| Basic Information | |
|---|---|
| Family ID | F033032 |
| Family Type | Metagenome |
| Number of Sequences | 178 |
| Average Sequence Length | 44 residues |
| Representative Sequence | NWQQAFAIMYVHGSKVQVDLINIEKDGTFIVSGKSYGRPR |
| Number of Associated Samples | 124 |
| Number of Associated Scaffolds | 178 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 6.78 % |
| % of genes near scaffold ends (potentially truncated) | 90.45 % |
| % of genes from short scaffolds (< 2000 bps) | 89.33 % |
| Associated GOLD sequencing projects | 114 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.54 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (75.843 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (18.539 % of family members) |
| Environment Ontology (ENVO) | Unclassified (61.236 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (56.180 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 39.71% Coil/Unstructured: 60.29% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 178 Family Scaffolds |
|---|---|---|
| PF00145 | DNA_methylase | 1.12 |
| PF09723 | Zn-ribbon_8 | 1.12 |
| PF00497 | SBP_bac_3 | 0.56 |
| PF05869 | Dam | 0.56 |
| PF01844 | HNH | 0.56 |
| COG ID | Name | Functional Category | % Frequency in 178 Family Scaffolds |
|---|---|---|---|
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 1.12 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.31 % |
| Unclassified | root | N/A | 1.69 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000525|JGI1221J11331_1019983 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1606 | Open in IMG/M |
| 3300004123|Ga0066181_10109555 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 766 | Open in IMG/M |
| 3300004282|Ga0066599_101500812 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 518 | Open in IMG/M |
| 3300004448|Ga0065861_1104316 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 557 | Open in IMG/M |
| 3300004457|Ga0066224_1008927 | All Organisms → Viruses → Predicted Viral | 3666 | Open in IMG/M |
| 3300004461|Ga0066223_1196473 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300004481|Ga0069718_15844300 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 803 | Open in IMG/M |
| 3300005527|Ga0068876_10251367 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1014 | Open in IMG/M |
| 3300005527|Ga0068876_10629482 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 579 | Open in IMG/M |
| 3300005527|Ga0068876_10783744 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 505 | Open in IMG/M |
| 3300005581|Ga0049081_10193452 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 731 | Open in IMG/M |
| 3300005662|Ga0078894_10899802 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300005805|Ga0079957_1042596 | All Organisms → Viruses → Predicted Viral | 2862 | Open in IMG/M |
| 3300006484|Ga0070744_10083143 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 928 | Open in IMG/M |
| 3300006639|Ga0079301_1061326 | All Organisms → Viruses → Predicted Viral | 1199 | Open in IMG/M |
| 3300006639|Ga0079301_1237474 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 514 | Open in IMG/M |
| 3300006802|Ga0070749_10492268 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 668 | Open in IMG/M |
| 3300006802|Ga0070749_10799141 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 501 | Open in IMG/M |
| 3300006803|Ga0075467_10541213 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 597 | Open in IMG/M |
| 3300006803|Ga0075467_10661876 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 532 | Open in IMG/M |
| 3300006805|Ga0075464_10141977 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1406 | Open in IMG/M |
| 3300006805|Ga0075464_10936506 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 542 | Open in IMG/M |
| 3300006805|Ga0075464_10948212 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 538 | Open in IMG/M |
| 3300006805|Ga0075464_10985811 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 528 | Open in IMG/M |
| 3300006863|Ga0075459_1086137 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300006875|Ga0075473_10129391 | All Organisms → cellular organisms → Bacteria | 1008 | Open in IMG/M |
| 3300006875|Ga0075473_10254619 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300006920|Ga0070748_1280910 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 594 | Open in IMG/M |
| 3300006920|Ga0070748_1290299 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 583 | Open in IMG/M |
| 3300006920|Ga0070748_1304240 | Not Available | 566 | Open in IMG/M |
| 3300007363|Ga0075458_10078668 | All Organisms → Viruses → Predicted Viral | 1029 | Open in IMG/M |
| 3300007708|Ga0102859_1062213 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1046 | Open in IMG/M |
| 3300007860|Ga0105735_1117279 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 573 | Open in IMG/M |
| 3300007974|Ga0105747_1238999 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 606 | Open in IMG/M |
| 3300008108|Ga0114341_10150336 | All Organisms → Viruses → Predicted Viral | 1354 | Open in IMG/M |
| 3300008108|Ga0114341_10465386 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 584 | Open in IMG/M |
| 3300008110|Ga0114343_1042504 | All Organisms → Viruses → Predicted Viral | 1807 | Open in IMG/M |
| 3300008111|Ga0114344_1137460 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 849 | Open in IMG/M |
| 3300008111|Ga0114344_1160214 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 758 | Open in IMG/M |
| 3300008261|Ga0114336_1214909 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 796 | Open in IMG/M |
| 3300008266|Ga0114363_1050069 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2020 | Open in IMG/M |
| 3300008266|Ga0114363_1173095 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 693 | Open in IMG/M |
| 3300008266|Ga0114363_1206127 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 598 | Open in IMG/M |
| 3300008266|Ga0114363_1250897 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 773 | Open in IMG/M |
| 3300008267|Ga0114364_1150992 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 640 | Open in IMG/M |
| 3300008448|Ga0114876_1127923 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 962 | Open in IMG/M |
| 3300008450|Ga0114880_1029347 | All Organisms → Viruses → Predicted Viral | 2468 | Open in IMG/M |
| 3300008450|Ga0114880_1240038 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 574 | Open in IMG/M |
| 3300008450|Ga0114880_1264404 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 526 | Open in IMG/M |
| 3300009009|Ga0105105_10758821 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 582 | Open in IMG/M |
| 3300009068|Ga0114973_10276371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 900 | Open in IMG/M |
| 3300009081|Ga0105098_10206297 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 910 | Open in IMG/M |
| 3300009081|Ga0105098_10261648 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 819 | Open in IMG/M |
| 3300009081|Ga0105098_10403904 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 679 | Open in IMG/M |
| 3300009082|Ga0105099_10142996 | All Organisms → Viruses → Predicted Viral | 1343 | Open in IMG/M |
| 3300009151|Ga0114962_10524798 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 623 | Open in IMG/M |
| 3300009155|Ga0114968_10260807 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 981 | Open in IMG/M |
| 3300009155|Ga0114968_10755959 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 507 | Open in IMG/M |
| 3300009158|Ga0114977_10055850 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2439 | Open in IMG/M |
| 3300009158|Ga0114977_10457921 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 703 | Open in IMG/M |
| 3300009159|Ga0114978_10224906 | All Organisms → Viruses → Predicted Viral | 1176 | Open in IMG/M |
| 3300009160|Ga0114981_10769841 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 508 | Open in IMG/M |
| 3300009161|Ga0114966_10612442 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 606 | Open in IMG/M |
| 3300009164|Ga0114975_10051815 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2418 | Open in IMG/M |
| 3300009164|Ga0114975_10160503 | All Organisms → Viruses → Predicted Viral | 1282 | Open in IMG/M |
| 3300009164|Ga0114975_10414093 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 734 | Open in IMG/M |
| 3300009164|Ga0114975_10520386 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 640 | Open in IMG/M |
| 3300009165|Ga0105102_10486632 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 668 | Open in IMG/M |
| 3300009170|Ga0105096_10287719 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 838 | Open in IMG/M |
| 3300009170|Ga0105096_10477056 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 648 | Open in IMG/M |
| 3300009180|Ga0114979_10471507 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 728 | Open in IMG/M |
| 3300009180|Ga0114979_10815626 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 523 | Open in IMG/M |
| 3300009182|Ga0114959_10501321 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 586 | Open in IMG/M |
| 3300009183|Ga0114974_10593521 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 611 | Open in IMG/M |
| 3300009183|Ga0114974_10643983 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 580 | Open in IMG/M |
| 3300009183|Ga0114974_10712158 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 544 | Open in IMG/M |
| 3300009184|Ga0114976_10079175 | All Organisms → Viruses → Predicted Viral | 1897 | Open in IMG/M |
| 3300009184|Ga0114976_10323285 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 821 | Open in IMG/M |
| 3300009184|Ga0114976_10575866 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 573 | Open in IMG/M |
| 3300009185|Ga0114971_10076196 | All Organisms → Viruses → Predicted Viral | 2071 | Open in IMG/M |
| 3300009194|Ga0114983_1142401 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 513 | Open in IMG/M |
| 3300009466|Ga0126448_1059633 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 872 | Open in IMG/M |
| 3300010885|Ga0133913_10627101 | All Organisms → Viruses → Predicted Viral | 2820 | Open in IMG/M |
| 3300010970|Ga0137575_10003921 | All Organisms → Viruses → Predicted Viral | 2806 | Open in IMG/M |
| 3300011010|Ga0139557_1012910 | All Organisms → Viruses → Predicted Viral | 1607 | Open in IMG/M |
| 3300012663|Ga0157203_1033087 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 722 | Open in IMG/M |
| 3300012665|Ga0157210_1016731 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1215 | Open in IMG/M |
| 3300012665|Ga0157210_1026222 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 925 | Open in IMG/M |
| 3300013004|Ga0164293_10657025 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 676 | Open in IMG/M |
| 3300013004|Ga0164293_11060935 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 502 | Open in IMG/M |
| 3300013372|Ga0177922_10820980 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 547 | Open in IMG/M |
| 3300014811|Ga0119960_1021359 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 838 | Open in IMG/M |
| 3300017722|Ga0181347_1066682 | All Organisms → Viruses → Predicted Viral | 1066 | Open in IMG/M |
| 3300017736|Ga0181365_1170090 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 511 | Open in IMG/M |
| 3300017754|Ga0181344_1111834 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 789 | Open in IMG/M |
| 3300017766|Ga0181343_1126396 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 717 | Open in IMG/M |
| 3300017766|Ga0181343_1156638 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 634 | Open in IMG/M |
| 3300017774|Ga0181358_1010404 | All Organisms → Viruses → Predicted Viral | 3823 | Open in IMG/M |
| 3300017774|Ga0181358_1258158 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 545 | Open in IMG/M |
| 3300017777|Ga0181357_1336178 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 505 | Open in IMG/M |
| 3300017778|Ga0181349_1051382 | All Organisms → Viruses → Predicted Viral | 1616 | Open in IMG/M |
| 3300017778|Ga0181349_1178619 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 746 | Open in IMG/M |
| 3300017778|Ga0181349_1296664 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 525 | Open in IMG/M |
| 3300017780|Ga0181346_1269058 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 589 | Open in IMG/M |
| 3300017780|Ga0181346_1271487 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 585 | Open in IMG/M |
| 3300017784|Ga0181348_1180879 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 769 | Open in IMG/M |
| 3300017785|Ga0181355_1200566 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 784 | Open in IMG/M |
| 3300017785|Ga0181355_1265275 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 655 | Open in IMG/M |
| 3300017785|Ga0181355_1394446 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 501 | Open in IMG/M |
| 3300020205|Ga0211731_11544609 | Not Available | 1143 | Open in IMG/M |
| 3300020537|Ga0208722_1022918 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 952 | Open in IMG/M |
| 3300020550|Ga0208600_1052383 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 609 | Open in IMG/M |
| 3300021438|Ga0213920_1010179 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2813 | Open in IMG/M |
| 3300021952|Ga0213921_1003813 | All Organisms → Viruses → Predicted Viral | 3227 | Open in IMG/M |
| 3300021956|Ga0213922_1115333 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 532 | Open in IMG/M |
| 3300021963|Ga0222712_10261210 | All Organisms → Viruses → Predicted Viral | 1103 | Open in IMG/M |
| 3300022747|Ga0228703_1134140 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 545 | Open in IMG/M |
| 3300024346|Ga0244775_10693675 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 821 | Open in IMG/M |
| 3300024348|Ga0244776_10696310 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 628 | Open in IMG/M |
| 3300024348|Ga0244776_10740322 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 602 | Open in IMG/M |
| 3300025436|Ga0208103_1030959 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 736 | Open in IMG/M |
| 3300025635|Ga0208147_1071349 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 865 | Open in IMG/M |
| 3300025889|Ga0208644_1149976 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1070 | Open in IMG/M |
| 3300025889|Ga0208644_1385681 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 521 | Open in IMG/M |
| 3300025896|Ga0208916_10416964 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 586 | Open in IMG/M |
| 3300027212|Ga0208554_1003366 | All Organisms → Viruses → Predicted Viral | 2554 | Open in IMG/M |
| 3300027396|Ga0255146_1055349 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 831 | Open in IMG/M |
| 3300027631|Ga0208133_1079970 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 770 | Open in IMG/M |
| 3300027726|Ga0209285_10166457 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 686 | Open in IMG/M |
| 3300027734|Ga0209087_1028652 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2679 | Open in IMG/M |
| 3300027734|Ga0209087_1049107 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1935 | Open in IMG/M |
| 3300027741|Ga0209085_1288629 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 629 | Open in IMG/M |
| 3300027759|Ga0209296_1286809 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 660 | Open in IMG/M |
| 3300027759|Ga0209296_1342532 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 578 | Open in IMG/M |
| 3300027764|Ga0209134_10329583 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 516 | Open in IMG/M |
| 3300027769|Ga0209770_10167667 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 879 | Open in IMG/M |
| 3300027782|Ga0209500_10152121 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1088 | Open in IMG/M |
| 3300027785|Ga0209246_10328774 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 584 | Open in IMG/M |
| 3300027808|Ga0209354_10210256 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Amaranthaceae → Bosea | 787 | Open in IMG/M |
| 3300027900|Ga0209253_10352506 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 1129 | Open in IMG/M |
| 3300027969|Ga0209191_1162464 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 904 | Open in IMG/M |
| 3300027971|Ga0209401_1331457 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 518 | Open in IMG/M |
| 3300027976|Ga0209702_10167202 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 958 | Open in IMG/M |
| (restricted) 3300028114|Ga0247835_1074023 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1402 | Open in IMG/M |
| (restricted) 3300028559|Ga0247831_1227889 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 668 | Open in IMG/M |
| (restricted) 3300028569|Ga0247843_1144952 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 984 | Open in IMG/M |
| (restricted) 3300028571|Ga0247844_1077701 | All Organisms → Viruses → Predicted Viral | 1655 | Open in IMG/M |
| 3300031758|Ga0315907_10132084 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2124 | Open in IMG/M |
| 3300031857|Ga0315909_10245910 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1377 | Open in IMG/M |
| 3300031857|Ga0315909_10351290 | All Organisms → Viruses → Predicted Viral | 1077 | Open in IMG/M |
| 3300032116|Ga0315903_10071430 | All Organisms → Viruses → Predicted Viral | 3421 | Open in IMG/M |
| 3300032116|Ga0315903_11040889 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 568 | Open in IMG/M |
| 3300033816|Ga0334980_0177997 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 861 | Open in IMG/M |
| 3300033981|Ga0334982_0206345 | All Organisms → cellular organisms → Bacteria | 968 | Open in IMG/M |
| 3300033994|Ga0334996_0111596 | All Organisms → Viruses → Predicted Viral | 1577 | Open in IMG/M |
| 3300033994|Ga0334996_0461445 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 579 | Open in IMG/M |
| 3300034012|Ga0334986_0594384 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 528 | Open in IMG/M |
| 3300034020|Ga0335002_0493108 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 657 | Open in IMG/M |
| 3300034061|Ga0334987_0078271 | All Organisms → Viruses → Predicted Viral | 2617 | Open in IMG/M |
| 3300034061|Ga0334987_0644518 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 617 | Open in IMG/M |
| 3300034062|Ga0334995_0048339 | All Organisms → Viruses → Predicted Viral | 3495 | Open in IMG/M |
| 3300034062|Ga0334995_0747356 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 543 | Open in IMG/M |
| 3300034066|Ga0335019_0867166 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 504 | Open in IMG/M |
| 3300034092|Ga0335010_0634545 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 536 | Open in IMG/M |
| 3300034095|Ga0335022_0608201 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 551 | Open in IMG/M |
| 3300034101|Ga0335027_0654782 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 631 | Open in IMG/M |
| 3300034101|Ga0335027_0711782 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 594 | Open in IMG/M |
| 3300034105|Ga0335035_0243932 | All Organisms → Viruses → Predicted Viral | 1085 | Open in IMG/M |
| 3300034105|Ga0335035_0619751 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 569 | Open in IMG/M |
| 3300034106|Ga0335036_0773442 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 559 | Open in IMG/M |
| 3300034118|Ga0335053_0637175 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 608 | Open in IMG/M |
| 3300034120|Ga0335056_0451870 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 684 | Open in IMG/M |
| 3300034122|Ga0335060_0210471 | All Organisms → Viruses → Predicted Viral | 1101 | Open in IMG/M |
| 3300034122|Ga0335060_0433303 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 689 | Open in IMG/M |
| 3300034200|Ga0335065_0640851 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 615 | Open in IMG/M |
| 3300034200|Ga0335065_0777020 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 539 | Open in IMG/M |
| 3300034284|Ga0335013_0781676 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 536 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 18.54% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 17.42% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 14.61% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 10.67% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 6.18% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 5.06% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.25% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 2.25% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.25% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 2.81% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.69% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 1.69% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.69% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 1.69% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.12% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.12% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 1.12% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.56% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.56% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.56% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.56% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.56% |
| Aquatic | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Aquatic | 0.56% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.56% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater | 0.56% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 0.56% |
| Pond Fresh Water | Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water | 0.56% |
| Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 0.56% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.56% |
| Hypersaline | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline | 0.56% |
| Meromictic Pond | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond | 0.56% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000525 | Hypersaline microbial communities from Lake Vida, Antarctica - Brine Hole Two >0.2 micron | Environmental | Open in IMG/M |
| 3300004123 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SD (version 2) | Environmental | Open in IMG/M |
| 3300004282 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Initial sediment | Environmental | Open in IMG/M |
| 3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300004457 | Marine viral communities from Newfoundland, Canada MC-1 | Environmental | Open in IMG/M |
| 3300004461 | Marine viral communities from Newfoundland, Canada BC-2 | Environmental | Open in IMG/M |
| 3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006863 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300007363 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
| 3300007860 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1372A_3um | Environmental | Open in IMG/M |
| 3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
| 3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008111 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NA | Environmental | Open in IMG/M |
| 3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009009 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
| 3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009170 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300009185 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG | Environmental | Open in IMG/M |
| 3300009194 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT | Environmental | Open in IMG/M |
| 3300009466 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 2m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300010970 | Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV1, april 2016 | Environmental | Open in IMG/M |
| 3300011010 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice | Environmental | Open in IMG/M |
| 3300012663 | Freshwater microbial communities from Indian River, Ontario, Canada - S50 | Environmental | Open in IMG/M |
| 3300012665 | Freshwater microbial communities from Talbot River, Ontario, Canada - S11 | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300014811 | Aquatic viral communities from ballast water - Michigan State University - AB_ballast water | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300020537 | Freshwater microbial communities from Lake Mendota, WI - 21SEP2011 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020550 | Freshwater microbial communities from Lake Mendota, WI - 08OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021438 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MG | Environmental | Open in IMG/M |
| 3300021952 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17 MG | Environmental | Open in IMG/M |
| 3300021956 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MG | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022747 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17_Aug_MG | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300025436 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA7.5M (SPAdes) | Environmental | Open in IMG/M |
| 3300025635 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027212 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027396 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_8h | Environmental | Open in IMG/M |
| 3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
| 3300027726 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027769 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
| 3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027971 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027976 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 (SPAdes) | Environmental | Open in IMG/M |
| 3300028114 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_13.5m | Environmental | Open in IMG/M |
| 3300028559 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_1m | Environmental | Open in IMG/M |
| 3300028569 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2017_8m | Environmental | Open in IMG/M |
| 3300028571 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch201714.5m_1 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
| 3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
| 3300034020 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2015-rr0055 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
| 3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
| 3300034095 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Feb2014D0-rr0091 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034105 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
| 3300034120 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172 | Environmental | Open in IMG/M |
| 3300034122 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181 | Environmental | Open in IMG/M |
| 3300034200 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190 | Environmental | Open in IMG/M |
| 3300034284 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1221J11331_10199834 | 3300000525 | Hypersaline | MNSQQAAYMKGSMNWQQAFAIMYVHAKTVQVDIINIEKNGTFIVSGKVYGRPRK* |
| Ga0066181_101095553 | 3300004123 | Freshwater Lake | GTANWQQAFAIMYVHGSSVQVDIINIEKNGTFIVQGKVYGRVR* |
| Ga0066599_1015008121 | 3300004282 | Freshwater | NWQQAFAIMYVQGSTVQVDLINIEKNGTFIVQGKVYGRPRR* |
| Ga0065861_11043161 | 3300004448 | Marine | WQQAFAIMYVHGPSVQVDLINIEKNGTFIVQGKVYGRPRR* |
| Ga0066224_10089271 | 3300004457 | Marine | QASYTKGTANWQQAFAIMYVKGSNVQVDIINIEKNGTFIVQGKVYGRVR* |
| Ga0066223_11964733 | 3300004461 | Marine | RQASYTKGTANWQQAFAIMYVHNSSVQVDLINIEKNGTFIVQGKVYGRPR* |
| Ga0069718_158443004 | 3300004481 | Sediment | NWQQAFAIIYVNKNKVQVDLINIEKDGTFIVAGKSYGRAR* |
| Ga0068876_102513674 | 3300005527 | Freshwater Lake | SMPNWQQAFAIVTEVGKNVQVDLIYVEKDGTFLVHGKRYGRPR* |
| Ga0068876_106294821 | 3300005527 | Freshwater Lake | QQAFAIMYVEGKNVQVDLIYIEKDGTFVVSGKRYGRPR* |
| Ga0068876_107837442 | 3300005527 | Freshwater Lake | YTKGSANWQQAFAIMYVEGKNVQVDLIYLEKDGTFVVSGKRYGRPR* |
| Ga0049081_101934523 | 3300005581 | Freshwater Lentic | ANWQQAFAIMYVDGKNVQVDLIYFEKDGTFVVSGKRYGRPR* |
| Ga0078894_108998021 | 3300005662 | Freshwater Lake | ANWQQAFAIIYVNKAKVQVDLIHIEKDGTFIVAGKSYGRPR* |
| Ga0079957_104259610 | 3300005805 | Lake | HLMSLKEALYTRGTANWQQAFQIMTEDAKGVQIDMINIEKDGTFIVHGKRYGRVR* |
| Ga0070744_100831431 | 3300006484 | Estuarine | GTANWQQAFAIMYVHGSSVQVDIINIEKNGTFIVQGKVYGRPRH* |
| Ga0079301_10613264 | 3300006639 | Deep Subsurface | YTKGSANWQQAFAIMYVEGKNVQVDLIYIEKDGTFVVAGKRYGRAR* |
| Ga0079301_12374741 | 3300006639 | Deep Subsurface | YTKGTANWQQAFAIMYVKGKNVQVDLIYIEKDGTFTVQGKVYGRPRNR* |
| Ga0070749_104922683 | 3300006802 | Aqueous | QQAFAIMYVKGSNVQVDIIHIEKNGTFIVQGKVYGRVR* |
| Ga0070749_107991411 | 3300006802 | Aqueous | VANWQQAFAIIYVNKTKVQVDLIHIEKDGTFIVSGKSYGRPR* |
| Ga0075467_105412132 | 3300006803 | Aqueous | AIMYVHGSNVQVDLINIEKNGTFIVQGKVYGRPR* |
| Ga0075467_106618763 | 3300006803 | Aqueous | FAIMYVKGKNVQVDLIYIEKNGTFIVNGKVYGRPR* |
| Ga0075464_101419771 | 3300006805 | Aqueous | FAIMYINKNKVQVDLINIEKDGTFIVAGKSYGRAR* |
| Ga0075464_109365061 | 3300006805 | Aqueous | QASYTKGSANWQQCFAIMYVHGKNVQTDLIYIEKNGTFIVQGKVYGRPR* |
| Ga0075464_109482121 | 3300006805 | Aqueous | AFAIIYVNKAKVQVDLINIEKDGTFIVAGKSYGRAR* |
| Ga0075464_109858111 | 3300006805 | Aqueous | QASYTKGTANWQQAFAIMYVHGSSVQVDIINIEKNGTFIVQGKVYGRVR* |
| Ga0075459_10861371 | 3300006863 | Aqueous | ASYTKGTANWQQAFAIMYVKGKNVQVDLIYIEKDGTFTVQGKVYGRKRK* |
| Ga0075473_101293911 | 3300006875 | Aqueous | TLHGVEVGNLMSFQAAKYTKGSAQWQQAFAIMYVQGSSVQVDLINIEKNGTFIVQGKVYGRPRR* |
| Ga0075473_102546191 | 3300006875 | Aqueous | GTANWQQAFAIMYVKGKNVQVDLIYIEKDGTFTVQGKVYGRPRNR* |
| Ga0070748_12809103 | 3300006920 | Aqueous | VANWQQAFAIIYVNKAKVQVDLINIEKDGTFIVAGKSYGRPR* |
| Ga0070748_12902993 | 3300006920 | Aqueous | QQAFAIMYVHGSTVQVDIINIEKNGTFIVQGKVYGRVR* |
| Ga0070748_13042402 | 3300006920 | Aqueous | FAIMYVKGRNVQVDLIYIEKDGTFTVQGKVYGRTRK* |
| Ga0075458_100786681 | 3300007363 | Aqueous | MDFKQAAYTKGVANWQQAFAIIYVNKAKVQVDLIHIEKDGTFIVAGKTYGRAR* |
| Ga0102859_10622131 | 3300007708 | Estuarine | QAFSIIYVKGKNVQIDLIYIEKNGTFIVNGKVYGRVR* |
| Ga0105735_11172793 | 3300007860 | Estuary Water | ANWQQAFAIMYVEGKNVQVDIIYLEKDGTFLVAGKRYGRSR* |
| Ga0105747_12389991 | 3300007974 | Estuary Water | GTANWQQAFAIMYVHGSSVQVDIINIEKNGTFIVQGKVYGRPR* |
| Ga0114341_101503365 | 3300008108 | Freshwater, Plankton | ANWQQAFAIMYVTGKNVQVDLIYIEKDGTFVVAGKRYGRPR* |
| Ga0114341_104653863 | 3300008108 | Freshwater, Plankton | FAIIYVNKAKVQVDLIHIEKDGTFIVAGKSYGRPR* |
| Ga0114343_10425041 | 3300008110 | Freshwater, Plankton | AYTKGTANWQQAFAIMYVHGKNVQVDLIYIEKNGTFIVNGKVYGRPR* |
| Ga0114344_11374605 | 3300008111 | Freshwater, Plankton | FAIMYVKGSNVQVDIIHIEKNGTFIVQGKVYGRAR* |
| Ga0114344_11602143 | 3300008111 | Freshwater, Plankton | YTKGSANWQSAFAIMYVDGKNVQVDIIYIEKDGTFVVSGKRYGRPR* |
| Ga0114336_12149093 | 3300008261 | Freshwater, Plankton | DFKQAAYTKGTANWQQAFAIMYVHNKNVQVDLIYIEKNGTFIVNGKVYGRPR* |
| Ga0114363_10500695 | 3300008266 | Freshwater, Plankton | TKGTANWQQAFAIMYVQGPTVQVDLINIEKNGTFIVQGKVYGRPRK* |
| Ga0114363_11730953 | 3300008266 | Freshwater, Plankton | SYTKGTANWQQAFAIMYVDKKNVQVDLIYIEKDGTFVVSGKRYGRSR* |
| Ga0114363_12061273 | 3300008266 | Freshwater, Plankton | KGSANWQQAFAIMYVEGKNVQVDLIYLEKDGTFQVSGKRYGRPR* |
| Ga0114363_12508972 | 3300008266 | Freshwater, Plankton | ANWQQAFAIIYVNKSKVQVDIIHIEKDGTFIVAGKSYGRAR* |
| Ga0114364_11509921 | 3300008267 | Freshwater, Plankton | AFAIMYVHGSSVQVDIINIEKNGTFIVQGKVYGRVR* |
| Ga0114876_11279231 | 3300008448 | Freshwater Lake | AFAIMYVKGSNVQVDIIHIEKNGTFIVQGKVYGRVR* |
| Ga0114880_10293471 | 3300008450 | Freshwater Lake | GSANWQQAFAIMYVEGKNVQVDLIYFEKDGTFVVAGKRYGRAR* |
| Ga0114880_12400383 | 3300008450 | Freshwater Lake | YTKGSANWQAAFAIMYVDGKNVQVDLIYIEKDGTFLVSGKRYGRPR* |
| Ga0114880_12644041 | 3300008450 | Freshwater Lake | GSANWQQAFAIMYVEGKNVQVDLIYFEKDGTFVVAGKRYGRPR* |
| Ga0105105_107588212 | 3300009009 | Freshwater Sediment | QAFAIIYVNKTKVQVDLINIEKDGTFIVAGKSYGRAR* |
| Ga0114973_102763711 | 3300009068 | Freshwater Lake | FAIMYVHGSKVQVDLINIEKDGTFIVSGKSYGRPR* |
| Ga0105098_102062971 | 3300009081 | Freshwater Sediment | WQQAFAIIYVNKSKVQVDLIHIEKDGTFIVSGKSYGRPR* |
| Ga0105098_102616481 | 3300009081 | Freshwater Sediment | FAIMYVKASNVQVDIINIEKNGNFIVQGKVYGRAR* |
| Ga0105098_104039042 | 3300009081 | Freshwater Sediment | NWQQAFAIMYVDGKNVQVDLIYLEKDGTFVVAGKRYGRPR* |
| Ga0105099_101429961 | 3300009082 | Freshwater Sediment | QQAFAIMYVKGKNVQVDLIYIEKNGTFIVNGKVYGRPR* |
| Ga0114962_105247981 | 3300009151 | Freshwater Lake | FAIMYVHGSTVQVDIINIERNGTFIVQGKVYGRVR* |
| Ga0114968_102608071 | 3300009155 | Freshwater Lake | NWQQAFAIMYVHGSKVQVDLINIEKDGTFIVSGKSYGRPR* |
| Ga0114968_107559591 | 3300009155 | Freshwater Lake | RQAGYVKGTANWQQAFAIMYVKGSNVQVDIIHIEKNGTFIVQGKVYGRVR* |
| Ga0114977_100558507 | 3300009158 | Freshwater Lake | FAIVTEIGKNVQVDLIYVEKDGTFLVHGKRYGRPR* |
| Ga0114977_104579211 | 3300009158 | Freshwater Lake | FKQARYTKGTANWQQAFAIMYVHGSSVQVDIINIEKNGTFIVQGKVYGRFR* |
| Ga0114978_102249063 | 3300009159 | Freshwater Lake | AIMYVEGKNVQVDLIYIEKDGTFVVSGKRYGRPR* |
| Ga0114981_107698411 | 3300009160 | Freshwater Lake | NLQQAYAILYDKCSNVQVDIIHIEKNGTFIVQGKVYGRVR* |
| Ga0114966_106124421 | 3300009161 | Freshwater Lake | MPNWQQAFAIVTEIGKNVQVDLIYVEKDGTFIVSGKRYGRSR* |
| Ga0114975_100518158 | 3300009164 | Freshwater Lake | EVGNLMSFSAAKYTKGSAQWQQAFAIMYVHNSTVQVDIINIEKNGTFIVAGKVYGRPRR* |
| Ga0114975_101605031 | 3300009164 | Freshwater Lake | KSAHYTRGTANWQQSISIVTEDAKGVQIDLIYIEKDGTFLVHGKRYGRPR* |
| Ga0114975_103983921 | 3300009164 | Freshwater Lake | KYVSSPNWQQAFAIVTEHNKNVQVDLIYVEKDGTFLVYGKRYGRAR* |
| Ga0114975_104140932 | 3300009164 | Freshwater Lake | FAIVTEHNKNVQVDLIYVEKDGTFMVHGKRYGRAR* |
| Ga0114975_105203861 | 3300009164 | Freshwater Lake | ANWQQAFAIMYVHGSSVQVDIINIEKNGTFIVQGKVYGRVR* |
| Ga0105102_104866321 | 3300009165 | Freshwater Sediment | QQAFAIMYVDGKNVQVDLIYLEKDGTFVVAGKRYGRPR* |
| Ga0105096_102877194 | 3300009170 | Freshwater Sediment | QAFAIIYVNKAKVQVDLINIEKDGTFIVAGKSYGRPR* |
| Ga0105096_104770562 | 3300009170 | Freshwater Sediment | QQAFAIIYVNKAKVQVDLINIEKDGTFIVAGKSYGRPR* |
| Ga0114979_104715073 | 3300009180 | Freshwater Lake | PNWQQAFAIVKEHGKNVQVDLTHVEKDGTFIVDGKDYGRVR* |
| Ga0114979_108156262 | 3300009180 | Freshwater Lake | SYTKGTANWQQAFAIMYVKGNNVQVDIIHIEKNGTFIVQGKVYGRVR* |
| Ga0114959_105013213 | 3300009182 | Freshwater Lake | WQQAFAIMYVHGSTVQVDIINIEKNGTFIVQGKVYGRIR* |
| Ga0114974_105935211 | 3300009183 | Freshwater Lake | QARYTKGTANWQQAFAIMYVHGSSVQVDIINIEKNGTFIVQGKVYGRVR* |
| Ga0114974_106439831 | 3300009183 | Freshwater Lake | NWQQAFAIMYVHGSKVQVDLINIEKDGTFIVSGKSYGKAR* |
| Ga0114974_107121581 | 3300009183 | Freshwater Lake | ASYTKGTANWQQAFAIMYVKGNNVQVDIIHIEKNGTFIVQGKVYGRVR* |
| Ga0114976_100791756 | 3300009184 | Freshwater Lake | WQQAFAIVTEIGKNVQVDLIYVEKDGTFVVSGKRYGRAR* |
| Ga0114976_103232853 | 3300009184 | Freshwater Lake | AKYVSTPNWQQAFAIVKEHGKNVQVDLIYVEKDGTFIVDGKVYGRVR* |
| Ga0114976_105758661 | 3300009184 | Freshwater Lake | QAFAIMYVKGSNVQVDIINIEKNGTFIVQGKVYGRVR* |
| Ga0114971_100761961 | 3300009185 | Freshwater Lake | ANWQQAFAIIYVKGSNVQVDIIHIEKNGTFIVQGKVYGRVR* |
| Ga0114983_11424013 | 3300009194 | Deep Subsurface | YTKGTANWQQAFAIMYVKGSNVQVDIIHIEKNGTFIVQGKVYGRVR* |
| Ga0126448_10596334 | 3300009466 | Meromictic Pond | TKGVANWQQAFAIMYVEGKNVQVDLIYIEKDGTFVVAGKRYGRSR* |
| Ga0133913_106271018 | 3300010885 | Freshwater Lake | MQTTKAGYTHGVMNWQQAFAIMYVHGKNVQVDLIHIEKNGTFIVNGKVHGRVR* |
| Ga0137575_100039211 | 3300010970 | Pond Fresh Water | KGVANWQQAFAIMYINKNKVQVDLINIEKDGTFIVAGKSYGRAR* |
| Ga0139557_10129104 | 3300011010 | Freshwater | AYTKGSANWQQAFAIMYVEGKNVQVDIIYFEKDGTFLVSGKRYGRPR* |
| Ga0157203_10330872 | 3300012663 | Freshwater | QAFAIIYVNKAKVQVDLIHIEKDGTFIVAGKSYGRPR* |
| Ga0157210_10167314 | 3300012665 | Freshwater | FRQAGYVKGTANWQQAFAIMYVKGSNVQVDIIHIEKNGTFIVQGKVYGRVR* |
| Ga0157210_10262221 | 3300012665 | Freshwater | AKYVSMPNWQQAFAIVTEIGKNVQVDLIYVEKDGTFIVSGKRYGRSR* |
| Ga0164293_106570251 | 3300013004 | Freshwater | RQASYTKGTANWQQAFAIMYVKGSNVQVDIIHIEKNGTFIVQGKVYGRIR* |
| Ga0164293_110609352 | 3300013004 | Freshwater | YTKGTANWQQAFAIMYVEGKNVQVDLIYIEKDGTFVVAGKRYGRPR* |
| Ga0177922_108209801 | 3300013372 | Freshwater | FKQAAYTKGTANWQQAFAIMYIHNKNVQVDLIYIEKNGTFIVGGKVYGRPR* |
| Ga0119960_10213591 | 3300014811 | Aquatic | FPSHDRGSKVQVDLINIEKDGTFIVAGKTYGRAR* |
| Ga0181347_10666825 | 3300017722 | Freshwater Lake | FSKASYTKGSANWQQAFAIMYVEGKNVQVDLIYFEKDGTFLVSGKRYGRPR |
| Ga0181365_11700903 | 3300017736 | Freshwater Lake | WQQAFAIMYVHGSSVQVDIINIEKNGTFIVQGKVYGRVR |
| Ga0181344_11118341 | 3300017754 | Freshwater Lake | NWQQAFAIMYVEGKNVQVDLIYIEKDGTFVVSGKRYGRPR |
| Ga0181343_11263961 | 3300017766 | Freshwater Lake | ANWQQAFAIIYVHGSKVQVDLINIEKDGTFIVSGKSYGRPR |
| Ga0181343_11566381 | 3300017766 | Freshwater Lake | DFSKASYTKGSANWQQAFAIMYVDGKNVQVDLIYLEKDGTFLVSGKRYGRPR |
| Ga0181358_101040412 | 3300017774 | Freshwater Lake | SSDLGGIAIVTENGKNVQVDLIYAEKDGTFQVHGRRYGRSR |
| Ga0181358_12581581 | 3300017774 | Freshwater Lake | SANWQQAFAIMYVEGKNVQVDIIYFEKDGTFLVSGKRYGRPR |
| Ga0181357_13361781 | 3300017777 | Freshwater Lake | KASYTKGSANWQQAFAIMYVEGKNVQVDLIYFEKDGTFLVSGKRYGRPR |
| Ga0181349_10513821 | 3300017778 | Freshwater Lake | TANWQQAFAIMYVHGSSVQVDIINIEKNGTFIVQGKVYGRVR |
| Ga0181349_11786191 | 3300017778 | Freshwater Lake | NWQQAFAIMYVDGKNVQVDLIYLEKDGTFLVSGKRYGRPR |
| Ga0181349_12966641 | 3300017778 | Freshwater Lake | RGSAQWQQAFAIMYVHGSSVQVDIINIEKNGTFIVQGKVYGRVR |
| Ga0181346_12690581 | 3300017780 | Freshwater Lake | RYTRGTANWQQAFAIMYVHGSSVQVDIINIEKNGTFIVQGKVYGRVR |
| Ga0181346_12714871 | 3300017780 | Freshwater Lake | HGVEVGNLMSFSAAKYMRGSAQWQQAFAIMYVHGSSVQVDIINIEKNGTFIVQGKVYGRV |
| Ga0181348_11808793 | 3300017784 | Freshwater Lake | TKGTANWQQAFAIMYVHGSSVQVDIINIEKNGTFIVQGKVYGRVR |
| Ga0181355_12005662 | 3300017785 | Freshwater Lake | MDFKQAHYTKGSANWQQAFAIIYVNKSKVQVDLINIDKDGTFIVSGKSYGRPR |
| Ga0181355_12652751 | 3300017785 | Freshwater Lake | KASYTKGSANWQQAFAVMYVDGKNVQVDLIYIEKDGTFVVSGKRYGRPR |
| Ga0181355_13944462 | 3300017785 | Freshwater Lake | ARYTRGTANWQQAFAIMYVHGSSVQVDIINIEKNGTFIVQGKVYGRVR |
| Ga0211731_115446091 | 3300020205 | Freshwater | YMKGYANWQTGFAVMYVDGNHVSVDLIYMEKDASFIVAGKRYG |
| Ga0208722_10229183 | 3300020537 | Freshwater | ASYTKGSANWQQAFAIIYVNKAKVQVDLIHIEKDGTFIVSGKSYGRPR |
| Ga0208600_10523832 | 3300020550 | Freshwater | GVANWQQAFAIMYVHGNKVQVDLIHIEKDGTFIVAGKSYGRPR |
| Ga0213920_10101791 | 3300021438 | Freshwater | GVMNWQQAFAVMYVHGKNVQVDLIHIEKNGTFIVQGKVHGRVR |
| Ga0213921_10038131 | 3300021952 | Freshwater | FAIMYVHEKNVQVDLIHIEKDGTFIVSGKRYGRHR |
| Ga0213922_11153331 | 3300021956 | Freshwater | WQQCFAIMYVHNKNVQVDLIYIEKNGTFVVNGKVYGRVR |
| Ga0222712_102612103 | 3300021963 | Estuarine Water | AFAIMYVKGSNVQVDIIHIEKNGTFIVQGKVYGRAR |
| Ga0228703_11341401 | 3300022747 | Freshwater | FAIMYVKGKNVQTDLIYIEKNGTFIVNGKVYGRVR |
| Ga0244775_106936754 | 3300024346 | Estuarine | WQQAFAIIYVNKAKVQVDLINIEKDGTFIVAGKSYGRPR |
| Ga0244776_106963103 | 3300024348 | Estuarine | QAFSIIYVKGKNVQIDLIYIEKNGTFIVNGKVYGRVR |
| Ga0244776_107403223 | 3300024348 | Estuarine | GTANWQQAFAIMYVKGKNVQVDLIYIEKDGTFTVQGKVYGRPRNR |
| Ga0208103_10309591 | 3300025436 | Freshwater | FRQASYTKGTANWQQAFAIMYVHGSSVQVDIINIEKNGTFIVQGKVYGRVR |
| Ga0208147_10713491 | 3300025635 | Aqueous | QAAYTKGVANWQQAFAIIYVNKAKVQVDLIHIEKDGTFIVAGKTYGRAR |
| Ga0208644_11499761 | 3300025889 | Aqueous | ANWQQAFAIMYVKGSNVQVDIIHIEKNGTFIVQGKVYGRVR |
| Ga0208644_13856811 | 3300025889 | Aqueous | ASYTKGTANWQQAFAIMYVKSSNVQVDIIHIEKNGTFIVQGKVYGRVR |
| Ga0208916_104169643 | 3300025896 | Aqueous | ASYTKGTANWQQAFAIMYVKGSNVQVDIIHIEKNGTFIVQGKVYGRVR |
| Ga0208554_100336610 | 3300027212 | Estuarine | AIMYVHNKNVQVDLIYIEKDGTFTVQGKVYGRKRK |
| Ga0255146_10553493 | 3300027396 | Freshwater | YTRGTANWQQAFAIMYVHGSTIQVDIINIEKNGTFIVQGKIYGRAR |
| Ga0208133_10799703 | 3300027631 | Estuarine | NWQQAFAIIYVNKAKVQVDLINIEKDGTFIVAGKSYGRPR |
| Ga0209285_101664571 | 3300027726 | Freshwater Sediment | AFAIIYVNKAKVQVDLINIEKDGTFIVAGKSYGRPR |
| Ga0209087_10286521 | 3300027734 | Freshwater Lake | QAFAIMYVKGSNVQVDIINIEKNGTFIVQGKVYGRVR |
| Ga0209087_10491075 | 3300027734 | Freshwater Lake | DFKQAHYTKGSANWQQAFAIMYVHGSKVQVDLINIEKDGTFIVSGKSYGRPR |
| Ga0209085_12886291 | 3300027741 | Freshwater Lake | LMDFRQASYTKGTANWQQAFSIMYVQGNNVQVDIINIEKNGTFIVQGKVHGRVR |
| Ga0209296_12868093 | 3300027759 | Freshwater Lake | HYTKGSANWQQAFAIMYVHGSKVQVDLINIEKDGTFIVSGKSYGRPR |
| Ga0209296_13425322 | 3300027759 | Freshwater Lake | QAKYVSTPNWQQAFAIVKEHGKNVQVDLIYVEKDGTFIVDGKVYGRVR |
| Ga0209134_103295831 | 3300027764 | Freshwater Lake | YTHGVMNWQQAFSIIYVKGKNVQVDLIYIEKNGTFIVNGKVYGRPR |
| Ga0209770_101676671 | 3300027769 | Freshwater Lake | NWQQAFAIMYVHGKNVHVDLIYIEKNGTFIVGGKVYGRPR |
| Ga0209500_101521215 | 3300027782 | Freshwater Lake | QASYTKGTANWQQAFAIMYVKGNNVQVDIIHIEKNGTFIVQGKVYGRVR |
| Ga0209246_103287741 | 3300027785 | Freshwater Lake | QAFATIETDGKRVNVQLIYIEKDGTFLVSGRRYGKPR |
| Ga0209354_102102563 | 3300027808 | Freshwater Lake | QAFAIIYVNKSKVQVDLIHIEKDGTFIVSGKSYGRAR |
| Ga0209253_103525061 | 3300027900 | Freshwater Lake Sediment | AFAIVTENGKNVQVDLIYIEKDGTFQVHGRRYGRSR |
| Ga0209191_11624643 | 3300027969 | Freshwater Lake | AIMYVKNRNVQVDLIYIEKDGTFTVQGKVYGRARK |
| Ga0209401_13314571 | 3300027971 | Freshwater Lake | YTKGTANWQQAFAIMYVKGSNVQVDIIHIEKNGTFIVQGKVYGRVR |
| Ga0209702_101672021 | 3300027976 | Freshwater | NLMDSKQAHYMKGSMNWQQAFAIMYTHGKKVQVDIINIEKDGTFIVAGKIYGRAR |
| (restricted) Ga0247835_10740233 | 3300028114 | Freshwater | YTKGSANWQQAFAIMYVEGKNVQVDLIYLEKDGTFLVSGKRYGRPR |
| (restricted) Ga0247831_12278891 | 3300028559 | Freshwater | AFAIMYVHGSKVQVDLINIEKDGTFIVSGKSYGRPR |
| (restricted) Ga0247843_11449523 | 3300028569 | Freshwater | SYTKGSANWQQAFAIMYVDGKNVQVDLIYLEKDGTFVVSGKRYGRPR |
| (restricted) Ga0247844_10777011 | 3300028571 | Freshwater | QASYTKGTANWQQAFAIMYVKGSSVQVDLINIEKNGTFIVNGKVYGRVR |
| Ga0315907_101320847 | 3300031758 | Freshwater | KGTANWQQAFAIMYVKGSNVQVDIIHIEKNGTFIVQGKVYGRVR |
| Ga0315909_102459101 | 3300031857 | Freshwater | FAIVKEHGKNVQVDLIYVEKDGTFIVDGKVYGRVR |
| Ga0315909_103512901 | 3300031857 | Freshwater | TKGSANWQQAFAIMYVDGKNVQVDIIYLEKDGTFLVSGKRYGRPR |
| Ga0315903_100714309 | 3300032116 | Freshwater | KAGYVKGTANWQSGFAIMYVDGKNVQVDLIYLEKDGTFVVAGKRYGRPR |
| Ga0315903_110408891 | 3300032116 | Freshwater | AHYTKGSANWQQAFAIIYVNKAKVQVDLIHIEKDGTFIVAGKSYGRPR |
| Ga0334980_0177997_45_206 | 3300033816 | Freshwater | MDFKQAAYTKGVANWQQAFAIMYVHGNKVQVDLINIEKDGTFIVSGKGYGRAR |
| Ga0334982_0206345_826_954 | 3300033981 | Freshwater | VANWQQAFAIIYVNKAKVQVDLIHIEKDGTFIVAGKSYGRPR |
| Ga0334996_0111596_1442_1576 | 3300033994 | Freshwater | KGSANWQQAFAIMYVDGKNVQVDLIYIEKDGTFVVAGKRYGRSR |
| Ga0334996_0461445_67_228 | 3300033994 | Freshwater | MDFKQAAYTKGVANWQQAFAIMYVHGNKVQVDLINIEKDGTFIVSGKTYGRPR |
| Ga0334986_0594384_2_121 | 3300034012 | Freshwater | WQQAFAIMYVEGKNVQVDLIYIEKDGTFVVAGKRYGRPR |
| Ga0335002_0493108_548_655 | 3300034020 | Freshwater | FAIIYVNKAKVQVDLIHIEKDGTFIVAGKSYGRPR |
| Ga0334987_0078271_2275_2436 | 3300034061 | Freshwater | MDFKQAAYTKGVANWQQAFAIMYVHGNKVQVDLINIEKDGTFIVSGKTYGRAR |
| Ga0334987_0644518_181_345 | 3300034061 | Freshwater | MDFKQASYTKGTANWQQAFAIMYVQNSTVQVDLINIEKNGTFIVQGKVYGRPRK |
| Ga0334995_0048339_3189_3350 | 3300034062 | Freshwater | MDFKQAAYTKGVANWQQAFAIMYVHGNKVQVDLINIEKDGTFIVSGKTYGRGR |
| Ga0334995_0747356_217_378 | 3300034062 | Freshwater | MDFSKAGYTKGSANWQQAFAIMYVDGKNVQVDLIYFEKDGTFVVAGKRYGRSR |
| Ga0335019_0867166_3_164 | 3300034066 | Freshwater | DFLPGSYYKGTANWQQAFAIMYVQASSVQVDLINIEKNGTFIVQGKVYGRPRK |
| Ga0335010_0634545_1_156 | 3300034092 | Freshwater | FKQAAYMKGVGNWQQAFAIIYINKAKVQVDLIHIEKDGTFIVSGKSYGRPR |
| Ga0335022_0608201_31_192 | 3300034095 | Freshwater | MNFKQAGYTKGTANWQQAFATIETDGKRVNVQLIYIEKDGTFLVSGRRYGKPR |
| Ga0335027_0654782_2_145 | 3300034101 | Freshwater | SYTKGSANWQQAFAIMYVEGKNVQVDLIYIEKDGTFVVSGKRYGRPR |
| Ga0335027_0711782_143_304 | 3300034101 | Freshwater | MDFSKASYTKGSANWQSGFAIMYVEGKNVQVDLIYLEKDGTFVVAGKRYGRPR |
| Ga0335035_0243932_888_1049 | 3300034105 | Freshwater | MDFKQAAYMKGVGNWQQAFAIIYINKAKVQVDLIHIEKDGTFIVSGKSYGRPR |
| Ga0335035_0619751_98_235 | 3300034105 | Freshwater | MDFKQAAYTKGVANWQQAFAIIYVNKAKVQVDLINIEKDGTFIVA |
| Ga0335036_0773442_2_109 | 3300034106 | Freshwater | FAIMYIHGKNVQVDLIYIEKNGTFIVQGKVYGRPR |
| Ga0335053_0637175_3_128 | 3300034118 | Freshwater | ANWQQAFAIMYVEGKNVQVDLIYIEKDGTFVVSGKRYGRPR |
| Ga0335056_0451870_2_160 | 3300034120 | Freshwater | DFKQAAYTKGVANWQQAFAIMYVHGNKVQVDLINIEKDGTFIVSGKSYGRAR |
| Ga0335060_0210471_951_1100 | 3300034122 | Freshwater | QAAYTKGVANWQQAFAIMYVHGNKVQVDLINIEKDGTFIVSGKSYGRAR |
| Ga0335060_0433303_554_682 | 3300034122 | Freshwater | VANWQQAFAIIYVNKAKVQVDLINIEKDGTFIVAGKSYGRPR |
| Ga0335065_0640851_1_120 | 3300034200 | Freshwater | WQQAFAIMYVDGKNVQVDLIYIEKDGTFVVSGKRYGRPR |
| Ga0335065_0777020_140_304 | 3300034200 | Freshwater | MDFKQASYTKGTANWQQAFAIMYVHASTVQVDLINIEKNGTFIVQGKVYGRPRK |
| Ga0335013_0781676_2_109 | 3300034284 | Freshwater | FAIMYVEGKNVQVDLIYLEKDGTFVVSGKRYGRPR |
| ⦗Top⦘ |