Basic Information | |
---|---|
Family ID | F033069 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 178 |
Average Sequence Length | 37 residues |
Representative Sequence | LSHEPVDEPLQLLEEEARAAGTKDRVVVLEEGVTRFF |
Number of Associated Samples | 150 |
Number of Associated Scaffolds | 178 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 98.88 % |
% of genes from short scaffolds (< 2000 bps) | 87.64 % |
Associated GOLD sequencing projects | 147 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.49 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (75.843 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (9.551 % of family members) |
Environment Ontology (ENVO) | Unclassified (19.663 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.944 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 26.15% β-sheet: 0.00% Coil/Unstructured: 73.85% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 178 Family Scaffolds |
---|---|---|
PF00903 | Glyoxalase | 28.65 |
PF05161 | MOFRL | 10.67 |
PF13660 | DUF4147 | 7.30 |
PF12681 | Glyoxalase_2 | 5.62 |
PF11954 | DUF3471 | 3.93 |
PF13180 | PDZ_2 | 2.25 |
PF13185 | GAF_2 | 2.25 |
PF00487 | FA_desaturase | 1.69 |
PF05016 | ParE_toxin | 1.12 |
PF03720 | UDPG_MGDP_dh_C | 1.12 |
PF07731 | Cu-oxidase_2 | 0.56 |
PF07885 | Ion_trans_2 | 0.56 |
PF03190 | Thioredox_DsbH | 0.56 |
PF03721 | UDPG_MGDP_dh_N | 0.56 |
PF13181 | TPR_8 | 0.56 |
PF07676 | PD40 | 0.56 |
PF12762 | DDE_Tnp_IS1595 | 0.56 |
PF06172 | Cupin_5 | 0.56 |
PF01016 | Ribosomal_L27 | 0.56 |
PF12838 | Fer4_7 | 0.56 |
PF02823 | ATP-synt_DE_N | 0.56 |
PF00326 | Peptidase_S9 | 0.56 |
PF00248 | Aldo_ket_red | 0.56 |
PF02743 | dCache_1 | 0.56 |
PF12706 | Lactamase_B_2 | 0.56 |
PF01026 | TatD_DNase | 0.56 |
PF00595 | PDZ | 0.56 |
PF09844 | DUF2071 | 0.56 |
PF07704 | PSK_trans_fac | 0.56 |
PF11937 | DUF3455 | 0.56 |
PF12695 | Abhydrolase_5 | 0.56 |
PF17209 | Hfq | 0.56 |
PF01804 | Penicil_amidase | 0.56 |
PF00120 | Gln-synt_C | 0.56 |
COG ID | Name | Functional Category | % Frequency in 178 Family Scaffolds |
---|---|---|---|
COG2379 | Glycerate-2-kinase | Carbohydrate transport and metabolism [G] | 10.67 |
COG1398 | Fatty-acid desaturase | Lipid transport and metabolism [I] | 1.69 |
COG3239 | Fatty acid desaturase | Lipid transport and metabolism [I] | 1.69 |
COG0211 | Ribosomal protein L27 | Translation, ribosomal structure and biogenesis [J] | 0.56 |
COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.56 |
COG0355 | FoF1-type ATP synthase, epsilon subunit | Energy production and conversion [C] | 0.56 |
COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.56 |
COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.56 |
COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 0.56 |
COG1331 | Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains | General function prediction only [R] | 0.56 |
COG1893 | Ketopantoate reductase | Coenzyme transport and metabolism [H] | 0.56 |
COG2132 | Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA) | Cell cycle control, cell division, chromosome partitioning [D] | 0.56 |
COG2366 | Acyl-homoserine lactone (AHL) acylase PvdQ | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.56 |
COG2972 | Sensor histidine kinase YesM | Signal transduction mechanisms [T] | 0.56 |
COG3542 | Predicted sugar epimerase, cupin superfamily | General function prediction only [R] | 0.56 |
COG4423 | Uncharacterized conserved protein | Function unknown [S] | 0.56 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 75.84 % |
Unclassified | root | N/A | 24.16 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000364|INPhiseqgaiiFebDRAFT_103583693 | Not Available | 538 | Open in IMG/M |
3300001166|JGI12694J13545_1000178 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 5649 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100292856 | All Organisms → cellular organisms → Bacteria | 1512 | Open in IMG/M |
3300002245|JGIcombinedJ26739_101760786 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 520 | Open in IMG/M |
3300002245|JGIcombinedJ26739_101834834 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
3300003505|JGIcombinedJ51221_10088949 | All Organisms → cellular organisms → Bacteria | 1220 | Open in IMG/M |
3300005167|Ga0066672_10725720 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
3300005336|Ga0070680_101166064 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
3300005435|Ga0070714_101087534 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 779 | Open in IMG/M |
3300005542|Ga0070732_10308730 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
3300005575|Ga0066702_10157484 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1349 | Open in IMG/M |
3300005607|Ga0070740_10222584 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 781 | Open in IMG/M |
3300005610|Ga0070763_10818603 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
3300005616|Ga0068852_100668453 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1047 | Open in IMG/M |
3300005900|Ga0075272_1003336 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 3384 | Open in IMG/M |
3300005995|Ga0066790_10167809 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
3300006034|Ga0066656_10709430 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
3300006052|Ga0075029_100210188 | All Organisms → cellular organisms → Bacteria | 1218 | Open in IMG/M |
3300006052|Ga0075029_100349739 | All Organisms → cellular organisms → Bacteria | 952 | Open in IMG/M |
3300006059|Ga0075017_101088110 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
3300006059|Ga0075017_101422235 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 546 | Open in IMG/M |
3300006102|Ga0075015_100602757 | Not Available | 643 | Open in IMG/M |
3300006102|Ga0075015_100850735 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
3300006162|Ga0075030_100639953 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 843 | Open in IMG/M |
3300006354|Ga0075021_10054129 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2323 | Open in IMG/M |
3300006797|Ga0066659_10483222 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 990 | Open in IMG/M |
3300006806|Ga0079220_10391634 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
3300006871|Ga0075434_100925689 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 886 | Open in IMG/M |
3300006881|Ga0068865_100079861 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2344 | Open in IMG/M |
3300006893|Ga0073928_10082061 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2759 | Open in IMG/M |
3300006903|Ga0075426_11446352 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 522 | Open in IMG/M |
3300007258|Ga0099793_10049467 | All Organisms → cellular organisms → Bacteria | 1849 | Open in IMG/M |
3300009012|Ga0066710_100272113 | All Organisms → cellular organisms → Bacteria | 2464 | Open in IMG/M |
3300009088|Ga0099830_11128089 | Not Available | 650 | Open in IMG/M |
3300009093|Ga0105240_12222378 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
3300009093|Ga0105240_12471492 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 537 | Open in IMG/M |
3300009148|Ga0105243_11668867 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
3300009523|Ga0116221_1276335 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_58_4 | 726 | Open in IMG/M |
3300009525|Ga0116220_10605522 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
3300009632|Ga0116102_1020176 | Not Available | 2315 | Open in IMG/M |
3300009665|Ga0116135_1024672 | All Organisms → cellular organisms → Bacteria | 2057 | Open in IMG/M |
3300009665|Ga0116135_1090586 | All Organisms → cellular organisms → Bacteria | 1098 | Open in IMG/M |
3300009762|Ga0116130_1145588 | Not Available | 746 | Open in IMG/M |
3300009792|Ga0126374_10428041 | Not Available | 933 | Open in IMG/M |
3300009824|Ga0116219_10709025 | Not Available | 550 | Open in IMG/M |
3300010048|Ga0126373_11444806 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
3300010359|Ga0126376_11091652 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 805 | Open in IMG/M |
3300010359|Ga0126376_13174368 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
3300010361|Ga0126378_13219750 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
3300010366|Ga0126379_11139121 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 886 | Open in IMG/M |
3300010371|Ga0134125_11689817 | Not Available | 689 | Open in IMG/M |
3300010376|Ga0126381_103277102 | Not Available | 639 | Open in IMG/M |
3300010379|Ga0136449_100507007 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2093 | Open in IMG/M |
3300010398|Ga0126383_12211432 | Not Available | 636 | Open in IMG/M |
3300011269|Ga0137392_10109728 | All Organisms → cellular organisms → Bacteria | 2187 | Open in IMG/M |
3300011411|Ga0153933_1074093 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dyella → Dyella choica | 725 | Open in IMG/M |
3300012205|Ga0137362_11482014 | Not Available | 565 | Open in IMG/M |
3300012206|Ga0137380_10835243 | Not Available | 794 | Open in IMG/M |
3300012209|Ga0137379_11688921 | Not Available | 530 | Open in IMG/M |
3300012357|Ga0137384_11112708 | Not Available | 632 | Open in IMG/M |
3300012359|Ga0137385_10964191 | Not Available | 704 | Open in IMG/M |
3300012359|Ga0137385_11014132 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
3300012582|Ga0137358_10290386 | Not Available | 1111 | Open in IMG/M |
3300012582|Ga0137358_11089143 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
3300012683|Ga0137398_11101688 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 547 | Open in IMG/M |
3300012917|Ga0137395_10358617 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1039 | Open in IMG/M |
3300012917|Ga0137395_10441608 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 934 | Open in IMG/M |
3300012960|Ga0164301_11543718 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 549 | Open in IMG/M |
3300012984|Ga0164309_11877745 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
3300014200|Ga0181526_10414640 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 854 | Open in IMG/M |
3300014200|Ga0181526_10697529 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 640 | Open in IMG/M |
3300014201|Ga0181537_10222434 | All Organisms → cellular organisms → Bacteria | 1298 | Open in IMG/M |
3300015356|Ga0134073_10284116 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 584 | Open in IMG/M |
3300016294|Ga0182041_11326497 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 659 | Open in IMG/M |
3300017927|Ga0187824_10285170 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
3300017929|Ga0187849_1088830 | All Organisms → cellular organisms → Bacteria | 1333 | Open in IMG/M |
3300017930|Ga0187825_10147559 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 830 | Open in IMG/M |
3300017943|Ga0187819_10706456 | Not Available | 568 | Open in IMG/M |
3300017946|Ga0187879_10880578 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_58_4 | 501 | Open in IMG/M |
3300017955|Ga0187817_10093294 | All Organisms → cellular organisms → Bacteria | 1889 | Open in IMG/M |
3300017955|Ga0187817_10651982 | Not Available | 672 | Open in IMG/M |
3300017966|Ga0187776_11374717 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 537 | Open in IMG/M |
3300017973|Ga0187780_11232426 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 549 | Open in IMG/M |
3300017975|Ga0187782_10678685 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 794 | Open in IMG/M |
3300017995|Ga0187816_10486316 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
3300018006|Ga0187804_10040560 | All Organisms → cellular organisms → Bacteria | 1792 | Open in IMG/M |
3300018006|Ga0187804_10093435 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1228 | Open in IMG/M |
3300018007|Ga0187805_10107170 | All Organisms → cellular organisms → Bacteria | 1265 | Open in IMG/M |
3300018007|Ga0187805_10449830 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 601 | Open in IMG/M |
3300018012|Ga0187810_10404033 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 574 | Open in IMG/M |
3300018020|Ga0187861_10178493 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 962 | Open in IMG/M |
3300018022|Ga0187864_10102153 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1489 | Open in IMG/M |
3300018035|Ga0187875_10609837 | Not Available | 575 | Open in IMG/M |
3300018042|Ga0187871_10116589 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1528 | Open in IMG/M |
3300018043|Ga0187887_10749320 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 577 | Open in IMG/M |
3300018044|Ga0187890_10574492 | Not Available | 635 | Open in IMG/M |
3300018058|Ga0187766_10011483 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5079 | Open in IMG/M |
3300018058|Ga0187766_10723399 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 689 | Open in IMG/M |
3300018058|Ga0187766_10891297 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 627 | Open in IMG/M |
3300018062|Ga0187784_10288473 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1333 | Open in IMG/M |
3300018062|Ga0187784_10844203 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 730 | Open in IMG/M |
3300018062|Ga0187784_11296532 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 577 | Open in IMG/M |
3300018086|Ga0187769_10048971 | All Organisms → cellular organisms → Bacteria | 2930 | Open in IMG/M |
3300018089|Ga0187774_10172022 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1158 | Open in IMG/M |
3300018090|Ga0187770_10334510 | All Organisms → cellular organisms → Bacteria | 1182 | Open in IMG/M |
3300018468|Ga0066662_10374320 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1238 | Open in IMG/M |
3300019785|Ga0182022_1099436 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 1740 | Open in IMG/M |
3300019786|Ga0182025_1256200 | All Organisms → cellular organisms → Bacteria | 1787 | Open in IMG/M |
3300020579|Ga0210407_10768001 | Not Available | 745 | Open in IMG/M |
3300020580|Ga0210403_10400167 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1121 | Open in IMG/M |
3300020580|Ga0210403_10796256 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 752 | Open in IMG/M |
3300020581|Ga0210399_11586709 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
3300020583|Ga0210401_11040894 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_58_4 | 677 | Open in IMG/M |
3300020583|Ga0210401_11212733 | Not Available | 613 | Open in IMG/M |
3300021178|Ga0210408_10886409 | Not Available | 695 | Open in IMG/M |
3300021407|Ga0210383_11280899 | Not Available | 613 | Open in IMG/M |
3300021420|Ga0210394_10955096 | Not Available | 744 | Open in IMG/M |
3300021432|Ga0210384_10040225 | All Organisms → cellular organisms → Bacteria | 4301 | Open in IMG/M |
3300021433|Ga0210391_10323563 | All Organisms → cellular organisms → Bacteria | 1210 | Open in IMG/M |
3300021478|Ga0210402_11223360 | Not Available | 678 | Open in IMG/M |
3300021560|Ga0126371_10174222 | All Organisms → cellular organisms → Bacteria | 2230 | Open in IMG/M |
3300022467|Ga0224712_10183968 | Not Available | 943 | Open in IMG/M |
3300024271|Ga0224564_1111889 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 557 | Open in IMG/M |
3300025414|Ga0208935_1015864 | Not Available | 1009 | Open in IMG/M |
3300025507|Ga0208188_1085072 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 731 | Open in IMG/M |
3300025911|Ga0207654_10855508 | Not Available | 658 | Open in IMG/M |
3300025922|Ga0207646_11025354 | Not Available | 728 | Open in IMG/M |
3300025924|Ga0207694_11032034 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
3300025928|Ga0207700_10664963 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
3300025932|Ga0207690_11422844 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 580 | Open in IMG/M |
3300025939|Ga0207665_10793014 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
3300025941|Ga0207711_11920830 | Not Available | 535 | Open in IMG/M |
3300025944|Ga0207661_11621542 | Not Available | 592 | Open in IMG/M |
3300025972|Ga0207668_11298115 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 655 | Open in IMG/M |
3300025998|Ga0208651_1022552 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
3300026078|Ga0207702_10026982 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4769 | Open in IMG/M |
3300026334|Ga0209377_1147397 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
3300026480|Ga0257177_1048995 | Not Available | 652 | Open in IMG/M |
3300026490|Ga0257153_1041352 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 950 | Open in IMG/M |
3300026538|Ga0209056_10032253 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4925 | Open in IMG/M |
3300027629|Ga0209422_1018296 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1737 | Open in IMG/M |
3300027696|Ga0208696_1015730 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2937 | Open in IMG/M |
3300027698|Ga0209446_1166174 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 569 | Open in IMG/M |
3300027825|Ga0209039_10031490 | All Organisms → cellular organisms → Bacteria | 2554 | Open in IMG/M |
3300027842|Ga0209580_10011456 | All Organisms → cellular organisms → Bacteria | 3822 | Open in IMG/M |
3300027842|Ga0209580_10551153 | Not Available | 573 | Open in IMG/M |
3300027889|Ga0209380_10145830 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_58_4 | 1382 | Open in IMG/M |
3300027889|Ga0209380_10535431 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
3300028673|Ga0257175_1004837 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1798 | Open in IMG/M |
3300028860|Ga0302199_1165812 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 684 | Open in IMG/M |
3300029908|Ga0311341_10761730 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 537 | Open in IMG/M |
3300029914|Ga0311359_10247703 | All Organisms → cellular organisms → Bacteria | 1517 | Open in IMG/M |
3300030053|Ga0302177_10389101 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 731 | Open in IMG/M |
3300030058|Ga0302179_10081325 | All Organisms → cellular organisms → Bacteria | 1434 | Open in IMG/M |
3300030506|Ga0302194_10025161 | All Organisms → cellular organisms → Bacteria | 3193 | Open in IMG/M |
3300031122|Ga0170822_11991227 | Not Available | 533 | Open in IMG/M |
3300031231|Ga0170824_109656534 | Not Available | 525 | Open in IMG/M |
3300031231|Ga0170824_114931749 | Not Available | 743 | Open in IMG/M |
3300031233|Ga0302307_10057231 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_58_4 | 2072 | Open in IMG/M |
3300031344|Ga0265316_10813844 | Not Available | 655 | Open in IMG/M |
3300031711|Ga0265314_10647230 | Not Available | 539 | Open in IMG/M |
3300031720|Ga0307469_10831688 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
3300031753|Ga0307477_10589459 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 750 | Open in IMG/M |
3300031754|Ga0307475_10929227 | Not Available | 686 | Open in IMG/M |
3300031941|Ga0310912_10359587 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1131 | Open in IMG/M |
3300031962|Ga0307479_10487829 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1216 | Open in IMG/M |
3300031962|Ga0307479_10838970 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 893 | Open in IMG/M |
3300031962|Ga0307479_11386009 | Not Available | 662 | Open in IMG/M |
3300032001|Ga0306922_11196070 | Not Available | 774 | Open in IMG/M |
3300032160|Ga0311301_11535056 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 817 | Open in IMG/M |
3300032160|Ga0311301_12507476 | Not Available | 576 | Open in IMG/M |
3300032180|Ga0307471_100385990 | All Organisms → cellular organisms → Bacteria | 1523 | Open in IMG/M |
3300032805|Ga0335078_10131516 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 3566 | Open in IMG/M |
3300032805|Ga0335078_12035811 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
3300032828|Ga0335080_11036891 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 833 | Open in IMG/M |
3300032896|Ga0335075_10652669 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1025 | Open in IMG/M |
3300032898|Ga0335072_10485148 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1287 | Open in IMG/M |
3300033289|Ga0310914_10506335 | All Organisms → cellular organisms → Bacteria | 1092 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.55% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.87% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 6.74% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 6.18% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.06% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 4.49% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 4.49% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.93% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.93% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.93% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 3.37% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.37% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.25% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 2.25% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.25% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.81% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.69% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.69% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.69% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.69% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.69% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.69% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.12% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.12% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.12% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.12% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.12% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.12% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.12% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.12% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.56% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.56% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.56% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.56% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.56% |
Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.56% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.56% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.56% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.56% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.56% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.56% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.56% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.56% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.56% |
Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.56% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300001166 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
3300005607 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
3300005900 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_404 | Environmental | Open in IMG/M |
3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
3300009632 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 | Environmental | Open in IMG/M |
3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
3300009762 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40 | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011411 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ017 MetaG | Host-Associated | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
3300017929 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100 | Environmental | Open in IMG/M |
3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
3300018020 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100 | Environmental | Open in IMG/M |
3300018022 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40 | Environmental | Open in IMG/M |
3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300019785 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300024271 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5 | Environmental | Open in IMG/M |
3300025414 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 (SPAdes) | Environmental | Open in IMG/M |
3300025507 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 (SPAdes) | Environmental | Open in IMG/M |
3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025998 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_204 (SPAdes) | Environmental | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
3300026480 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-B | Environmental | Open in IMG/M |
3300026490 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A | Environmental | Open in IMG/M |
3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027696 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
3300028673 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-B | Environmental | Open in IMG/M |
3300028860 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_3 | Environmental | Open in IMG/M |
3300029908 | II_Bog_E1 coassembly | Environmental | Open in IMG/M |
3300029914 | III_Bog_E2 coassembly | Environmental | Open in IMG/M |
3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
3300030506 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_1 | Environmental | Open in IMG/M |
3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031233 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2 | Environmental | Open in IMG/M |
3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Host-Associated | Open in IMG/M |
3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Host-Associated | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
INPhiseqgaiiFebDRAFT_1035836932 | 3300000364 | Soil | PMDEPLKFLEEVAKKSGIGDRVLVLNEGVTRIFG* |
JGI12694J13545_10001781 | 3300001166 | Forest Soil | EPVEEPLQLLEQEVRAAGIEDRVVVLEEGVTRFF* |
JGIcombinedJ26739_1002928561 | 3300002245 | Forest Soil | XPVEEPLQLLEKEARAAGIEDRVVVLEEGVTRFF* |
JGIcombinedJ26739_1017607862 | 3300002245 | Forest Soil | FRLSHEPVDEPLQLLDQEARSAGMKDKVLVMEEGVTRFF* |
JGIcombinedJ26739_1018348342 | 3300002245 | Forest Soil | RLSHEPIDEPLQLLDEEARSAGIEDRVFVLEEGITRFF* |
JGIcombinedJ51221_100889491 | 3300003505 | Forest Soil | SFRLSHEPVDEPLQLLEQEAKHAGIQDRVVVLEEGVTKFF* |
Ga0066672_107257201 | 3300005167 | Soil | TFRLSHEPVDEPLQLLDQEARAAGVQDKVVVLEEGVTRFF* |
Ga0070680_1011660641 | 3300005336 | Corn Rhizosphere | FRLSHEPVDEPLQLLDQEARAAGVQDKVVVLEEGVTRFF* |
Ga0070714_1010875342 | 3300005435 | Agricultural Soil | GTFRLSHEPVDEPLQLLDQAADEAGVQDRVVVMQEGVTKFF* |
Ga0070732_103087303 | 3300005542 | Surface Soil | LSHEPIDEPLQLLDQEARLAGVRDRVFVLEEGVTKFF* |
Ga0066702_101574841 | 3300005575 | Soil | HEPMDEPTERLGEAAKLAGVSERVIVMEEGVTRFFSS* |
Ga0070740_102225843 | 3300005607 | Surface Soil | LSYEPMEEPLQRLRIAAAAAGVSDRVMVLEEGKTKIFR* |
Ga0070763_108186031 | 3300005610 | Soil | FRLSHEPVEEPLQLLDQEAVAHGIKDRVVVLEEGVTRFF* |
Ga0068852_1006684531 | 3300005616 | Corn Rhizosphere | SHEPLDEPLQLLEQEAAAAGVSDRVLVLPEGVTKLF* |
Ga0075272_10033364 | 3300005900 | Rice Paddy Soil | LSHEPIDEPLRLLEKEAQAAGVLDRVLVLEEGVTRFF* |
Ga0066790_101678093 | 3300005995 | Soil | LSHEPMEEPLQLLSAEARVAGVEDRLLILEEGVTQLFRGRGRI* |
Ga0066656_107094302 | 3300006034 | Soil | LSHEPVDEPLQLLDQEARAAGVQDKVVVLEEGVTRFF* |
Ga0075029_1002101884 | 3300006052 | Watersheds | FRLSHEPVDEPLQLLDQEAKAAGIKDRVIVLEEGVTRFF* |
Ga0075029_1003497393 | 3300006052 | Watersheds | EPVDEPLQLLDEEARANGTKDRVVVMEEGVTRFF* |
Ga0075017_1010881102 | 3300006059 | Watersheds | TFRLSHEPVDEPLQLLEREAASAGVSEKVVVMDEGVTRFF* |
Ga0075017_1014222351 | 3300006059 | Watersheds | SHEPIEEPLQLLEQEAEAAGVSDRVVVLEEGVTRFF* |
Ga0075015_1006027572 | 3300006102 | Watersheds | TFRLSHEPVDEPLQLLEREARAAGIEDRVVVMEEGVTRFF* |
Ga0075015_1008507351 | 3300006102 | Watersheds | FKLSHEPMDEPLQLLEQEAKAAGIEDRVLVLQEGVTQFF* |
Ga0075030_1006399532 | 3300006162 | Watersheds | HEPMEEPLQLLQKEAAAAGVKHKVVVLEEGVTRFF* |
Ga0075021_100541294 | 3300006354 | Watersheds | LSHEPIDEPLQLLDQEARAAGVKDKVVVLEEGITKFF* |
Ga0066659_104832222 | 3300006797 | Soil | HEPIDEPLQLLDQAARQAGVQDRVLVLTEGVTKIF* |
Ga0079220_103916342 | 3300006806 | Agricultural Soil | EPIDEPLQLLEKEAKSAGIEDQVVVLEEGVTKFF* |
Ga0075434_1009256892 | 3300006871 | Populus Rhizosphere | LSHEPMEEPVQLLEQEAKAAGVIDRVHVLQEGVTRVF* |
Ga0068865_1000798611 | 3300006881 | Miscanthus Rhizosphere | FRLSHEPLDEPLQLLEQEAAAAGVSDRVLVLPEGVTKLF* |
Ga0073928_100820614 | 3300006893 | Iron-Sulfur Acid Spring | SHEPMDEPLQLLEQEARAAGIEDRVFVLEEGVTRFF* |
Ga0075426_114463522 | 3300006903 | Populus Rhizosphere | PMEEPLQLLEQEARAAGVQDRVVVLEEGKTRFFKSSWY* |
Ga0099793_100494671 | 3300007258 | Vadose Zone Soil | HEPVDEPLQLLDKEARNAGIADRVVVLEEGVTQFF* |
Ga0066710_1002721131 | 3300009012 | Grasslands Soil | FRWSHEPIDEPLQLLEKEALAAGITERVLVLDEGITKIF |
Ga0099830_111280891 | 3300009088 | Vadose Zone Soil | FRLSHEPIDEPLQLLEQEARSAGIKDRVVVMEEGVTRFF* |
Ga0105240_122223782 | 3300009093 | Corn Rhizosphere | EPMDEPLQLLEQEAAAAGVSDRVLVLPEGVTKLF* |
Ga0105240_124714922 | 3300009093 | Corn Rhizosphere | RLSHEPIDEPLQLLEQEAKKAGISDQVVVLEEGVTKLF* |
Ga0105243_116688672 | 3300009148 | Miscanthus Rhizosphere | HAPLEEPLQLLDREAAGAGVSDRVLVLPEGVTKLF* |
Ga0116221_12763352 | 3300009523 | Peatlands Soil | RLSHEPVDEPLQLLDQEAQAAGVKDRVMVMEEGVTRFF* |
Ga0116220_106055221 | 3300009525 | Peatlands Soil | TFRLSHEPVDEPLQLLDEEARAAGIKDRVVVMQEGVTRFF* |
Ga0116102_10201763 | 3300009632 | Peatland | FRLSHEPIEEPLQLLEREALKAGVKDKVLVLEEGVTRFF* |
Ga0116135_10246723 | 3300009665 | Peatland | EPIEEPLQLLGQEARKAGIEDKVVVLEEGITRLF* |
Ga0116135_10905863 | 3300009665 | Peatland | SHEPVDEPLQLLEQEARAAGIEDRVVVLEEGVTKFFGS* |
Ga0116130_11455881 | 3300009762 | Peatland | HEPIEEPLQLLEREALKAGVRDRVLVMEEGITRFF* |
Ga0126374_104280411 | 3300009792 | Tropical Forest Soil | RLSHEPIDEPLQLLDSEAKKAGVTDRVIVLEEGLTKFF* |
Ga0116219_107090251 | 3300009824 | Peatlands Soil | HEPVDEPLQLLHQEAEAAGIEDKVVVLEEGVTRFF* |
Ga0126373_114448063 | 3300010048 | Tropical Forest Soil | SHEPMDEPLQLLEREAQAAGIKDRVLVLKEGVTRIF* |
Ga0126376_110916522 | 3300010359 | Tropical Forest Soil | RLSHEPVDEPLQLLEQEAKVAGIKDRVVVLEEGVTKFF* |
Ga0126376_131743682 | 3300010359 | Tropical Forest Soil | FRLSHEPVEEPLQLLDQEARAAGIEDRVVVLEEGITRFF* |
Ga0126378_132197502 | 3300010361 | Tropical Forest Soil | FRLSHEPVDEPLQLLEKEAKHAGIQDRVVVLEEGVTRFF* |
Ga0126379_111391212 | 3300010366 | Tropical Forest Soil | GTFRLPNEPIDEPLQLLEQEDRAAGVKDQVVVLEEGVTRFF* |
Ga0134125_116898172 | 3300010371 | Terrestrial Soil | EPMEEPLQLLEQEARRAGVEDKVLVLPEGITKIF* |
Ga0126381_1032771022 | 3300010376 | Tropical Forest Soil | SHEPVEEPLQLLDQEARAAGIEDRVVVLEEGITRFF* |
Ga0136449_1005070073 | 3300010379 | Peatlands Soil | TFRLSHEPIDEPLQLLDQEARLAGVRDRVVVLEEGVTKFF* |
Ga0126383_122114321 | 3300010398 | Tropical Forest Soil | LSHEPLDEPLQLLDREARRIGIQDRVLVLQEGVTKIF* |
Ga0137392_101097284 | 3300011269 | Vadose Zone Soil | EPVDEPLQLLEQEARQAGIEDRVVVLEEGVTRFF* |
Ga0153933_10740931 | 3300011411 | Attine Ant Fungus Gardens | TFRLSHEPVDEPLQLLDQEAGSAGIKERVVVMEEGVTRFF* |
Ga0137362_114820142 | 3300012205 | Vadose Zone Soil | SHEPIEEPLQLLGQEAEAAGVKDRVVVLEEGVTHFF* |
Ga0137380_108352432 | 3300012206 | Vadose Zone Soil | LSHEPVDEPLQLLEQEADAAGTKDRVVVMEEGVTRFF* |
Ga0137379_116889212 | 3300012209 | Vadose Zone Soil | MSHEPMDEPLQLLEQEASAAGIQDRVLVLDEGITRIF* |
Ga0137384_111127081 | 3300012357 | Vadose Zone Soil | EPMDEPLQLLDQEARAAGIQDRVLVLSEGVTQIFDKS* |
Ga0137385_109641912 | 3300012359 | Vadose Zone Soil | EPMEEPLQLLEQEARAAGIHERVLVLKEGVTKIF* |
Ga0137385_110141321 | 3300012359 | Vadose Zone Soil | HEPMDEPLQLLDQEARAAGIQDRVLVLSEGVTQIFDKF* |
Ga0137358_102903861 | 3300012582 | Vadose Zone Soil | SFRLSHEPVDEPLQLLDKEARNAGIADRVVVLEEGVTQFF* |
Ga0137358_110891431 | 3300012582 | Vadose Zone Soil | LSHEPMDEPLQLLEEEAKAAGIEDRVFVLEEGVTRFF* |
Ga0137398_111016882 | 3300012683 | Vadose Zone Soil | HEHIEEPLQLLEREDQKAGVKDKVVVLEEGITRFF* |
Ga0137395_103586171 | 3300012917 | Vadose Zone Soil | FRLSHEPIEEPLQLLEREALKAGVKDKVVVLEEGVTRFF* |
Ga0137395_104416081 | 3300012917 | Vadose Zone Soil | TFRLSHEPIEEPLQLLEREALKAGVKDKVVVLEEGVTRFF* |
Ga0164301_115437182 | 3300012960 | Soil | LSQEPMDEPLQLLEKEATAAGIEDRVFVLEEGVTKFF* |
Ga0164309_118777451 | 3300012984 | Soil | EPMDEPLQLLEKEAKAAGIEDRVFVLEEGVTKFF* |
Ga0181526_104146401 | 3300014200 | Bog | HEPVEEPLQLLKKEARAAGIEDRVIVLEEGVTKFF* |
Ga0181526_106975292 | 3300014200 | Bog | GSFRLSHEPVDEPLQLLEHEAEVAGTKDRVVVMEEGVTRFF* |
Ga0181537_102224343 | 3300014201 | Bog | RLSHEPIEEPLQLLEKEARAAGIKDKVVVLEEGVTRFF* |
Ga0134073_102841162 | 3300015356 | Grasslands Soil | LSHEPMDEPLQLLDDAARQAGVQDRVLVLREGITKIF* |
Ga0182041_113264972 | 3300016294 | Soil | RLSHEPIEEPLQLLEREAKAAGIVDRVLVMEEGVTRFF |
Ga0187824_102851701 | 3300017927 | Freshwater Sediment | HEPMDEPLQLLEQEAAAAGVSDKILVLPEGVTKLF |
Ga0187849_10888302 | 3300017929 | Peatland | FRLSHEPIEEPLQLLEREALAAGVKDKVVVLEEGITRFF |
Ga0187825_101475592 | 3300017930 | Freshwater Sediment | RLSHEPVDEPLQLLEKEAATAGVRDRVVVLEEGVTRFF |
Ga0187819_107064561 | 3300017943 | Freshwater Sediment | LSHEPVDEPLQLLEEEARAAGIEDRVVVMEEGVTRFF |
Ga0187879_108805782 | 3300017946 | Peatland | TFRLSHEPVDEPLQLLAEEARAAGTKDRVVVMEEGVTRFF |
Ga0187817_100932943 | 3300017955 | Freshwater Sediment | HEPIDEPLQLLEQEAKAAGIEDRVVVLEEGVTQFF |
Ga0187817_106519821 | 3300017955 | Freshwater Sediment | HEPVDEPLQLLDEEARAAGVKDRVVVMEEGITRFF |
Ga0187776_113747172 | 3300017966 | Tropical Peatland | RLSHEPIDEPLQLLEQEAKAAGIEDRVRVLQEGVTQLF |
Ga0187780_112324262 | 3300017973 | Tropical Peatland | GSFRLSHEPVDEPLQLLEEESRAAGVEDRVVVMEEGVTRFF |
Ga0187782_106786852 | 3300017975 | Tropical Peatland | SHEPVEEPLQLLEEEVRAAGIEDRVVVMEEGVTRFF |
Ga0187816_104863162 | 3300017995 | Freshwater Sediment | LSHEPVDEPLQLLDQAVRAAGVEDRLVVMEEGVTRFF |
Ga0187804_100405601 | 3300018006 | Freshwater Sediment | RLSHEPIEEPLQLLQQEAQAAGVKDRVVVLEEGVTRFF |
Ga0187804_100934352 | 3300018006 | Freshwater Sediment | SHEPMDEPLKLLAKEARRAGVQDRVKVLPEGVTAFF |
Ga0187805_101071702 | 3300018007 | Freshwater Sediment | MFKKTALDEPLQLLKSEAKAAGIEDRVLVLQEGITRLF |
Ga0187805_104498302 | 3300018007 | Freshwater Sediment | LSHEPIDEPLQLLEQEAKAAGIEDRVKVLEEGVTQLF |
Ga0187810_104040332 | 3300018012 | Freshwater Sediment | SHEPIDEPLKLLAKEAKRAGIQDRVRVLREGVTAFF |
Ga0187861_101784931 | 3300018020 | Peatland | LSHEPIEEPLQLLEREALAAGVKDKVVVLEEGITRFF |
Ga0187864_101021533 | 3300018022 | Peatland | FRLSHEPIEEPLQLLEREALKAGVKDKVLVLEEGVTRFF |
Ga0187875_106098373 | 3300018035 | Peatland | RLSHEPIEEPLQLLEREALKAGVKDKVVVLEEGVTRFF |
Ga0187871_101165893 | 3300018042 | Peatland | FRLSHEPIDEPLQLLEREAAKAGVKDKVVVLEEGITRFF |
Ga0187887_107493201 | 3300018043 | Peatland | TFRLSHEPIDEPLQLLEREAAKAGVKDKVVVLEEGITRFF |
Ga0187890_105744921 | 3300018044 | Peatland | LSHEPIEEPLQLLEREALAAGVIDKVVVLEEGVTRFF |
Ga0187766_100114835 | 3300018058 | Tropical Peatland | LSHEPIDEPLQLLEQEAKARGIEDRVLVLEEGITQFF |
Ga0187766_107233991 | 3300018058 | Tropical Peatland | RLSHEPVDEPLQLLDREARAAGIQDRVVVMEEGITRFF |
Ga0187766_108912971 | 3300018058 | Tropical Peatland | SFRLSNEPIDEPLKLLAKEAKRAGIQDRVRVLPEGVTAFF |
Ga0187784_102884733 | 3300018062 | Tropical Peatland | GTFRLSHEPIDEPLHLLERGAKAAGIEDRVVAMEESVTQFF |
Ga0187784_108442031 | 3300018062 | Tropical Peatland | TFRLSHEPVEEPLQLLDQEARAAGIKDRVVVMEEGVTRFF |
Ga0187784_112965322 | 3300018062 | Tropical Peatland | GSFRLSHEPIDEPLKLLAKEARRAGIQERVRVLPEGVTAFF |
Ga0187769_100489711 | 3300018086 | Tropical Peatland | SHEPVEEPLQLLEQEARSAGIQDRVVVLEEGITRFF |
Ga0187774_101720221 | 3300018089 | Tropical Peatland | LSHEPIDEPLRLLAKEARRAGIQDRVRVLPEGVTAFF |
Ga0187770_103345104 | 3300018090 | Tropical Peatland | FRLSHEPVDEPLELLDQEARAAGVKDRVVVLEEGVTRLF |
Ga0066662_103743202 | 3300018468 | Grasslands Soil | SHEPIDEPLQLLQHEAEAAGIQDRVVVMEEGVTQFF |
Ga0182022_10994361 | 3300019785 | Fen | SFRLSHEPIEEPLQLLEREALKAGVKDKVVVLEEGVTRFF |
Ga0182025_12562003 | 3300019786 | Permafrost | MSLWTNRLQLLEQEAKAAGIEDRVLVLEEGVTRFF |
Ga0210407_107680012 | 3300020579 | Soil | HEPVDEPLQLLEREARAAGIEDRVVVLEEGVTKFF |
Ga0210403_104001672 | 3300020580 | Soil | AHEPVDEPLQLLEQEARSAGIADRVVVLEEGVTRFF |
Ga0210403_107962561 | 3300020580 | Soil | RLSHEPVDEPLQLLDQEAQAAGTKDRVVVMEEGVTRFF |
Ga0210399_115867092 | 3300020581 | Soil | LSHEPVDEPLRLLAQEAKAAGIEDRVRVMEEGVTQFF |
Ga0210401_110408941 | 3300020583 | Soil | FRLSHEPVDEPLQLLDQEARAAGVKDRVMVMEEGVTRFF |
Ga0210401_112127332 | 3300020583 | Soil | LSHEPIDEPLQLLDKEARQAGIRDRVVVLEEGLTKFF |
Ga0210408_108864092 | 3300021178 | Soil | LSHEPVDEPLQLLEEEARAAGTKDRVVVLEEGVTRFF |
Ga0210383_112808991 | 3300021407 | Soil | SHEPREEPLQLLEQEAKAAGIEDRVLVLEEGVTRFF |
Ga0210394_109550963 | 3300021420 | Soil | LSHEPVDEPLQLLEQEARAAGAKDRVVVMEEGVTRFF |
Ga0210384_100402257 | 3300021432 | Soil | LSHEPMEEPLQLLEQEAKAAGIEDRVLVLEEGVTRFF |
Ga0210391_103235634 | 3300021433 | Soil | LSHEPMDEPLQLLEQEAKAAGIEDRVFVMEEGVTRFF |
Ga0210402_112233602 | 3300021478 | Soil | LSHEPVDEPLQLLAEEAHSAGIEDRVLVMEEGVTRFF |
Ga0126371_101742224 | 3300021560 | Tropical Forest Soil | SHEPLDEPLQLLDREARRIGIQERVLVLQEGVTKIF |
Ga0224712_101839681 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | HEPMEEPLQLLEQEAAAAGVSDRVLVLPEGVTKLF |
Ga0224564_11118891 | 3300024271 | Soil | SHEPVDEPLQLLQQEAHAAGIEDRVVVLEEGVTRFF |
Ga0208935_10158642 | 3300025414 | Peatland | FRLSHEPVEEPLQLLEQEARMAGIRDRVLVLEEGVTRFF |
Ga0208188_10850722 | 3300025507 | Peatland | RLSHEPIEEPLQLLEQEAMAAGVKDKVVVLEEGVTHFF |
Ga0207654_108555082 | 3300025911 | Corn Rhizosphere | FRLSHEPVDEPLQLLDQEARAAGVQDKVVVLEEGVTRFF |
Ga0207646_110253541 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | HEPVDEPLQLLDQEARSAGIKDRVVVMEEGVTRFF |
Ga0207694_110320341 | 3300025924 | Corn Rhizosphere | TFRLSHEPLDEPLQLLEQEAAAAGVSDRVLVLPEGVTKLF |
Ga0207700_106649631 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | SHEPMEEPLQLLEQEAAAAGVSDRVLVLPEGVTKLF |
Ga0207690_114228442 | 3300025932 | Corn Rhizosphere | LSHEPMDEPLLLLKQEALDAGIEKKVVVMEEGVTQFF |
Ga0207665_107930141 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | LSHEPMEEPLALLEKEAKAAGIQDRVLIMEEGVTKFF |
Ga0207711_119208302 | 3300025941 | Switchgrass Rhizosphere | LSHEPLDEPLQLLEQEAAAAGVSDRVLVLPEGVTKLF |
Ga0207661_116215421 | 3300025944 | Corn Rhizosphere | HEPVDEPLQLLDQEARAAGVQDKVVVLEEGVTHFF |
Ga0207668_112981151 | 3300025972 | Switchgrass Rhizosphere | RLSHEPIDEPLQLLEKEAEAAGITDRVVVLEEGVTKFF |
Ga0208651_10225521 | 3300025998 | Rice Paddy Soil | RLSHEPIDEPLRLLEKEAQAAGVLDRVLVLEEGVTRFF |
Ga0207702_100269821 | 3300026078 | Corn Rhizosphere | SHEPVDEPLQLLDREARAAGIKDKVVVLEEGVTRFF |
Ga0209377_11473973 | 3300026334 | Soil | PMDEPLQLLDQEARAAGIQDRVLVLSEGVTQIFDKS |
Ga0257177_10489951 | 3300026480 | Soil | HEPIEEPLQLLEREALKAGVKDKVVVLEEGITRFF |
Ga0257153_10413522 | 3300026490 | Soil | RLSHEPIEEPLQLLEREAQKAGVKDKVVVLEEGITRFF |
Ga0209056_100322531 | 3300026538 | Soil | FRLSHEPIDEPLLLLDHAARQAGVQDRVLVLTEGVTKIF |
Ga0209422_10182964 | 3300027629 | Forest Soil | SHEPIEEPLQLLEREAQKAGVKDKVVVLEEGITRFF |
Ga0208696_10157301 | 3300027696 | Peatlands Soil | FRLSHEPIEEPLQLLEREALKAGVKDKVLVLEEGITRFF |
Ga0209446_11661741 | 3300027698 | Bog Forest Soil | SHEPIEEPLQLLEREAVKAGVKDKVVVLEEGITRFF |
Ga0209039_100314904 | 3300027825 | Bog Forest Soil | FRLSHEPVDEPLQLLEQEARSAGIEDRVVVMEEGVTRFF |
Ga0209580_100114566 | 3300027842 | Surface Soil | PLDEPLQLLDHEARRVGIRDRVLVLQEGVTKIFRE |
Ga0209580_105511531 | 3300027842 | Surface Soil | LSHEPIDEPLQLLDQEARLAGVRDRVFVLEEGVTKFF |
Ga0209380_101458301 | 3300027889 | Soil | QEPVDEPLQLLDQEAQAAGTKDRVVVMEEGVTRFF |
Ga0209380_105354311 | 3300027889 | Soil | RLSHEPIDEPLQLLEKEARAAGIEESVRVMEEGVTQFF |
Ga0257175_10048373 | 3300028673 | Soil | HEPMDEPLQLLEKEAKAAGIEDRVVVMEEGVTRFF |
Ga0302199_11658121 | 3300028860 | Bog | RLSHEPIEEPLQLLEREALAAGVKDKVVVLEEGITRFF |
Ga0311341_107617301 | 3300029908 | Bog | FRLSHEPVDEPLQLLEQEAREAGIEDRVVVLQEGVTRFF |
Ga0311359_102477031 | 3300029914 | Bog | FRLSHEPIEEPLQLLERAALAAGVRDKVVVLEEGVTRFF |
Ga0302177_103891013 | 3300030053 | Palsa | LSHEPIEEPLQLLEKEARAAGVKDKVVVLEEGITRFF |
Ga0302179_100813251 | 3300030058 | Palsa | HEPIEEPLQLLERAAQAAGVKDKVVVLEEGVTRFF |
Ga0302194_100251616 | 3300030506 | Bog | SFRLSHEPIEEPLQLLEREALAAGVKDKVVVLEEGITRFF |
Ga0170822_119912272 | 3300031122 | Forest Soil | FRLSHEPIDEPLQLLDEEARSHGIEDRVCVLEEGVTRFF |
Ga0170824_1096565341 | 3300031231 | Forest Soil | HEPVDEPLQLLEQEADAAGTKDRVVVMEEGVTRFF |
Ga0170824_1149317491 | 3300031231 | Forest Soil | SLSHEPIEEPLQLLEKEATAAGIKDRVLILDEGITRIF |
Ga0302307_100572313 | 3300031233 | Palsa | RLSHEPVDEPLQLLDEEARAAGTKDRVVVMEEGVTRFF |
Ga0265316_108138443 | 3300031344 | Rhizosphere | SHEPMEEPLQLLEREAKAAGVKDRVFVLEEGVTRFF |
Ga0265314_106472301 | 3300031711 | Rhizosphere | LSHEPIEEPLQLLEREAQAAGVKDRVVVLEEGITRFF |
Ga0307469_108316881 | 3300031720 | Hardwood Forest Soil | LSHEPLEEPLQLLDREARRAGIQDRVLVLEEGVTKIF |
Ga0307477_105894591 | 3300031753 | Hardwood Forest Soil | HEPVDEPLQLLDEEARTAGVKDRVIVMEEGVTRFF |
Ga0307475_109292272 | 3300031754 | Hardwood Forest Soil | SHEPIDEPLQLLEEEARYAGIEDRVVVLEEGVTKFF |
Ga0310912_103595871 | 3300031941 | Soil | SHEPIEEPLQLLEREAKAAGIVDRVLVMEEGVTRFF |
Ga0307479_104878291 | 3300031962 | Hardwood Forest Soil | FRLSREPIEEPLLLLEREAEKAGVKDKVVVLREGITRFF |
Ga0307479_108389702 | 3300031962 | Hardwood Forest Soil | HEPMEEPLQLLEKEARAAGIEDRVFVLEEGVTRFF |
Ga0307479_113860091 | 3300031962 | Hardwood Forest Soil | SHEPMDEPLQLLRAEVRAAGIEDRLAVLEEGVTRFF |
Ga0306922_111960702 | 3300032001 | Soil | HEPLDEPLQLLGQEARNAGIEDRVVVLEEGVTKFF |
Ga0311301_115350562 | 3300032160 | Peatlands Soil | HEPMDEPLQLLEQEAKAAGIEDRVLVLEEGVTRFF |
Ga0311301_125074761 | 3300032160 | Peatlands Soil | RLSHEPVDEPLQLLDQEAQAAGVKDRVMVMEEGVTRFF |
Ga0307471_1003859903 | 3300032180 | Hardwood Forest Soil | RLSHEPVDEPLELLDQEAEAAGVKDRVIVLEEGVTRFF |
Ga0335078_101315161 | 3300032805 | Soil | SHEPIDEPLQLLEQEAKAAGIEDRVRVLEEGVTQLF |
Ga0335078_120358111 | 3300032805 | Soil | RLSHEPVDEPLQLLDQEVRAAGVEDRVVVLQEGVTRFF |
Ga0335080_110368911 | 3300032828 | Soil | LSHEPIDEPLKLLAKEARRAGIQDRVRVLPEGVTAFF |
Ga0335075_106526691 | 3300032896 | Soil | FRLSHEPVEEPLQLLDREARKAGIEDKVVVMEEGVTRFF |
Ga0335072_104851481 | 3300032898 | Soil | TFRLSHEPVEEPLQLLDREARKAGIEDKVVVMEEGVTRFF |
Ga0310914_105063351 | 3300033289 | Soil | SHEPMDEPLQLLEREAQAAGIKDRVLVLKEGVTKIF |
⦗Top⦘ |