG/M |
| 3300010362|Ga0126377_10850541 | All Organisms → cellular organisms → Bacteria | 973 | Open in IMG/M |
| 3300010379|Ga0136449_103289567 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300011089|Ga0138573_1270148 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 792 | Open in IMG/M |
| 3300011120|Ga0150983_13721765 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 774 | Open in IMG/M |
| 3300011271|Ga0137393_10048657 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 3308 | Open in IMG/M |
| 3300012203|Ga0137399_11320909 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 606 | Open in IMG/M |
| 3300012210|Ga0137378_10190251 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1909 | Open in IMG/M |
| 3300012212|Ga0150985_108463107 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 654 | Open in IMG/M |
| 3300012212|Ga0150985_114294518 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1148 | Open in IMG/M |
| 3300012350|Ga0137372_10450384 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 965 | Open in IMG/M |
| 3300012359|Ga0137385_10516870 | All Organisms → cellular organisms → Bacteria | 1009 | Open in IMG/M |
| 3300012469|Ga0150984_108815715 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 524 | Open in IMG/M |
| 3300012917|Ga0137395_10306231 | All Organisms → cellular organisms → Bacteria | 1126 | Open in IMG/M |
| 3300012918|Ga0137396_11046705 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 588 | Open in IMG/M |
| 3300012922|Ga0137394_11277404 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300012923|Ga0137359_10684736 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 894 | Open in IMG/M |
| 3300012924|Ga0137413_10225228 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1274 | Open in IMG/M |
| 3300013503|Ga0120127_10111353 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300014150|Ga0134081_10057516 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1170 | Open in IMG/M |
| 3300014169|Ga0181531_11012138 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
| 3300014497|Ga0182008_10866528 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300014657|Ga0181522_10226737 | Not Available | 1102 | Open in IMG/M |
| 3300017654|Ga0134069_1314394 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 558 | Open in IMG/M |
| 3300017935|Ga0187848_10361387 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 601 | Open in IMG/M |
| 3300017935|Ga0187848_10423542 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 547 | Open in IMG/M |
| 3300017955|Ga0187817_10734147 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300017970|Ga0187783_11343449 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300017994|Ga0187822_10021703 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1649 | Open in IMG/M |
| 3300018035|Ga0187875_10669013 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 546 | Open in IMG/M |
| 3300018038|Ga0187855_10824567 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300018043|Ga0187887_10229447 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1101 | Open in IMG/M |
| 3300018058|Ga0187766_10486970 | All Organisms → cellular organisms → Bacteria | 828 | Open in IMG/M |
| 3300018062|Ga0187784_10511269 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 967 | Open in IMG/M |
| 3300018085|Ga0187772_11250238 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300018088|Ga0187771_11134484 | Not Available | 663 | Open in IMG/M |
| 3300018090|Ga0187770_10538306 | Not Available | 925 | Open in IMG/M |
| 3300018482|Ga0066669_11747362 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300019278|Ga0187800_1407221 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 859 | Open in IMG/M |
| 3300020579|Ga0210407_10385556 | Not Available | 1097 | Open in IMG/M |
| 3300020580|Ga0210403_10136896 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1999 | Open in IMG/M |
| 3300020581|Ga0210399_11114246 | Not Available | 631 | Open in IMG/M |
| 3300021046|Ga0215015_10631007 | All Organisms → cellular organisms → Bacteria | 1185 | Open in IMG/M |
| 3300021171|Ga0210405_11308141 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 532 | Open in IMG/M |
| 3300021178|Ga0210408_11127470 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300021180|Ga0210396_10244371 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1597 | Open in IMG/M |
| 3300021181|Ga0210388_10822520 | Not Available | 804 | Open in IMG/M |
| 3300021388|Ga0213875_10305472 | Not Available | 753 | Open in IMG/M |
| 3300021405|Ga0210387_10235112 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1599 | Open in IMG/M |
| 3300021407|Ga0210383_10585315 | All Organisms → cellular organisms → Bacteria | 962 | Open in IMG/M |
| 3300021407|Ga0210383_10597816 | All Organisms → cellular organisms → Bacteria | 951 | Open in IMG/M |
| 3300021432|Ga0210384_10174843 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1929 | Open in IMG/M |
| 3300021433|Ga0210391_10309904 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1238 | Open in IMG/M |
| 3300021433|Ga0210391_11457289 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
| 3300021477|Ga0210398_10141598 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1955 | Open in IMG/M |
| 3300021559|Ga0210409_10577175 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 992 | Open in IMG/M |
| 3300022531|Ga0242660_1068670 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 812 | Open in IMG/M |
| 3300022531|Ga0242660_1086864 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 746 | Open in IMG/M |
| 3300022532|Ga0242655_10078238 | Not Available | 872 | Open in IMG/M |
| 3300022532|Ga0242655_10189555 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300022563|Ga0212128_10014112 | All Organisms → cellular organisms → Bacteria | 5127 | Open in IMG/M |
| 3300022708|Ga0242670_1021705 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 773 | Open in IMG/M |
| 3300022722|Ga0242657_1087526 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 749 | Open in IMG/M |
| 3300022724|Ga0242665_10135383 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 766 | Open in IMG/M |
| 3300023250|Ga0224544_1068843 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
| 3300024176|Ga0224565_1017051 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 783 | Open in IMG/M |
| 3300025321|Ga0207656_10125362 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1199 | Open in IMG/M |
| 3300025900|Ga0207710_10498594 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300025981|Ga0207640_10456664 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1054 | Open in IMG/M |
| 3300026540|Ga0209376_1351004 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 557 | Open in IMG/M |
| 3300026909|Ga0207858_1028347 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
| 3300027030|Ga0208240_1019944 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 724 | Open in IMG/M |
| 3300027063|Ga0207762_1043994 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 661 | Open in IMG/M |
| 3300027570|Ga0208043_1104996 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 762 | Open in IMG/M |
| 3300027604|Ga0208324_1078888 | All Organisms → cellular organisms → Bacteria | 934 | Open in IMG/M |
| 3300027625|Ga0208044_1066350 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1110 | Open in IMG/M |
| 3300027629|Ga0209422_1018878 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1711 | Open in IMG/M |
| 3300027641|Ga0208827_1148152 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 654 | Open in IMG/M |
| 3300027692|Ga0209530_1207606 | Not Available | 539 | Open in IMG/M |
| 3300027701|Ga0209447_10108287 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 764 | Open in IMG/M |
| 3300027829|Ga0209773_10134617 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1027 | Open in IMG/M |
| 3300027867|Ga0209167_10031506 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 89 | 2549 | Open in IMG/M |
| 3300027867|Ga0209167_10347057 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
| 3300027867|Ga0209167_10397938 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300027895|Ga0209624_10258086 | All Organisms → cellular organisms → Bacteria | 1159 | Open in IMG/M |
| 3300028784|Ga0307282_10365123 | Not Available | 698 | Open in IMG/M |
| 3300028877|Ga0302235_10373418 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 612 | Open in IMG/M |
| 3300028906|Ga0308309_11241095 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 642 | Open in IMG/M |
| 3300028906|Ga0308309_11318132 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300029701|Ga0222748_1055098 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 691 | Open in IMG/M |
| 3300029903|Ga0247271_108938 | All Organisms → cellular organisms → Bacteria | 1537 | Open in IMG/M |
| 3300029918|Ga0302143_1116748 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 632 | Open in IMG/M |
| 3300030043|Ga0302306_10329428 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300030618|Ga0311354_11460060 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 607 | Open in IMG/M |
| 3300030659|Ga0316363_10031826 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2685 | Open in IMG/M |
| 3300030659|Ga0316363_10105135 | All Organisms → cellular organisms → Bacteria | 1251 | Open in IMG/M |
| 3300030730|Ga0307482_1086363 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 836 | Open in IMG/M |
| 3300030740|Ga0265460_11961871 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 607 | Open in IMG/M |
| 3300030878|Ga0265770_1089904 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 612 | Open in IMG/M |
| 3300030978|Ga0265757_104637 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 693 | Open in IMG/M |
| 3300031057|Ga0170834_101146984 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 585 | Open in IMG/M |
| 3300031057|Ga0170834_112381732 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 694 | Open in IMG/M |
| 3300031234|Ga0302325_11267941 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 973 | Open in IMG/M |
| 3300031525|Ga0302326_11844242 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 789 | Open in IMG/M |
| 3300031715|Ga0307476_10201090 | All Organisms → cellular organisms → Bacteria | 1446 | Open in IMG/M |
| 3300031715|Ga0307476_10614087 | Not Available | 806 | Open in IMG/M |
| 3300031715|Ga0307476_10707612 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 746 | Open in IMG/M |
| 3300031715|Ga0307476_10724610 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300031718|Ga0307474_10280352 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1281 | Open in IMG/M |
| 3300031718|Ga0307474_10358411 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1130 | Open in IMG/M |
| 3300031720|Ga0307469_10826820 | All Organisms → cellular organisms → Bacteria | 852 | Open in IMG/M |
| 3300031823|Ga0307478_10085422 | All Organisms → cellular organisms → Bacteria | 2417 | Open in IMG/M |
| 3300031823|Ga0307478_11150278 | Not Available | 647 | Open in IMG/M |
| 3300031823|Ga0307478_11733272 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300031941|Ga0310912_11399697 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
| 3300031962|Ga0307479_10575027 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1109 | Open in IMG/M |
| 3300032066|Ga0318514_10540101 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300032089|Ga0318525_10249170 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 913 | Open in IMG/M |
| 3300032180|Ga0307471_100305770 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1679 | Open in IMG/M |
| 3300032180|Ga0307471_103363832 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300032515|Ga0348332_10280755 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 634 | Open in IMG/M |
| 3300032805|Ga0335078_12441274 | Not Available | 542 | Open in IMG/M |
| 3300032828|Ga0335080_12046250 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 554 | Open in IMG/M |
| 3300032829|Ga0335070_11333584 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300033158|Ga0335077_11411117 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300033158|Ga0335077_12010066 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 537 | Open in IMG/M |
| 3300033475|Ga0310811_11399921 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300034282|Ga0370492_0104571 | All Organisms → cellular organisms → Bacteria | 1159 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.17% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 8.43% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 7.87% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.18% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.06% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.93% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.93% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.37% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.37% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.25% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.25% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.25% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.81% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.81% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.81% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.69% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.69% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.69% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.69% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.69% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.12% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.12% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.12% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.12% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.12% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.12% |
| Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 0.56% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.56% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.56% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.56% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.56% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.56% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.56% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.56% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.56% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.56% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.56% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.56% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.56% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.56% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.56% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.56% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001305 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300001546 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
| 3300004468 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 74 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004601 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 22 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009518 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 | Environmental | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009635 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10 | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Host-Associated | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011089 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 58 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300013503 | Permafrost microbial communities from Nunavut, Canada - A23_5cm_12M | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017935 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019278 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Host-Associated | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022563 | OV2_combined assembly | Environmental | Open in IMG/M |
| 3300022708 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022722 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023250 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 10-14 | Environmental | Open in IMG/M |
| 3300024176 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU1 | Environmental | Open in IMG/M |
| 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300026909 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 23 (SPAdes) | Environmental | Open in IMG/M |
| 3300027030 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF041 (SPAdes) | Environmental | Open in IMG/M |
| 3300027063 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 37 (SPAdes) | Environmental | Open in IMG/M |
| 3300027570 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027625 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027692 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027701 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028877 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029701 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029903 | Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Fen703 | Environmental | Open in IMG/M |
| 3300029918 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_1 | Environmental | Open in IMG/M |
| 3300030043 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030740 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assembly | Environmental | Open in IMG/M |
| 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030978 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSA4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| 3300034282 | Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1012650231 | 3300000364 | Soil | VSELRHLIQRYPHSPEALQARERLRKAGVSSAGRPS* |
| JGI1027J11758_120935862 | 3300000789 | Soil | RHLIQRYPKTNEATQARDRLRKLGAPVTAKSIPE* |
| C688J14111_100147301 | 3300001305 | Soil | LGKQDDGITELKHLIQRYPHSPEALQARERLRKLGVSAR* |
| JGI12659J15293_101536361 | 3300001546 | Forest Soil | ELRRVIQRYPRSPEALQARERLRKLGVSSSGRTGE* |
| JGIcombinedJ26739_1002083344 | 3300002245 | Forest Soil | EDGVVELRRVIQRYPRSPEALQARERLRKLGVASNARPGE* |
| Ga0062389_1049784801 | 3300004092 | Bog Forest Soil | IELGKQEDGVVELRHVIQRYPKSNEALQARERLRKLGVATRPGE* |
| Ga0066398_100747942 | 3300004268 | Tropical Forest Soil | GVKALRHVIQRYPRSNEAVQAREQLRKLGVSTSAGARRGQQ* |
| Ga0068977_11804863 | 3300004468 | Peatlands Soil | LIELGKKDDGIAELRHVIQRYPRSNEALQAKDRLRKLGVSTTAARTRSE* |
| Ga0068934_12099141 | 3300004601 | Peatlands Soil | KKDDGIAELRHVIQRYPRSNEALQAKDRLRKLGVSTTAARTRSE* |
| Ga0066684_106238781 | 3300005179 | Soil | GQKDAGISTLKHVVQRYPRSNEALQAKDRLRKLGATSASR* |
| Ga0070710_103651621 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | GQKDAGITALRHVVQRYPRTNEAVQAKDRLRKLGVATTASRRPEQ* |
| Ga0066681_102438881 | 3300005451 | Soil | GKQDDGVTELRHVVQRYPHSPEALQARERMRKLGVSTTRG* |
| Ga0070741_112215002 | 3300005529 | Surface Soil | QKDAGISTLRHVVQRYPRTNEATQAKDRLRKLGVATTASRRAE* |
| Ga0070733_101245374 | 3300005541 | Surface Soil | LGKQEDGVVELRRVIQRYPKSNEALQARERLKKLGVSTTVRPGQ* |
| Ga0070732_107174483 | 3300005542 | Surface Soil | LRHVIQRYPRSNEALQAKDRLKKLGVPTTAARAPGE* |
| Ga0066692_103065911 | 3300005555 | Soil | RELRHLLQRYPHSPEALQARERLRKLGVPATSRAGE* |
| Ga0068855_1012799692 | 3300005563 | Corn Rhizosphere | GLSQIQLGQQEDGVKALRHVIQRYPRSNEAAQAREQLRKLGVSTSAGARRGQ* |
| Ga0066705_102244183 | 3300005569 | Soil | ELGKQDDGVSELRHVIQRYPRSPEALQARDRLRKLGVSTGRNS* |
| Ga0066654_104623251 | 3300005587 | Soil | IELGRQDDGVAALRHVVQRYPKTTEAQQARERLRRLGVPASGTTAHR* |
| Ga0070761_102193784 | 3300005591 | Soil | GFSLIELGKQDDGVTELRHVIQRYPKSNEALQARERLRKLGVAPAGRSGQ* |
| Ga0070763_103692401 | 3300005610 | Soil | SLIELGKQDDGITELRHVIQRYPKSNEALQARERLRKLGVAPAPTGRPGQ* |
| Ga0070763_108748813 | 3300005610 | Soil | FSLIELGKQDDGVTELRHVIQRYPRSNEALQARERLRKLGVSATAHPGQ* |
| Ga0066903_1011196263 | 3300005764 | Tropical Forest Soil | DEGVNALRHVIQRYPKSNEALQARERLRKLGISTAGTTARRE* |
| Ga0070717_104448161 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | GFAQIESGQKDSGISTLRHVVQRYPRSNEALQAKDRLRKLGVATTASGGRRAE* |
| Ga0070717_105844821 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | GITTLRHVVQRYPRSNEALQAKDRLRKLGVATASSRQQ* |
| Ga0070717_107366213 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VQELRHLIQRYPKTNEAVQARDRLRKLGVSTAAKPGAGTQ* |
| Ga0075019_100757624 | 3300006086 | Watersheds | GVSELRHLNQRYPHSPEALQARDRLHKLGVSTVGK* |
| Ga0075015_1005517241 | 3300006102 | Watersheds | GVSELRHLNQRYPHSPEALQARERMHKLGVSPVGK* |
| Ga0070765_1007258861 | 3300006176 | Soil | RHVIQRYPKSNEALQARERLRKLGVAPAPTGRPGQ* |
| Ga0070765_1014287303 | 3300006176 | Soil | GKQEDGVVELRHVIQRYPKSNEALQARERLRKLGVAPRSGE* |
| Ga0066665_110257803 | 3300006796 | Soil | LIQRYPKTNEAVQARDRLRKLGVSTAAKPGAGTQ* |
| Ga0073928_101583421 | 3300006893 | Iron-Sulfur Acid Spring | QEDGVVELRHVIQRYPKSNEALQARERLRKLGVSPRSGG* |
| Ga0066710_1009868161 | 3300009012 | Grasslands Soil | KGFAQIEAGQKDSGITTLKHVVQRYPRSNEALQAKDRLRKLGVTTAGGRRAE |
| Ga0099830_118851731 | 3300009088 | Vadose Zone Soil | LGKQEDGVVELRRVIQRYPKSNEALQARERLKKLGVASRSGE* |
| Ga0105240_107869433 | 3300009093 | Corn Rhizosphere | GQKDAGITTLRHVVQRYPRTNEAMQAKDRLRKLGVATAASRRAE* |
| Ga0066709_1015857881 | 3300009137 | Grasslands Soil | GIAALRHVIQRYPKSNEALQARERLRKLGVAATARQAQ* |
| Ga0066709_1034240703 | 3300009137 | Grasslands Soil | AGQKDSGITTLKHVVQRYPRSNEALQAKERLRKLGVTTASGRRAE* |
| Ga0105241_116972831 | 3300009174 | Corn Rhizosphere | KQDDGVAELRHVVQRYPHSPEALQARERMRKLGVSSTRG* |
| Ga0116128_11444163 | 3300009518 | Peatland | LIELGKQEDGVAELRHVIQRYPRSPEALQARERLRKLGVSPAGHSGE* |
| Ga0116214_10125361 | 3300009520 | Peatlands Soil | KQDDGVSELRHLLQRYPHSPEALQARDRLRKLGVSSTGK* |
| Ga0116218_11225071 | 3300009522 | Peatlands Soil | GLSLIELGKKDDGIAELRHVIQRYPRSNEALQAKDRLRKLGVSTTASRTRSE* |
| Ga0116218_13718481 | 3300009522 | Peatlands Soil | IELGKQDDGVSELRHLLQRYPHSPEALQARDRLRKLGVSSIGK* |
| Ga0105237_125447761 | 3300009545 | Corn Rhizosphere | KDGGIAALRHVVQRYPRSNEALQARDRLRKLGVSSTAGRNRG* |
| Ga0116117_10044596 | 3300009635 | Peatland | EDGVVELRRVIQRYPKSNEALQARERLKKLGVSTTVRPGE* |
| Ga0116135_13377212 | 3300009665 | Peatland | IELGQKDDGVTALRHVIQRYPKSNEALQARDRLRKLGVSTTAAKQ* |
| Ga0116219_102497643 | 3300009824 | Peatlands Soil | LGKTDDGIAQLRHVIQRYPRSNEALQAKDRLRKLGVSTTAARAPGE* |
| Ga0123356_111649732 | 3300010049 | Termite Gut | AASAELKKGLAQIESGQKDSGIATLRHVVQRYPRTNEAMQAKDRLRKLGVATTASKTRAEQ* |
| Ga0074045_100603591 | 3300010341 | Bog Forest Soil | KQDDGVAELRHVIQRYPRSPEALQARERLRKLGVSSTGHTGE* |
| Ga0126376_121974101 | 3300010359 | Tropical Forest Soil | DGVQELRHVIQRYPKTTEATQARDRLRKLGVSASSARSGG* |
| Ga0126372_100010369 | 3300010360 | Tropical Forest Soil | LGQKDEAVKGFRHVIQRYPRSNEATQARDQLRKLGVTAATAKPSAERE* |
| Ga0126377_108505411 | 3300010362 | Tropical Forest Soil | LGQKDDGIAALRHVVQRYPKSNEALQARDRLRKLGVSTTGTSARK* |
| Ga0136449_1032895671 | 3300010379 | Peatlands Soil | IAQLRHVIQRYPRSNEALQAKDRLRKLGVATTASRAPGE* |
| Ga0136449_1044770381 | 3300010379 | Peatlands Soil | KGFALIELGKQDEGAQELKHVIQRYPKTNEAIQARDKLRKIGAAPARSRQ* |
| Ga0138573_12701483 | 3300011089 | Peatlands Soil | ELRHVIQRYPKSNEALQARERLRKLGVSATARPGQ* |
| Ga0150983_137217651 | 3300011120 | Forest Soil | DGIAELRHVIQRYPRSNEALQAKDRLRKLGVPTTASRAPGE* |
| Ga0137393_100486571 | 3300011271 | Vadose Zone Soil | KQEDGVIELRHVIQRYPKSNEALQARERLRKLGVSANARPGQ* |
| Ga0137399_113209092 | 3300012203 | Vadose Zone Soil | RELRHLIQRYPHSNEALQARDRLRKLGIASSTRPGE* |
| Ga0137378_101902514 | 3300012210 | Vadose Zone Soil | VSDLRHLIQRYPHSPEALQARERLRKLGVAVTGK* |
| Ga0150985_1084631072 | 3300012212 | Avena Fatua Rhizosphere | MAQIESGQKDSGIATLRHVVQRYPRTNEAMQAKDRLRKLGVATTASRRAE* |
| Ga0150985_1142945182 | 3300012212 | Avena Fatua Rhizosphere | FAQIESGQKDSGISTLRHVVQRYPRSNEALQAKDRLRKLGVTTASSGRRAE* |
| Ga0137372_104503841 | 3300012350 | Vadose Zone Soil | KDEGVSELRKLIQRYPHSPEALQARERLRKLGVASTAR* |
| Ga0137385_105168701 | 3300012359 | Vadose Zone Soil | QDDGVSELRHVVQRYPHSPEALQARERLRKLGVASTGRG* |
| Ga0150984_1088157152 | 3300012469 | Avena Fatua Rhizosphere | QIESGQKDSGIATLRHVVQRYPRTNEAMQAKDRLRKLGVATTTASRRAE* |
| Ga0137395_103062313 | 3300012917 | Vadose Zone Soil | VSELRHLIQRYPHSNEALQARERLRKLGVAASAKPGA* |
| Ga0137396_110467051 | 3300012918 | Vadose Zone Soil | GKQDDGVRELRHLIQRYPHSNEALQARDRLRKLGIASSTRPGE* |
| Ga0137394_112774041 | 3300012922 | Vadose Zone Soil | ELGKQEDGIAALRHVIQRYPKSNEALQARERLRKLGVATTGTTARRVVVQ* |
| Ga0137359_106847361 | 3300012923 | Vadose Zone Soil | KGFSLLELGKQEDGVVELRHVIQRYPKSNEALQARERLRKLGVSANARPGQ* |
| Ga0137413_102252281 | 3300012924 | Vadose Zone Soil | ELGQQEDGIAALRHVIQRYPKSNEALQARERLRKLGVAATGTTARKNQ* |
| Ga0120127_101113531 | 3300013503 | Permafrost | NEGVSELRKVIQRYPRSSEALQAKERLKKLGVSTGAGVPRPGE* |
| Ga0134081_100575161 | 3300014150 | Grasslands Soil | KQDDGVAALRHVVQRYPKTNEALQARERLRKLGVATVGSARRESQ* |
| Ga0181531_110121381 | 3300014169 | Bog | QQDNGVQELRHVIQRYPKSPEALQARERLRQLKVPATGRPGE* |
| Ga0182008_108665281 | 3300014497 | Rhizosphere | DDGVGALRHVVQRYPKTTEAQQARERLRRLGVPASGTTAHR* |
| Ga0181522_102267371 | 3300014657 | Bog | LGKQDDGVTELRHVVARYPHAPEALQAREKLRKLGVSTTGK* |
| Ga0134069_13143941 | 3300017654 | Grasslands Soil | GKQDDGVAALRHVVQRYPKTNEALQARERLRKLGVATVGSARRESQ |
| Ga0187848_103613871 | 3300017935 | Peatland | ELRHVIQRYPRSPEALQARERLRKLGVSPAGHSGE |
| Ga0187848_104235422 | 3300017935 | Peatland | ELRHVIQRYPKSPEALQARERLRQLKVPATGRPGE |
| Ga0187817_107341472 | 3300017955 | Freshwater Sediment | ELGQNDDGIAALRHVIQRYPRSNEALQARERLKKLGVSSTARRSGE |
| Ga0187783_113434491 | 3300017970 | Tropical Peatland | IELGKQDDGVTELRHVIQRYPRSNEALQARERLRKLGVSATAHPGQ |
| Ga0187822_100217034 | 3300017994 | Freshwater Sediment | VQELRHLIQRYPKTNEATQARERLRKLGASTTAAKPGE |
| Ga0187875_106690133 | 3300018035 | Peatland | GKQDDGVTELRHLLQRYPHSPEALQARDRLRKLGVAGKAGAGE |
| Ga0187855_108245671 | 3300018038 | Peatland | ELGKQEDGVVELRHVIQRYPRSPEALQARERLRKLGVSSTGRSGE |
| Ga0187887_102294473 | 3300018043 | Peatland | ELRRVIQRYPKSNEALQARERLKKLGVSTTVRPGE |
| Ga0187766_104869702 | 3300018058 | Tropical Peatland | DDGVAELRHVIQRYPRSNEALQAREKLRKLGVATSGTTARKQSE |
| Ga0187784_105112691 | 3300018062 | Tropical Peatland | KQDDGVAELRHLLQSYPRSPEALQAKERLRKWGVATAGR |
| Ga0187772_112502381 | 3300018085 | Tropical Peatland | ELRHVIQRYPKTNEALQAREKLRKLGVTATAPARQPGE |
| Ga0187771_111344842 | 3300018088 | Tropical Peatland | KQNDGVSELRHLIQRYPHSPEALQARERLRKLGVSTR |
| Ga0187770_105383061 | 3300018090 | Tropical Peatland | ELGKQDDGVKELRHLIQRYPHSPEALQARERLRKLGVATR |
| Ga0066669_117473621 | 3300018482 | Grasslands Soil | LGRQDDGVAALRHVVQRYPKTTEAQQARERLRRLGVPASGTTAHR |
| Ga0187800_14072211 | 3300019278 | Peatland | QLKKAFALIELGKQDDAIQELKHVIQRYPRTNEAVQARDKLRKLGATTTPARSR |
| Ga0210407_103855561 | 3300020579 | Soil | VTELRHLLQRYPHSPEALQARDRLRKLGVAGKAGAGE |
| Ga0210403_101368963 | 3300020580 | Soil | KDDGIAQLRHVIQRYPRSTEALQAKDRLRKLGVPTAAARAPGE |
| Ga0210399_111142463 | 3300020581 | Soil | LGKQEDGVAELRHEIQRYPKSNEALQARERLKKMGVSTTVRPGQ |
| Ga0215015_106310071 | 3300021046 | Soil | LGKQDDGVSELRHLIQRYPHSNEALQARERLRKLGVAASAKPGA |
| Ga0210405_113081413 | 3300021171 | Soil | GKQDDGVAELRRVIQRYPKSNEALQARERLRKLGVAPAGRPGQ |
| Ga0210408_111274702 | 3300021178 | Soil | ALIELGKKDDGIAQLRHVIQRYPRSNEALQAKDRLRKLGVATTAARAPGE |
| Ga0210396_102443714 | 3300021180 | Soil | VVELRRVIQRYPRSNEALQARERLKKLGVSGRSGE |
| Ga0210388_108225202 | 3300021181 | Soil | DDGVTELRHLVQRYPHSPEALQARDRLRKLGVATTAK |
| Ga0213875_103054721 | 3300021388 | Plant Roots | GQKDAGISALRHVVQRYPRSNEALQAKDRLRKLGVATTASSR |
| Ga0210387_102351123 | 3300021405 | Soil | ELGKQDDGVNELKHLVQRYPHSPEALQARDRMRKLGVPATGR |
| Ga0210383_105853151 | 3300021407 | Soil | ELGKQEDGVAELRHVIQRYPKSNEALQARERLKKMGVSTSVRPGQ |
| Ga0210383_105978163 | 3300021407 | Soil | VVELRRVIQRYPRSPEALQARERLRKLGVASNARPGE |
| Ga0210384_101748433 | 3300021432 | Soil | LALIELGKKDDGIAQLRHVIQRYPRSTEALQAKDRLRKLGVPTAAARAPGE |
| Ga0210391_103099044 | 3300021433 | Soil | DGVAELRRVIQRYPKSNEALQARERLRKLGVAPAGRPGQ |
| Ga0210391_114572891 | 3300021433 | Soil | GKQDDGVGELRHVIQRYPHAPEALQARDRLRKLGVATTGK |
| Ga0210398_101415981 | 3300021477 | Soil | DDGVSELRHVIQRYPHSPEALQARERLRKLGVPTTGRNS |
| Ga0210409_105771753 | 3300021559 | Soil | VELRRVIQRYPKSNEALQARERLKKLGVSTTVRPGQ |
| Ga0242660_10686701 | 3300022531 | Soil | LIELGKQEDGVAELRHVIQRYPKSNEALQARERLRKLGVAPRPGA |
| Ga0242660_10868643 | 3300022531 | Soil | QDDGVAELRHVIQRYPKSNEALQARERLKKLGVASRPGA |
| Ga0242655_100782382 | 3300022532 | Soil | ELRHLIQRYPKTNEAVQARDRLRKLGVSTASKPGA |
| Ga0242655_101895551 | 3300022532 | Soil | DGIAQLRHVIQRYPRSTEALQAKDRLRKLGVPTAAARAPGE |
| Ga0212128_100141121 | 3300022563 | Thermal Springs | LGRRDDGVRELRALITRYPKTVEATRARERLRKLGPAA |
| Ga0242670_10217053 | 3300022708 | Soil | GFALIELGKQDDGVAELRHVIQRYPKSNEALQARERLKKLGVASRPGA |
| Ga0242657_10875261 | 3300022722 | Soil | IELGKQDDGVAELRHVIQRYPKSNEALQARERLKKLGVASRPGA |
| Ga0242665_101353831 | 3300022724 | Soil | ELRHLIQRYPHSNEALQARDRLRKLGIASSTRPGE |
| Ga0224544_10688431 | 3300023250 | Soil | DGVTELRHVIQRYPRSNEALQARERLRKLGVSATAHPGQ |
| Ga0224565_10170513 | 3300024176 | Plant Litter | ELGKQEDGVQELRHLIQRYPHSPEALQARERLRKLGVSSATRPGE |
| Ga0207656_101253624 | 3300025321 | Corn Rhizosphere | SQIQLGQQEDGVKALRHVIQRYPRSNEAAQAREQLRKLGVSTSAGARR |
| Ga0207710_104985942 | 3300025900 | Switchgrass Rhizosphere | KDDGVNELRHVIQRYPRSPEATQAQDRLRKLGVASRAR |
| Ga0207640_104566643 | 3300025981 | Corn Rhizosphere | SQIQLGQQEDGVKALRHVIQRYPRSNEAAQAREQLRKLGVSTSAGARRGQ |
| Ga0209376_13510041 | 3300026540 | Soil | ALLELGKQDDGVAALRHVVQRYPKTNEALQARERLRKLGVATVGSARRESQ |
| Ga0207858_10283471 | 3300026909 | Tropical Forest Soil | ALLELGKQDEGVSELKHLIQRYPRSPEALQAKERLRKAGVSSTGRSGL |
| Ga0208240_10199443 | 3300027030 | Forest Soil | LGKQDDGVSELRHVIQRYPHAPEALQARDRLRKLGVATTGK |
| Ga0207762_10439941 | 3300027063 | Tropical Forest Soil | VQELRHLIQRYPKTNEAAQARDRLKKLGVPLTAKAGAE |
| Ga0208043_11049962 | 3300027570 | Peatlands Soil | SSDLKKALALIELGQNDDGVAELRHVIQRYPRTNEALQAREKLRKLGVSATAAPAHRPGE |
| Ga0208324_10788882 | 3300027604 | Peatlands Soil | GIAELRHVIQRYPRSNEALQAKDRLRKLGVSTTASRTRSE |
| Ga0208044_10663501 | 3300027625 | Peatlands Soil | GVSELRHLIQRYPHSPEALQARDRLHKLGVSTVGK |
| Ga0209422_10188783 | 3300027629 | Forest Soil | VSELRHVIQRYPHSPEALQARERLRKLGVPTTGRNS |
| Ga0208827_11481521 | 3300027641 | Peatlands Soil | NDDGVAELRHVIQRYPRTNEALQAREKLRKLGVSATAAPAHRPGE |
| Ga0209530_12076062 | 3300027692 | Forest Soil | SGVQELRHVIQRYPRSPEALQARERLRKLGVSSNGRSGE |
| Ga0209447_101082871 | 3300027701 | Bog Forest Soil | IELGKQDDGVAELRHLIQRYPKSNEALQARERLRKLGVSPAARPGQ |
| Ga0209773_101346173 | 3300027829 | Bog Forest Soil | ELGKQDDGIAELRHVIQRYPKSNEALQARERLRKLGVAPAGRSGQ |
| Ga0209167_100315063 | 3300027867 | Surface Soil | KQADGVTELRHLLQRYPHSPEALQARERLRKLGVSATAKPAA |
| Ga0209167_103470572 | 3300027867 | Surface Soil | ELGKTDDGIAQLRHVIQRYPRSNEALQAKDRLRKLGVSTTAARAPGE |
| Ga0209167_103979383 | 3300027867 | Surface Soil | GKKDDGIAQLRHVIQRYPRSTEALQAKDRLRKLGVPATATRAPGE |
| Ga0209624_102580863 | 3300027895 | Forest Soil | IELGKQEDGVVELRRVIQRYPRSPEALQARERLRKLGVASNARPGE |
| Ga0307282_103651232 | 3300028784 | Soil | KDAGITTLRHVVQRYPRSNEAMQAKDRLRKLGVATAGTGSSRRAE |
| Ga0302235_103734181 | 3300028877 | Palsa | VVELRHVIQRYPRSPEALQARERLRKLGVASNARPGE |
| Ga0308309_112410953 | 3300028906 | Soil | LSLIELGKQDDGITELRHVIQRYPKSNEALQARERLRKLGVAPAPTGRPGQ |
| Ga0308309_113181321 | 3300028906 | Soil | KTDDGIAQLRHVIQRYPRSNEALQAKDRLKKLGVSTTAARAPGE |
| Ga0222748_10550981 | 3300029701 | Soil | GVGELRHVIQRYPHAPEALQARDRLRKLGVATTGK |
| Ga0247271_1089381 | 3300029903 | Soil | VQELRHLIQRYPRSPEALQARERLRKLGVNGAGRPGE |
| Ga0302143_11167481 | 3300029918 | Bog | FSLIELGKQEDGVVELRHVIQRYPKSNEALQARERLKKLGVSTTARPGQ |
| Ga0302306_103294282 | 3300030043 | Palsa | DGVVELRHVIQRYPKSNEALQARERLRKLGVATRPGE |
| Ga0311354_114600602 | 3300030618 | Palsa | KQDDGVTELRHVIQRYPRSNEALQARERLRKLGVSATAHPGQ |
| Ga0316363_100318261 | 3300030659 | Peatlands Soil | DDGVAELRHVIQRYPRTNEALQAREKLRKLGVSATAAPAHRPGE |
| Ga0316363_101051354 | 3300030659 | Peatlands Soil | LIELGKKDDGIAELRHVIQRYPRSNEALQAKDRLRKLGVSTTASRTRSE |
| Ga0307482_10863633 | 3300030730 | Hardwood Forest Soil | FALIELGKQDDGVAELRHVIQRYPRSSEALQARERLKKLGVANRPGA |
| Ga0265460_119618713 | 3300030740 | Soil | LIELGKQDDGVTDLRHVIQRYPKSNEALQARERLRKLGVSPAARSGQ |
| Ga0265770_10899041 | 3300030878 | Soil | QDDGVAELRHVIQRYPHAPEALQARERLRKLGVSTTGK |
| Ga0265757_1046373 | 3300030978 | Soil | GVTELRHLLQRYPHSPEALQARDRLRKLGVAGKAGAGE |
| Ga0170834_1011469842 | 3300031057 | Forest Soil | QAGAERIGFALIESGQKNEGVAALRHVVQRYPRSNEALQAKDRLRKLGVATAASSRPQ |
| Ga0170834_1123817321 | 3300031057 | Forest Soil | GQQEAGILSLRHVIQRYPKSNEALQARDKLRKLGVATTGK |
| Ga0302325_112679413 | 3300031234 | Palsa | ELRHLLQRYPHSPEALQARDRLRKLGVAGKAGAGE |
| Ga0302326_118442423 | 3300031525 | Palsa | KKGFSLIELGKQEDGVVELRRVIQRYPKSNEALQARERLRKLGVATRPGE |
| Ga0307476_102010904 | 3300031715 | Hardwood Forest Soil | LIELGKKDDGIAELRHVIQRYPRSNEALQAKDRLRKLGVSTTAARTRAE |
| Ga0307476_106140873 | 3300031715 | Hardwood Forest Soil | GVQELRHLIQRYPKSPEALQARERLRKLGVAPNTRPGE |
| Ga0307476_107076121 | 3300031715 | Hardwood Forest Soil | VELGKQDDGVTELRHLIQRYPHSPEALQARDRLRKLGVATR |
| Ga0307476_107246103 | 3300031715 | Hardwood Forest Soil | IELGKQDDGVVELRHVIQRYPRSPEALQARERLRKLGVASNARPGE |
| Ga0307474_102803524 | 3300031718 | Hardwood Forest Soil | SLLELGKQEDGVVELRRVIQRYPRSNEALQARERLKKLGVSGRSGE |
| Ga0307474_103584114 | 3300031718 | Hardwood Forest Soil | DDGVAELRHVIQRYPKSNEALQARERLRKLGVAAGAPARPGQ |
| Ga0307469_108268203 | 3300031720 | Hardwood Forest Soil | QKEDGIAELRRLIQRYPRSNEALQAKDKLRKLGVSATGTTARREPQ |
| Ga0307478_100854221 | 3300031823 | Hardwood Forest Soil | ELRHVIQRYPRSNEALQAKDRLRKLGVPTTASRAPGE |
| Ga0307478_111502781 | 3300031823 | Hardwood Forest Soil | GKQEDGVTELRHVIQRYPRSPEALQARERLRKLGVASNARPGE |
| Ga0307478_117332721 | 3300031823 | Hardwood Forest Soil | GVQELRHLIQRYPKTNEAVQARDRLRKLGVSTASKPGA |
| Ga0310912_113996971 | 3300031941 | Soil | QDEGVSELRHLIQRYPRSPEALQAKERLRKAGVSSAPRSGN |
| Ga0307479_105750274 | 3300031962 | Hardwood Forest Soil | IELGKQDDGVAELRHVIQRYPKSNEALQARERLRKLGVATGAPARPGQ |
| Ga0318514_105401011 | 3300032066 | Soil | GKKDDGVQELRHLIQRYPKTNEAAQARDRLKKLGVTAGTRAGAE |
| Ga0318525_102491703 | 3300032089 | Soil | VTELRHLIQRYPKTNEALQARDRLKELGVTTAARPGD |
| Ga0307471_1003057703 | 3300032180 | Hardwood Forest Soil | KDDGVTELRHLIQRYPKTNEALQARERLKKLGVTTATRPGD |
| Ga0307471_1033638321 | 3300032180 | Hardwood Forest Soil | DGVQELRHLIQRYPKTNEAVQARDRLRKLGVSTAAKPGAGTQ |
| Ga0348332_102807551 | 3300032515 | Plant Litter | IELGKQDDGVAELRHVIQRYPKSNEALQARERLRKLGVAPTARPGQ |
| Ga0335078_124412741 | 3300032805 | Soil | GKQDEGVSELRHLIQRYPRASEALQARERLHKLGVSTVGK |
| Ga0335080_120462502 | 3300032828 | Soil | DEGVTELRHLIQRYPHSPEALQARERLRKLGVSSTGRPS |
| Ga0335070_113335842 | 3300032829 | Soil | LRHLIQRYPKTNEATQARERLRKLGASSAAAKPGE |
| Ga0335077_114111173 | 3300033158 | Soil | ALIELGKQDDGIAELRHVIQRYPRSNEALQARERLRKLGVSPARPGE |
| Ga0335077_120100661 | 3300033158 | Soil | ELRHLIQRYPRTNEATEARERLRKLGASAAAPRAQQ |
| Ga0310811_113999211 | 3300033475 | Soil | LGQKDDGVQALRHVIQRFPRSNEALQAKDRLRKLGVSTAGSSRR |
| Ga0370492_0104571_1014_1154 | 3300034282 | Untreated Peat Soil | LLELGKQDDGVQQLRHVIQRYPKSNEALQSRERLRKLGVSPAGRAQ |
| ⦗Top⦘ |