Metagenome / Metatranscriptome Family F033031

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F033031
Family Type	Metagenome / Metatranscriptome
Number of Sequences	178
Average Sequence Length	39 residues
Representative Sequence	MDDLIRLSDIIFSTDEMAMLGGIIGFWFGSRGWSKK
Number of Associated Samples	133
Number of Associated Scaffolds	178

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	1.14 %
% of genes near scaffold ends (potentially truncated)	88.20 %
% of genes from short scaffolds (< 2000 bps)	85.39 %
Associated GOLD sequencing projects	126
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.45

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Unclassified (45.506 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (17.977 % of family members)
Environment Ontology (ENVO)	Unclassified (47.753 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Water (non-saline) (43.820 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 45.31% β-sheet: 0.00% Coil/Unstructured: 54.69%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.45
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.45
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 178 Family Scaffolds
PF00959	Phage_lysozyme	86.52
PF01541	GIY-YIG	3.93
PF07460	NUMOD3	1.69
PF13392	HNH_3	1.12
PF13730	HTH_36	0.56
PF00622	SPRY	0.56
PF07508	Recombinase	0.56
PF00149	Metallophos	0.56
PF13884	Peptidase_S74	0.56
PF12708	Pectate_lyase_3	0.56
PF03819	MazG	0.56
PF03837	RecT	0.56
PF09588	YqaJ	0.56
PF10991	DUF2815	0.56

COG ID	Name	Functional Category	% Frequency in 178 Family Scaffolds
COG1961	Site-specific DNA recombinase SpoIVCA/DNA invertase PinE	Replication, recombination and repair [L]	0.56
COG3723	Recombinational DNA repair protein RecT	Replication, recombination and repair [L]	0.56

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	54.49 %
Unclassified	root	N/A	45.51 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	45.51 %
Viruses	superkingdom	All Organisms → Viruses	43.82 %
cellular organisms	root	All Organisms → cellular organisms	10.67 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	45.51 %
Duplodnaviria	clade	All Organisms → Viruses → Duplodnaviria	39.33 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	10.67 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	4.49 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	45.51 %
Heunggongvirae	kingdom	All Organisms → Viruses → Duplodnaviria → Heunggongvirae	39.33 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	7.87 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	4.49 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	45.51 %
Uroviricota	phylum	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota	39.33 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	4.49 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	2.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	45.51 %
Caudoviricetes	class	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	39.33 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	4.49 %
Methylococcales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales	1.12 %
Vibrionales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales	0.56 %
Moraxellales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales	0.56 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	45.51 %
environmental samples	no rank	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples	29.21 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	4.49 %
unclassified Caudoviricetes	no rank	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes	3.37 %
Methylococcaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae	1.12 %
Vibrionaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae	0.56 %
Moraxellaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae	0.56 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	45.51 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	29.21 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	4.49 %
Podoviridae sp. ctwJH20	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Podoviridae sp. ctwJH20	3.37 %
unclassified Methylococcaceae	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → unclassified Methylococcaceae	1.12 %
Vibrio	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio	0.56 %
Moraxella	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Moraxella	0.56 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	45.51 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	29.21 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	4.49 %
Podoviridae sp. ctwJH20	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Podoviridae sp. ctwJH20	3.37 %
Methylococcaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → unclassified Methylococcaceae → Methylococcaceae bacterium	1.12 %
Moraxella osloensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Moraxella → Moraxella osloensis	0.56 %
Vibrio cincinnatiensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio cincinnatiensis	0.56 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300002274\|B570J29581_108093	All Organisms → cellular organisms → Bacteria → Proteobacteria	643	Open in IMG/M
3300002408\|B570J29032_109074576	Not Available	586	Open in IMG/M
3300003393\|JGI25909J50240_1061388	All Organisms → cellular organisms → Bacteria	768	Open in IMG/M
3300003411\|JGI25911J50253_10070990	Not Available	1127	Open in IMG/M
3300003412\|JGI25912J50252_10130084	Not Available	588	Open in IMG/M
3300003497\|JGI25925J51416_10158626	All Organisms → cellular organisms → Bacteria → Proteobacteria	511	Open in IMG/M
3300004481\|Ga0069718_15578940	Not Available	779	Open in IMG/M
3300004481\|Ga0069718_15996498	Not Available	746	Open in IMG/M
3300005517\|Ga0070374_10384259	Not Available	707	Open in IMG/M
3300005527\|Ga0068876_10327833	Not Available	865	Open in IMG/M
3300005527\|Ga0068876_10563685	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	620	Open in IMG/M
3300005528\|Ga0068872_10288586	All Organisms → cellular organisms → Bacteria	912	Open in IMG/M
3300005581\|Ga0049081_10165138	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	805	Open in IMG/M
3300005582\|Ga0049080_10183200	Not Available	695	Open in IMG/M
3300006484\|Ga0070744_10133039	Not Available	715	Open in IMG/M
3300006802\|Ga0070749_10034630	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3127	Open in IMG/M
3300006803\|Ga0075467_10648664	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	538	Open in IMG/M
3300007171\|Ga0102977_1081451	All Organisms → cellular organisms → Bacteria → Proteobacteria	2433	Open in IMG/M
3300007538\|Ga0099851_1074273	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1314	Open in IMG/M
3300007538\|Ga0099851_1295433	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	572	Open in IMG/M
3300007549\|Ga0102879_1120950	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	808	Open in IMG/M
3300007622\|Ga0102863_1243051	Not Available	528	Open in IMG/M
3300007629\|Ga0102895_1074591	Not Available	873	Open in IMG/M
3300007640\|Ga0070751_1391146	Not Available	502	Open in IMG/M
3300007653\|Ga0102868_1188708	Not Available	503	Open in IMG/M
3300007973\|Ga0105746_1314987	Not Available	543	Open in IMG/M
3300008107\|Ga0114340_1240230	Not Available	563	Open in IMG/M
3300008108\|Ga0114341_10248725	All Organisms → cellular organisms → Bacteria → Proteobacteria	959	Open in IMG/M
3300008116\|Ga0114350_1019067	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	7326	Open in IMG/M
3300008261\|Ga0114336_1004587	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	16067	Open in IMG/M
3300008265\|Ga0114361_1099773	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1310	Open in IMG/M
3300008266\|Ga0114363_1033319	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2156	Open in IMG/M
3300008266\|Ga0114363_1130415	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	860	Open in IMG/M
3300008266\|Ga0114363_1159815	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	738	Open in IMG/M
3300008448\|Ga0114876_1129736	Not Available	953	Open in IMG/M
3300008448\|Ga0114876_1158698	Not Available	815	Open in IMG/M
3300008450\|Ga0114880_1104673	All Organisms → Viruses → Predicted Viral	1088	Open in IMG/M
3300008450\|Ga0114880_1167881	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	771	Open in IMG/M
3300008996\|Ga0102831_1099800	Not Available	967	Open in IMG/M
3300009075\|Ga0105090_10949089	Not Available	524	Open in IMG/M
3300009086\|Ga0102812_10759811	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	536	Open in IMG/M
3300009152\|Ga0114980_10404654	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Podoviridae sp. ctwJH20	782	Open in IMG/M
3300009165\|Ga0105102_10267524	All Organisms → cellular organisms → Bacteria	875	Open in IMG/M
3300009165\|Ga0105102_10546746	Not Available	634	Open in IMG/M
3300009165\|Ga0105102_10745876	Not Available	553	Open in IMG/M
3300009168\|Ga0105104_10771635	Not Available	557	Open in IMG/M
3300009170\|Ga0105096_10191904	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	1032	Open in IMG/M
3300009181\|Ga0114969_10299312	Not Available	949	Open in IMG/M
3300009426\|Ga0115547_1244328	Not Available	561	Open in IMG/M
3300010354\|Ga0129333_10095821	All Organisms → cellular organisms → Bacteria → Proteobacteria	2742	Open in IMG/M
3300010354\|Ga0129333_10555095	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Podoviridae sp. ctwJH20	1001	Open in IMG/M
3300010354\|Ga0129333_10784770	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Podoviridae sp. ctwJH20	813	Open in IMG/M
3300010370\|Ga0129336_10030519	Not Available	3262	Open in IMG/M
3300010370\|Ga0129336_10079690	All Organisms → Viruses → Predicted Viral	1933	Open in IMG/M
3300010370\|Ga0129336_10206406	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1116	Open in IMG/M
3300010370\|Ga0129336_10699160	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	537	Open in IMG/M
3300011184\|Ga0136709_1008942	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1426	Open in IMG/M
3300012665\|Ga0157210_1039899	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	725	Open in IMG/M
3300012665\|Ga0157210_1071710	Not Available	522	Open in IMG/M
3300013004\|Ga0164293_10914901	Not Available	551	Open in IMG/M
3300013005\|Ga0164292_10837182	Not Available	580	Open in IMG/M
(restricted) 3300013131\|Ga0172373_10492099	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	748	Open in IMG/M
3300014258\|Ga0075315_1081549	Not Available	589	Open in IMG/M
3300014711\|Ga0134314_113539	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	539	Open in IMG/M
(restricted) 3300014720\|Ga0172376_10150264	All Organisms → cellular organisms → Bacteria → Proteobacteria	1554	Open in IMG/M
(restricted) 3300014720\|Ga0172376_10431507	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	751	Open in IMG/M
3300017716\|Ga0181350_1008915	Not Available	2880	Open in IMG/M
3300017723\|Ga0181362_1098264	Not Available	583	Open in IMG/M
3300017736\|Ga0181365_1076504	Not Available	822	Open in IMG/M
3300017747\|Ga0181352_1053665	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1168	Open in IMG/M
3300017747\|Ga0181352_1196012	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	520	Open in IMG/M
3300017754\|Ga0181344_1113431	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	783	Open in IMG/M
3300017754\|Ga0181344_1136289	Not Available	703	Open in IMG/M
3300017761\|Ga0181356_1206942	Not Available	578	Open in IMG/M
3300017774\|Ga0181358_1060011	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Moraxella → Moraxella osloensis	1421	Open in IMG/M
3300017774\|Ga0181358_1145377	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	814	Open in IMG/M
3300017777\|Ga0181357_1000425	All Organisms → cellular organisms → Bacteria	15712	Open in IMG/M
3300017780\|Ga0181346_1242892	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	632	Open in IMG/M
3300017785\|Ga0181355_1087065	All Organisms → Viruses → Predicted Viral	1301	Open in IMG/M
3300017785\|Ga0181355_1115057	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1104	Open in IMG/M
3300020048\|Ga0207193_1132241	Not Available	2153	Open in IMG/M
3300020159\|Ga0211734_10052601	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1018	Open in IMG/M
3300020162\|Ga0211735_10935875	Not Available	645	Open in IMG/M
3300020172\|Ga0211729_11089286	All Organisms → Viruses → Predicted Viral	2181	Open in IMG/M
3300020498\|Ga0208050_1032712	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	511	Open in IMG/M
3300020536\|Ga0207939_1037762	Not Available	615	Open in IMG/M
3300020550\|Ga0208600_1035386	Not Available	773	Open in IMG/M
3300020551\|Ga0208360_1048874	Not Available	533	Open in IMG/M
3300021960\|Ga0222715_10478074	Not Available	665	Open in IMG/M
3300021962\|Ga0222713_10427423	Not Available	809	Open in IMG/M
3300021962\|Ga0222713_10501394	Not Available	726	Open in IMG/M
3300022179\|Ga0181353_1023506	Not Available	1626	Open in IMG/M
3300022190\|Ga0181354_1143844	Not Available	751	Open in IMG/M
3300022407\|Ga0181351_1074494	All Organisms → cellular organisms → Bacteria → Proteobacteria	1367	Open in IMG/M
3300023174\|Ga0214921_10298653	Not Available	899	Open in IMG/M
3300024346\|Ga0244775_10039628	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	4155	Open in IMG/M
3300024503\|Ga0255152_1032743	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	964	Open in IMG/M
3300025091\|Ga0209616_1007671	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1195	Open in IMG/M
3300025635\|Ga0208147_1107337	Not Available	673	Open in IMG/M
3300025756\|Ga0255239_1036586	Not Available	774	Open in IMG/M
3300025889\|Ga0208644_1304870	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	631	Open in IMG/M
3300026473\|Ga0255166_1032111	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1087	Open in IMG/M
3300026473\|Ga0255166_1096093	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	537	Open in IMG/M
3300026478\|Ga0255156_1094095	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	526	Open in IMG/M
3300026566\|Ga0256334_1143883	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	541	Open in IMG/M
3300027365\|Ga0209300_1003896	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	5106	Open in IMG/M
3300027396\|Ga0255146_1106882	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	573	Open in IMG/M
3300027597\|Ga0255088_1100048	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	533	Open in IMG/M
3300027608\|Ga0208974_1105802	Not Available	747	Open in IMG/M
3300027608\|Ga0208974_1185548	Not Available	510	Open in IMG/M
3300027631\|Ga0208133_1083837	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	749	Open in IMG/M
3300027710\|Ga0209599_10145183	Not Available	631	Open in IMG/M
3300027743\|Ga0209593_10094266	All Organisms → cellular organisms → Bacteria → Proteobacteria	1106	Open in IMG/M
3300027772\|Ga0209768_10002101	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	12466	Open in IMG/M
3300027804\|Ga0209358_10059864	Not Available	2219	Open in IMG/M
3300027805\|Ga0209229_10305158	Not Available	701	Open in IMG/M
3300027805\|Ga0209229_10394684	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	601	Open in IMG/M
3300027808\|Ga0209354_10437781	Not Available	504	Open in IMG/M
3300027899\|Ga0209668_10696456	Not Available	682	Open in IMG/M
3300027917\|Ga0209536_101632750	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	782	Open in IMG/M
3300028025\|Ga0247723_1009900	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3775	Open in IMG/M
3300028025\|Ga0247723_1133872	Not Available	594	Open in IMG/M
3300031707\|Ga0315291_10566119	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1038	Open in IMG/M
3300031758\|Ga0315907_10343037	Not Available	1217	Open in IMG/M
3300031758\|Ga0315907_11023725	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	594	Open in IMG/M
3300031758\|Ga0315907_11153547	Not Available	546	Open in IMG/M
3300031758\|Ga0315907_11281822	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	507	Open in IMG/M
3300031784\|Ga0315899_11661746	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	527	Open in IMG/M
3300031787\|Ga0315900_10004466	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	19703	Open in IMG/M
3300031787\|Ga0315900_10644377	Not Available	763	Open in IMG/M
3300031787\|Ga0315900_11004855	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	548	Open in IMG/M
3300031857\|Ga0315909_10036108	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	4726	Open in IMG/M
3300031857\|Ga0315909_10601054	Not Available	735	Open in IMG/M
3300031857\|Ga0315909_10792415	Not Available	600	Open in IMG/M
3300031885\|Ga0315285_10900334	Not Available	541	Open in IMG/M
3300031951\|Ga0315904_10082937	Not Available	3425	Open in IMG/M
3300031951\|Ga0315904_10604098	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	943	Open in IMG/M
3300031951\|Ga0315904_10758378	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	805	Open in IMG/M
3300031951\|Ga0315904_11230621	Not Available	572	Open in IMG/M
3300031963\|Ga0315901_10298742	All Organisms → Viruses → Predicted Viral	1335	Open in IMG/M
3300032050\|Ga0315906_10084842	All Organisms → Viruses → Predicted Viral	3184	Open in IMG/M
3300032050\|Ga0315906_10550344	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio cincinnatiensis	963	Open in IMG/M
3300032050\|Ga0315906_10986589	Not Available	635	Open in IMG/M
3300032093\|Ga0315902_10867712	Not Available	700	Open in IMG/M
3300032116\|Ga0315903_10733564	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Podoviridae sp. ctwJH20	733	Open in IMG/M
3300033418\|Ga0316625_101548018	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	630	Open in IMG/M
3300033482\|Ga0316627_101919566	Not Available	612	Open in IMG/M
3300033488\|Ga0316621_11174887	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	579	Open in IMG/M
3300033979\|Ga0334978_0196871	All Organisms → cellular organisms → Bacteria → Proteobacteria	990	Open in IMG/M
3300033981\|Ga0334982_0485686	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	548	Open in IMG/M
3300033992\|Ga0334992_0497229	Not Available	529	Open in IMG/M
3300033995\|Ga0335003_0332121	Not Available	672	Open in IMG/M
3300033996\|Ga0334979_0687701	Not Available	535	Open in IMG/M
3300033996\|Ga0334979_0752912	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	505	Open in IMG/M
3300034012\|Ga0334986_0035009	All Organisms → Viruses → Predicted Viral	3290	Open in IMG/M
3300034012\|Ga0334986_0039223	All Organisms → Viruses → Predicted Viral	3075	Open in IMG/M
3300034012\|Ga0334986_0279042	Not Available	895	Open in IMG/M
3300034071\|Ga0335028_0655132	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Podoviridae sp. ctwJH20	556	Open in IMG/M
3300034072\|Ga0310127_260902	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	610	Open in IMG/M
3300034082\|Ga0335020_0611971	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	508	Open in IMG/M
3300034101\|Ga0335027_0792704	Not Available	550	Open in IMG/M
3300034102\|Ga0335029_0115726	All Organisms → cellular organisms → Bacteria	1874	Open in IMG/M
3300034104\|Ga0335031_0747325	Not Available	555	Open in IMG/M
3300034106\|Ga0335036_0391759	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Podoviridae sp. ctwJH20	895	Open in IMG/M
3300034106\|Ga0335036_0560293	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	701	Open in IMG/M
3300034106\|Ga0335036_0567552	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → unclassified Methylococcaceae → Methylococcaceae bacterium	694	Open in IMG/M
3300034107\|Ga0335037_0695582	Not Available	531	Open in IMG/M
3300034110\|Ga0335055_0416415	Not Available	552	Open in IMG/M
3300034112\|Ga0335066_0472080	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → unclassified Methylococcaceae → Methylococcaceae bacterium	670	Open in IMG/M
3300034112\|Ga0335066_0622189	Not Available	555	Open in IMG/M
3300034112\|Ga0335066_0635029	Not Available	548	Open in IMG/M
3300034166\|Ga0335016_0538443	Not Available	649	Open in IMG/M
3300034272\|Ga0335049_0066091	Not Available	2666	Open in IMG/M
3300034283\|Ga0335007_0683051	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	578	Open in IMG/M
3300034355\|Ga0335039_0568044	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	560	Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	100.00%

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	94.94%
Terrestrial	Environmental → Terrestrial	5.06%

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater	78.65%
Marine	Environmental → Aquatic → Marine	16.29%
Soil	Environmental → Terrestrial → Soil	2.25%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface	2.81%

Habitat	Taxonomy	Distribution
Lake	Environmental → Aquatic → Freshwater → Lake	29.78%
Lentic	Environmental → Aquatic → Freshwater → Lentic	24.16%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified	12.92%
Coastal	Environmental → Aquatic → Marine → Coastal	8.43%
Sediment	Environmental → Aquatic → Freshwater → Sediment	5.62%
River	Environmental → Aquatic → Freshwater → River	4.49%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	3.37%
Unclassified	Environmental → Aquatic → Marine → Unclassified	3.37%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	2.25%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified	2.81%
Lotic	Environmental → Aquatic → Freshwater → Lotic	1.12%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	0.56%
Oceanic	Environmental → Aquatic → Marine → Oceanic	0.56%
Pelagic	Environmental → Aquatic → Marine → Pelagic	0.56%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	28.09%
Unclassified	Environmental → Aquatic → Freshwater → Lentic → Unclassified	21.35%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified → Unclassified	12.92%
Unclassified	Environmental → Aquatic → Marine → Coastal → Unclassified	8.43%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	5.62%
Unclassified	Environmental → Aquatic → Freshwater → River → Unclassified	4.49%
Estuary	Environmental → Aquatic → Marine → Intertidal Zone → Estuary	3.37%
Unclassified	Environmental → Aquatic → Marine → Unclassified → Unclassified	3.37%
Epilimnion	Environmental → Aquatic → Freshwater → Lentic → Epilimnion	2.25%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	2.25%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified	2.81%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	1.69%
Unclassified	Environmental → Aquatic → Freshwater → Lotic → Unclassified	1.12%
Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment	0.56%
Unclassified	Environmental → Aquatic → Freshwater → Groundwater → Unclassified	0.56%
Sediment	Environmental → Aquatic → Marine → Oceanic → Sediment	0.56%
Unclassified	Environmental → Aquatic → Marine → Pelagic → Unclassified	0.56%

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	17.98%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake	16.29%
Freshwater	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater	11.80%
Freshwater, Plankton	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton	5.06%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	4.49%
Freshwater	Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater	4.49%
Aqueous	Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous	3.93%
Freshwater To Marine Saline Gradient	Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient	3.93%
Estuarine	Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine	3.37%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater	2.25%
Freshwater Lentic	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic	2.25%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	2.25%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	1.69%
Estuarine	Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine	1.69%
Estuarine Water	Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water	1.69%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	1.69%
Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment	1.12%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater	1.12%
Freshwater And Sediment	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment	1.12%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	1.12%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	1.12%
Freshwater	Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater	1.12%
Freshwater	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater	1.12%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface	1.12%
Deep Subsurface Sediment	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment	1.12%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake	0.56%
Freshwater Lake Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment	0.56%
Freshwater Lake Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment	0.56%
Surface Water	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Surface Water	0.56%
Marine Sediment	Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment	0.56%
Estuary Water	Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water	0.56%
Pelagic Marine	Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine	0.56%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	0.56%
Fracking Water	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water	0.56%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300002274	Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion	Environmental	Open in IMG/M
3300002408	Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)	Environmental	Open in IMG/M
3300003393	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD	Environmental	Open in IMG/M
3300003411	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD	Environmental	Open in IMG/M
3300003412	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD	Environmental	Open in IMG/M
3300003497	Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN	Environmental	Open in IMG/M
3300004481	Combined Assembly of Gp0112041, Gp0112042, Gp0112043	Environmental	Open in IMG/M
3300005517	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4)	Environmental	Open in IMG/M
3300005527	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG	Environmental	Open in IMG/M
3300005528	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG	Environmental	Open in IMG/M
3300005581	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF	Environmental	Open in IMG/M
3300005582	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF	Environmental	Open in IMG/M
3300006484	Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535	Environmental	Open in IMG/M
3300006802	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18	Environmental	Open in IMG/M
3300006803	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA	Environmental	Open in IMG/M
3300007171	Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface layer) 8 sequencing projects	Environmental	Open in IMG/M
3300007538	Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG	Environmental	Open in IMG/M
3300007549	Estuarine microbial communities from the Columbia River estuary - metaG 1548B-02	Environmental	Open in IMG/M
3300007622	Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02	Environmental	Open in IMG/M
3300007629	Estuarine microbial communities from the Columbia River estuary - metaG 1554B-3	Environmental	Open in IMG/M
3300007640	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28	Environmental	Open in IMG/M
3300007653	Estuarine microbial communities from the Columbia River estuary - metaG 1546C-3	Environmental	Open in IMG/M
3300007973	Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um	Environmental	Open in IMG/M
3300008107	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA	Environmental	Open in IMG/M
3300008108	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA	Environmental	Open in IMG/M
3300008116	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA	Environmental	Open in IMG/M
3300008261	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA	Environmental	Open in IMG/M
3300008265	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0126-100-LTR	Environmental	Open in IMG/M
3300008266	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA	Environmental	Open in IMG/M
3300008448	Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs	Environmental	Open in IMG/M
3300008450	Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs	Environmental	Open in IMG/M
3300008996	Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747	Environmental	Open in IMG/M
3300009075	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015	Environmental	Open in IMG/M
3300009086	Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713	Environmental	Open in IMG/M
3300009152	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG	Environmental	Open in IMG/M
3300009165	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015	Environmental	Open in IMG/M
3300009168	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015	Environmental	Open in IMG/M
3300009169	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015	Environmental	Open in IMG/M
3300009170	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015	Environmental	Open in IMG/M
3300009181	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG	Environmental	Open in IMG/M
3300009426	Pelagic marine microbial communities from North Sea - COGITO_mtgs_100420	Environmental	Open in IMG/M
3300010354	Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA	Environmental	Open in IMG/M
3300010370	Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA	Environmental	Open in IMG/M
3300011184	Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA - Floc-Cal metaG	Environmental	Open in IMG/M
3300012665	Freshwater microbial communities from Talbot River, Ontario, Canada - S11	Environmental	Open in IMG/M
3300013004	Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG	Environmental	Open in IMG/M
3300013005	Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG	Environmental	Open in IMG/M
3300013131 (restricted)	Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m	Environmental	Open in IMG/M
3300014258	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleA_D1	Environmental	Open in IMG/M
3300014711	Surface water microbial communities from Bangladesh - BaraHaldiaSW0111	Environmental	Open in IMG/M
3300014720 (restricted)	Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m	Environmental	Open in IMG/M
3300017716	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D	Environmental	Open in IMG/M
3300017723	Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N	Environmental	Open in IMG/M
3300017736	Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N	Environmental	Open in IMG/M
3300017747	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N	Environmental	Open in IMG/M
3300017754	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D	Environmental	Open in IMG/M
3300017761	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N	Environmental	Open in IMG/M
3300017774	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D	Environmental	Open in IMG/M
3300017777	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N	Environmental	Open in IMG/M
3300017780	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N	Environmental	Open in IMG/M
3300017785	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N	Environmental	Open in IMG/M
3300019781	Freshwater viral communities from Lake Michigan, USA - Sp13.ND.MM15.S.D	Environmental	Open in IMG/M
3300020048	Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915	Environmental	Open in IMG/M
3300020159	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1	Environmental	Open in IMG/M
3300020162	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1	Environmental	Open in IMG/M
3300020172	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1	Environmental	Open in IMG/M
3300020498	Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300020536	Freshwater microbial communities from Lake Mendota, WI - 02JUN2012 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300020550	Freshwater microbial communities from Lake Mendota, WI - 08OCT2012 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300020551	Freshwater microbial communities from Lake Mendota, WI - 27JUL2010 deep hole epilimnion ns (SPAdes)	Environmental	Open in IMG/M
3300021960	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D	Environmental	Open in IMG/M
3300021962	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D	Environmental	Open in IMG/M
3300022179	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N	Environmental	Open in IMG/M
3300022190	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N	Environmental	Open in IMG/M
3300022407	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D	Environmental	Open in IMG/M
3300023174	Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505	Environmental	Open in IMG/M
3300024346	Whole water sample coassembly	Environmental	Open in IMG/M
3300024503	Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8h	Environmental	Open in IMG/M
3300025091	Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA - Floc-Cal metaG (SPAdes)	Environmental	Open in IMG/M
3300025635	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes)	Environmental	Open in IMG/M
3300025756	Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepB_8d (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300025889	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes)	Environmental	Open in IMG/M
3300026473	Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_8d	Environmental	Open in IMG/M
3300026478	Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8h	Environmental	Open in IMG/M
3300026566	Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300027365	Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT (SPAdes)	Environmental	Open in IMG/M
3300027396	Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_8h	Environmental	Open in IMG/M
3300027597	Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepB_8d	Environmental	Open in IMG/M
3300027608	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes)	Environmental	Open in IMG/M
3300027631	Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes)	Environmental	Open in IMG/M
3300027710	Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes)	Environmental	Open in IMG/M
3300027743	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 (SPAdes)	Environmental	Open in IMG/M
3300027772	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes)	Environmental	Open in IMG/M
3300027804	Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes)	Environmental	Open in IMG/M
3300027805	Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes)	Environmental	Open in IMG/M
3300027808	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes)	Environmental	Open in IMG/M
3300027899	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes)	Environmental	Open in IMG/M
3300027917	Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes)	Environmental	Open in IMG/M
3300028025	Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC	Environmental	Open in IMG/M
3300031707	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20	Environmental	Open in IMG/M
3300031758	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123	Environmental	Open in IMG/M
3300031784	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112	Environmental	Open in IMG/M
3300031787	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114	Environmental	Open in IMG/M
3300031857	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125	Environmental	Open in IMG/M
3300031885	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36	Environmental	Open in IMG/M
3300031951	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120	Environmental	Open in IMG/M
3300031963	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116	Environmental	Open in IMG/M
3300032050	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122	Environmental	Open in IMG/M
3300032093	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117	Environmental	Open in IMG/M
3300032116	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119	Environmental	Open in IMG/M
3300033418	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A	Environmental	Open in IMG/M
3300033482	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C	Environmental	Open in IMG/M
3300033488	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D1_C	Environmental	Open in IMG/M
3300033979	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME30Aug2017-rr0003	Environmental	Open in IMG/M
3300033981	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011	Environmental	Open in IMG/M
3300033992	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035	Environmental	Open in IMG/M
3300033995	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056	Environmental	Open in IMG/M
3300033996	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004	Environmental	Open in IMG/M
3300034012	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027	Environmental	Open in IMG/M
3300034071	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110	Environmental	Open in IMG/M
3300034072	Fracking water microbial communities from deep shales in Oklahoma, United States - MC-3-A	Environmental	Open in IMG/M
3300034082	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088	Environmental	Open in IMG/M
3300034101	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107	Environmental	Open in IMG/M
3300034102	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112	Environmental	Open in IMG/M
3300034104	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120	Environmental	Open in IMG/M
3300034106	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131	Environmental	Open in IMG/M
3300034107	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Apr2017-rr0133	Environmental	Open in IMG/M
3300034110	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Jun2009D10-rr0171	Environmental	Open in IMG/M
3300034112	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191	Environmental	Open in IMG/M
3300034166	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Sep2012-rr0079	Environmental	Open in IMG/M
3300034272	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156	Environmental	Open in IMG/M
3300034283	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061	Environmental	Open in IMG/M
3300034355	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Oct2015-rr0135	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID	Sample Taxon ID	Habitat	Sequence
B570J29581_1080931	3300002274	Freshwater	PSLVNNMDDLIRVTDVIFSSDEMAMLGGIIGFWFGSRSWAKK*
B570J29032_1090745761	3300002408	Freshwater	ELIALSDIIFSTDEMAMLGGIIGFWFGSRSWAKK*
JGI25909J50240_10613882	3300003393	Freshwater Lake	VSNMDDLIRITDIIFSADEMAMLGGIIGFWFGSRSWSKK*
JGI25911J50253_100709902	3300003411	Freshwater Lake	VVNNMDDLIRVTDVIFSADEMAMLGGIIGFWFGSRSWSKK*
JGI25912J50252_101300842	3300003412	Freshwater Lake	PNLVSSMDDLIRITDILFSADEMAMLGGIIGFWFGSRSWSKK*
JGI25925J51416_101586261	3300003497	Freshwater Lake	SLVNNMDDLIRVTDVIFSSDEMAMLGGIIGFWFGSRSWAKK*
Ga0069718_155789402	3300004481	Sediment	WYNEKLITNLEELVKFSDIIFSTDEMAMLGGIIGFWFGSRGWSKK*
Ga0069718_159964981	3300004481	Sediment	GLITNMDDVLRYADIIFSPDEMAMLGGIIGFWFGSRNWSKK*
Ga0070374_103842591	3300005517	Freshwater Lake	VQNIDDLIRLSEIIFSTDEMAMLGGIIGFWFGSRGWAKK*
Ga0068876_103278331	3300005527	Freshwater Lake	MDDLIRLSDIIFSTDEMAMLGGIIGFWFGSRGWSKK*
Ga0068876_105636851	3300005527	Freshwater Lake	HPGLINSVEDVIRYSELVFSSDEMSMLGGIIGFWFGSRGWAKK*
Ga0068872_102885863	3300005528	Freshwater Lake	DVIRYSELVFSSDEMSMLGGIIGFWFGSRGWAKK*
Ga0049081_101651384	3300005581	Freshwater Lentic	GVITSIDDVLKFSDVVFSQDEMAMLGGIIGYWFGSRGWAKK*
Ga0049080_101832002	3300005582	Freshwater Lentic	DDLIRLSDIIFSTDEMAMLGGIIGFWFGSRGWSKK*
Ga0070744_101330391	3300006484	Estuarine	IYTRPSLVQNMDDLIRLSDIIFSSDEMAMLGGIIGFWFGSRGWNKK*
Ga0070749_100346301	3300006802	Aqueous	IDDVIRYADIVFSSDEMAMLGRIIGYWFGSRGWRKK*
Ga0075467_106486642	3300006803	Aqueous	VSGMDDVLRYADIIFSPDEMAMLGGIIGFWFGSRNWGKK*
Ga0102977_10814511	3300007171	Freshwater Lake	IQNIDDVLKYADIVFSSDEMAMLGGIIGFWFGSRGWSKK*
Ga0099851_10742734	3300007538	Aqueous	QNIDDLIRVSAIIFSDDEMAMLGGIIGFWFGSRSWQKK*
Ga0099851_12954332	3300007538	Aqueous	LIMSIEDLIRLSDIIFSTDEMAMLGGIIGFWFGSRNWKK*
Ga0102879_11209501	3300007549	Estuarine	TNMDDLIRVSDIIFSGDEMAMLGAIIGFWFGSRSWSKK*
Ga0102863_12430512	3300007622	Estuarine	SRPSLVTSMDDLIRVSDIIFSSDEMAMLGGIIGFWFGSRGWAKK*
Ga0102895_10745911	3300007629	Estuarine	TNMDDLIRVTDIIFSSDEMAMLGGIIGFWFGSRSWSKK*
Ga0070751_13911462	3300007640	Aqueous	FTHPNLIQNIDDVIRFSEIIFSSDEMAMLGGIIGFWFGSRSWQRK*
Ga0102868_11887082	3300007653	Estuarine	YVYSRPSLVNNMDDLIRVTDIIFSSDEMAMLGAIIGFWFGSRSWSKK*
Ga0105746_13149872	3300007973	Estuary Water	YTNPGMIKSMDDVLKYSDIIFSPDEMAMLGGIIGFWFGSRNWNKK*
Ga0114340_12402302	3300008107	Freshwater, Plankton	VTSMDDLIQVTDIIFSGDEMAMLGAIIGFWFGSRSWSKK*
Ga0114341_102487251	3300008108	Freshwater, Plankton	SMEDLIRLSDIIFSTDEMAMLGGIIGFWFGSRSWSKK*
Ga0114341_103106101	3300008108	Freshwater, Plankton	IFSLPGVITSIDDVIRFSDVVFSESEMSMLGGIIGYWFGSRGWSKK*
Ga0114350_10190674	3300008116	Freshwater, Plankton	MDDVLKYSDIIFSPDEMAMLSGILGFWFGSRTWSKK*
Ga0114336_10045878	3300008261	Freshwater, Plankton	MSMEDLIRLSDIIFSTDEMAMLGGIIGFWFGSRSWSKK*
Ga0114361_10997734	3300008265	Freshwater, Plankton	SRPSLVNNMDDLIRVTDVIFSSDEMAMLGGIIGFWFGSRSWAKK*
Ga0114363_10333191	3300008266	Freshwater, Plankton	PGVINNIDDVLKFADVVFSQDEMAMLGGIVGYWFGSRGWAKK*
Ga0114363_11304153	3300008266	Freshwater, Plankton	SIDDVIKFSDVVFSEDEMAMLGGIIGYWFGSRGWSKK*
Ga0114363_11598152	3300008266	Freshwater, Plankton	SNHPELITSIDNLIAVSDIIFSSDEMAMLGGIIGFWFGSRSWSKK*
Ga0114876_11297363	3300008448	Freshwater Lake	LPGVITSIDDVIKFSDVVFSEDEMAMLGGIIGYWFGSRGWSKK*
Ga0114876_11586983	3300008448	Freshwater Lake	MDDLIRLSDIIFSSDEMAMLGGIIGFWFGSRGWAKK*
Ga0114880_11046731	3300008450	Freshwater Lake	SLVTNMEDLIRLTDILFSADEMAMLGGIIGFWFGSRSWAKK*
Ga0114880_11678812	3300008450	Freshwater Lake	IDNLIAVSDIIFSSDEMAMLGGIIGFWFGSRSWSKK*
Ga0102831_10998003	3300008996	Estuarine	YSRPSLVTSMDDLIRVSDIIFSSDEMAMLGGIIGFWFGSRSWSKK*
Ga0105090_109490892	3300009075	Freshwater Sediment	PHLVASVGDVEKVAELIFSSDEMAMLGGIIGFWFGSRGWAKK*
Ga0102812_107598112	3300009086	Estuarine	YSRPSLVTNMDDLIRVSDVIFSSDEMAMLGGIIGFWFGSRSWSKK*
Ga0114980_104046543	3300009152	Freshwater Lake	RPSLVTSMDDLIRVSDIIFSTDEMAMLGAVIGYWFGSRSWNKK*
Ga0105102_102675243	3300009165	Freshwater Sediment	TVDDFIRASDLIFSSEELSMLGAIIGYWFGSRGWSKK*
Ga0105102_105467462	3300009165	Freshwater Sediment	PGMISSMDDVLRYADIIFSPDEMAMLGGIIGFWFGSRNWSKK*
Ga0105102_107458761	3300009165	Freshwater Sediment	LWQNPGLITSMDDVLRYADIIFSPDEMAMLGGIIGFWFGSRNWSKK*
Ga0105104_107716351	3300009168	Freshwater Sediment	MDDVLRYADIIFSPDEMAMLGGIIGFWFGSRNWSKK*
Ga0105097_103411341	3300009169	Freshwater Sediment	DLEIIGEMIFSSDEMAMLGGIIGFWFGSRNWDKKK*
Ga0105096_101919041	3300009170	Freshwater Sediment	LWSNPGLITSMDDVLRYADIIFSPDEMAMLGGIIGFWFGSRNWSKK*
Ga0114969_102993121	3300009181	Freshwater Lake	SLVTSMDDLIRVSDIIFSSDEMAMLGGIIGFWFGSRSWAKK*
Ga0115547_12443282	3300009426	Pelagic Marine	SRPNLVMSMEDLIRLSDIIFSTDEMAMLGGIIGFWFGSRSWSKK*
Ga0129333_100958211	3300010354	Freshwater To Marine Saline Gradient	LIKSVDDIIKYSELIFSSDEMAMLGGIIGFWFGSRQWGKK*
Ga0129333_105550953	3300010354	Freshwater To Marine Saline Gradient	FTHPSLIQNIDDLLRVTEVIFTDDEMAMLGAVIGYWFGSRSWSKK*
Ga0129333_107847701	3300010354	Freshwater To Marine Saline Gradient	SMDDVLKYSDIIFSPDEMAMLSGILGFWFGSRTWSKK*
Ga0129336_100305191	3300010370	Freshwater To Marine Saline Gradient	MDDIILYSDLIFSADEMAILGGIIGYWFGSRQWSKK*
Ga0129336_100796901	3300010370	Freshwater To Marine Saline Gradient	IDDVIKFADVVFSESEMSMLGGIIGFWFGSRGWSKK*
Ga0129336_102064063	3300010370	Freshwater To Marine Saline Gradient	ELIKSVDDIIKYSDLIFSSDEMAMLGGIIGFWFGSRQWGKK*
Ga0129336_106991602	3300010370	Freshwater To Marine Saline Gradient	SLPGVINNIDDVLKFADVVFSEDEMAMLGGIVGYWFGSRGWAKK*
Ga0136709_10089424	3300011184	Freshwater	IYTRPTLVQNMDDLIRLSDIIFSSDEMAMLGGIIGFWFGSRGWNKK*
Ga0157210_10398991	3300012665	Freshwater	NMDDLIRVSEIIFSTDEMAMLGGIIGFWFGSRSWSKK*
Ga0157210_10717102	3300012665	Freshwater	ALVTSMDDLVRLTDILFSTDEMAMLGGIIGFWFGSRSWSKK*
Ga0164293_109149012	3300013004	Freshwater	SIDDVIRYSDLIFSSDEMAMLGGIIGFWFGSRQWSKK*
Ga0164292_108371822	3300013005	Freshwater	YVYLNPHLVLNMGDLISLSDIIFSSDEMAMLGGIIGFWFGSRSWAKK*
(restricted) Ga0172373_104920991	3300013131	Freshwater	IDDVIKFSDVVFSQDEMAMLGGIIGYWFGSRGWAKK*
Ga0075315_10815491	3300014258	Natural And Restored Wetlands	EEMSAASDVIFSSDEMAMLGGIIGFWFGSRNWQKK*
Ga0134314_1135391	3300014711	Surface Water	IDTLIKFSDIIFSEDEMSMLGGIIGFWFGSRGWSKK*
(restricted) Ga0172376_101502641	3300014720	Freshwater	NIDDLIRVSAIIFSEDEMAMLGGIIGFWFGSRSWQKK*
(restricted) Ga0172376_104315072	3300014720	Freshwater	IDDVLKFADVVFSEDEMAMLGGIVGYWFGSRGWAKK*
Ga0181350_10089151	3300017716	Freshwater Lake	NNMDDLIRVTDVIFSSDEMAMLGGIIGFWFGSRSWAKK
Ga0181362_10982641	3300017723	Freshwater Lake	QNIDDLIRLSEIIFSTDEMAMLGGIIGFWFGSRGWAKK
Ga0181365_10765043	3300017736	Freshwater Lake	RPTLVMSIEDLIRLSDIIFSTDEMAMLGGIIGFWFGSRSWSKK
Ga0181352_10536651	3300017747	Freshwater Lake	TNPGMIKSMDEVLRYSDIIFSPDEMAMLGGILGFWFGTRTWSKK
Ga0181352_11960121	3300017747	Freshwater Lake	NLVTSMDDLTRLTDVLFSADETAMLGGIIGFWFGTRSWGKK
Ga0181344_11134313	3300017754	Freshwater Lake	LFNHGTLITNVDDFLKATDMIFSEDEMAMLGAIIGYWFGSRGWSKK
Ga0181344_11362892	3300017754	Freshwater Lake	IIKDIDSLIAITDVLFSSDEMAMLGGIIGFWFGSRSWAKK
Ga0181356_12069421	3300017761	Freshwater Lake	NMDDLIRLSEIIFSTDEMAMLGGIIGFWFGSRGWAKK
Ga0181358_10600114	3300017774	Freshwater Lake	RPSLVMSMDDLIRLSDIIFSTDEMAMLGGIIGFWFGSRGWSKK
Ga0181358_11453773	3300017774	Freshwater Lake	DDLIRLSEIIFSTDEMAMLGGIIGFWFGSRGWAKK
Ga0181357_10004251	3300017777	Freshwater Lake	SIDDIIRYSDLIFSADEMAMLGGIIGFWFGSRQWSKK
Ga0181346_12428921	3300017780	Freshwater Lake	PNLIQNMDDVLRYTDIIFSPDEMAMLGGIIGFWFGSRGWSKK
Ga0181355_10870651	3300017785	Freshwater Lake	SVGDLEKVAELIFSSDEMAMLGGIIGFWFGSRGWAKK
Ga0181355_11150571	3300017785	Freshwater Lake	GMIKSMDDVLKYSDIIFSPDEMSMLGAIIGFWFGTRTWGKK
Ga0181360_1078981	3300019781	Freshwater Lake	VSDLDVIGELIFSSDEMAMLGGIVGFWFGSRNWDKKK
Ga0207193_11322414	3300020048	Freshwater Lake Sediment	VQNVDDLIKYASIIFSDDEMAMLGGIIGFWFGSRNWSKK
Ga0211734_100526013	3300020159	Freshwater	MSMDDLIRLSDLIFSADEMAMLGGILGFWFGSRTWSKK
Ga0211735_109358751	3300020162	Freshwater	IDDLIRLSDIIFSTDEMAMLGGIIGFWFGSRGWSKK
Ga0211729_110892865	3300020172	Freshwater	MDDLIRLSDIIFSTDEMAMLGGIIGFWFGSRGWNKK
Ga0208050_10327122	3300020498	Freshwater	MIKSMDDVLRYSDIIFSPDEMSMLGAIIGFWFGTRTWGKK
Ga0207939_10377622	3300020536	Freshwater	WNHPNLIQSMDDIIQYADLIFSADEMAILGGILGYWFGSRTWSKK
Ga0208600_10353863	3300020550	Freshwater	QSIDDVIRYSDLIFSADEMAMLGGIIGFWFGSRGWSKK
Ga0208360_10488741	3300020551	Freshwater	PGMIKSMDDVLRYSDIIFSPDEMAMLGGIIGFWFGSRNWNKK
Ga0222715_104780741	3300021960	Estuarine Water	SLVTNMEDLIRLTDILFSADEMAMLGGIIGFWFGSRSWSKK
Ga0222713_104274233	3300021962	Estuarine Water	MDDVLKYADIIFSPDEMAMLGGIIGFWFGSRNWGKK
Ga0222713_105013941	3300021962	Estuarine Water	VWYNEKLITNLEDLVRFSDIIFSTDEMAMLGGIIGFWFGSRGWSKK
Ga0181353_10235061	3300022179	Freshwater Lake	DMDDLIRVSEIIFSTDEMAMLGGIIGFWFGSRSWSKK
Ga0181354_11438441	3300022190	Freshwater Lake	RTGMITSIDDIVKYSDLIFSSDEMAMLGGIIGFWFGSRQWSKK
Ga0181351_10744941	3300022407	Freshwater Lake	IDDIIRYSDLIFSADEMAMLGGIIGFWFGSRQWSKK
Ga0214921_102986531	3300023174	Freshwater	MDDLIKVTDIIFSSDEMAMLGGIIGFWFGSRSWSKK
Ga0244775_1003962810	3300024346	Estuarine	NNMDDLIRVTDIIFSGDEMAMLGGIIGFWFGSRSWSKK
Ga0255152_10327431	3300024503	Freshwater	NVLNNIDDVIKFADVVFSESEMSMLGGIIGFWFGSRGWSKK
Ga0209616_10076713	3300025091	Freshwater	IYTRPTLVQNMDDLIRLSDIIFSSDEMAMLGGIIGFWFGSRGWNKK
Ga0208147_11073371	3300025635	Aqueous	VDDVVKYSEIIFSPDEMSMLGGIIGFWFGSRNWSKK
Ga0255239_10365861	3300025756	Freshwater	DDIIKYSDLIFSSDEMAMLGGIIGFWFGSRQWGKK
Ga0208644_13048702	3300025889	Aqueous	IDSLIKVTDVVFNEDEMAMLGGIIGFWFGSRSWSKKK
Ga0255166_10321114	3300026473	Freshwater	HMPHLVASTGDLEKVAELIFSSDEMAMLGGIIGFWFGSRGWSKK
Ga0255166_10960931	3300026473	Freshwater	TIPSLVSSVGDLERVSELIFSSDEMAMLGGIIGFWFGSRGWQKK
Ga0255156_10940951	3300026478	Freshwater	NVDDFIKATDMIFSEDEMAMLGAIIGYWFGSRGWSKK
Ga0256334_11438831	3300026566	Freshwater	QTLIEFSDVIFSAEEMSMLGGIIGFWFGSRGWAKK
Ga0209300_10038966	3300027365	Deep Subsurface	HPGLITNIDDVIKYADLIFSADEMAMLGGIIGFWFGSRGWSKK
Ga0255146_11068822	3300027396	Freshwater	PALIVDVQTLIEFSDVIFSAEEMSMLGGIIGFWFGSRGWAKK
Ga0255088_11000481	3300027597	Freshwater	KSIDDVVRYSELIFSSDEMSMLGGIIGFWFGSRGFKK
Ga0208974_11058023	3300027608	Freshwater Lentic	DDLIRVTDVIFSSDEMAMLGGIIGFWFGSRSWAKK
Ga0208974_11855481	3300027608	Freshwater Lentic	SLVNNMDDLIRVTDIIFSGDEMAMLGGIIGFWFGSRSWSKK
Ga0208133_10838372	3300027631	Estuarine	MDDLIRVTDIIFSGDEMAMLGGIIGFWFGSRSWSKK
Ga0209599_101451831	3300027710	Deep Subsurface	IDDVIRYSEIIFSSDEMAMLGGILGFWFGSRTWSKK
Ga0209593_100942661	3300027743	Freshwater Sediment	LIGGIDDVLKYADIVFSEAEMVMLSGIVSFWFGSRNWSKK
Ga0209768_1000210116	3300027772	Freshwater Lake	NMDDLIRVTDVIFSSDEMAMLGGIIGFWFGSRSWAKK
Ga0209358_100598643	3300027804	Freshwater Lake	EDLIRLSDIIFSTDEMAMLGGIIGFWFGSRSWSKK
Ga0209229_103051582	3300027805	Freshwater And Sediment	NMGDLISLSDIIFSSDEMAMLGGIIGFWFGSRSWAKK
Ga0209229_103946841	3300027805	Freshwater And Sediment	IQNIDDVIKYSGLIFSSDEMAMLGGIIGFWFGSRGWAKK
Ga0209354_104377811	3300027808	Freshwater Lake	MDDLIRITDIIFSADEMAMLGGIIGFWFGSRSWSKK
Ga0209668_106964561	3300027899	Freshwater Lake Sediment	HLVQSMEDLIKVAEIIFSDDEMAMLGGIIGFWFGSRSWNKK
Ga0209536_1016327503	3300027917	Marine Sediment	GTIQSVDDMIRASDVIFSSDEMAMLGGIIGFWFGSRGWGKK
Ga0247723_100990011	3300028025	Deep Subsurface Sediment	LTYMFYHNELITNVDDFIRATDIIFSDDEMAMLGACIGYWFGSRGWSKK
Ga0247723_11338721	3300028025	Deep Subsurface Sediment	VYSRPSLVNNMDDLIRITDVIFSSDEMAMLGGIIGFWFGSRSWAKK
Ga0315291_105661191	3300031707	Sediment	DDLIRVSDIIFSGDEMAMLGAIIGFWFGSRSWSKK
Ga0315907_103430371	3300031758	Freshwater	PHLIQTIDDVIKYSEIIFSSDEMAMLGGIIGFWFGSRGFKK
Ga0315907_110237251	3300031758	Freshwater	HLVQNIDDLIRVSAIIFSDDEMAMLGGIIGFWFGSRSWQKK
Ga0315907_111535472	3300031758	Freshwater	GDVEKVAELIFSSDEMAMLGGIIGFWFGSRGWAKK
Ga0315907_112818222	3300031758	Freshwater	HPELITNIDNLIAVSDIIFSSDEMAMLGGIIGFWFGSRSWSKK
Ga0315899_116617461	3300031784	Freshwater	LDDLMRYVDIIFSQDEMAMLGGIIGFWFGSRSMGQKQ
Ga0315900_100044661	3300031787	Freshwater	MIKSMDDVLKYSDIIFSPDEMAMLGGIIGFWFGSRNWNKK
Ga0315900_106443773	3300031787	Freshwater	KSMDDVLRYSDIIFSPDEMAMLGGIIGFWFGTRTWGRK
Ga0315900_110048551	3300031787	Freshwater	LPGVINNIDDVLKFADVVFSQDEMAMLGGIVGYWFGSRGWAKK
Ga0315909_1003610812	3300031857	Freshwater	PGVINNIDDVLKFADVVFSQDEMAMLGGIVGYWFGSRGWAKK
Ga0315909_106010543	3300031857	Freshwater	IDDLIRVSAIIFSDDEMAMLGGIIGFWFGSRSWQKK
Ga0315909_107924151	3300031857	Freshwater	GMIKSMDDVLRYSDIIFSPDEMAMLGGIIGFWFGTRTWGRK
Ga0315285_109003341	3300031885	Sediment	DDLIRLSDIIFSTDEMAMLGGIIGFWFGSRGWNKK
Ga0315904_100829371	3300031951	Freshwater	IKSMDDVLKYSDIIFSPDEMAMLGGIIGFWFGSRNWNKK
Ga0315904_106040983	3300031951	Freshwater	IQSIDDVIKYADLIFSSDEMAMLGGILGFWFGSRTWSKK
Ga0315904_107583781	3300031951	Freshwater	PGVITSIDDVIRFSDVVFSESEMSMLGGIIGYWFGSRGWSKK
Ga0315904_112306211	3300031951	Freshwater	RPSLVNNMDDLIRVTDVIFSSDEMAMLGGIIGFWFGSRSWAKK
Ga0315901_102987421	3300031963	Freshwater	DDVLRYSDIIFSPDEMAMLGGIIGFWFGTRTWGKK
Ga0315906_100848421	3300032050	Freshwater	SLVMSIEDLIRLSDIIFSTDEMAMLGGIIGFWFGSRSWSKK
Ga0315906_105503444	3300032050	Freshwater	SIDDVLKFSDVVFSQDEMAMLGGIIGYWFGSRGWAKK
Ga0315906_109865892	3300032050	Freshwater	LWQRPDLITGIDDVIRYSDIIFSSDEMAMLGGILGFWFGSRTWSKK
Ga0315902_108677121	3300032093	Freshwater	DDLIQVTDIIFSGDEMAMLGAIIGFWFGSRSWSKK
Ga0315903_107335641	3300032116	Freshwater	NNVDDLIRITTVIFSDDEMAMLGGILGFWFGSRSWSKK
Ga0316625_1015480182	3300033418	Soil	SNIDDVIKFSDVIFSESEMSMLGGIIGFWFGSRGWQKK
Ga0316627_1019195662	3300033482	Soil	IDDLVRVSTIIFSDDEMAMLGGIIGFWFGSRSWQKK
Ga0316621_111748872	3300033488	Soil	PHLVQNIDDLIRVSAIIFSDDEMAMLGGIIGFWFGSRSWQKK
Ga0334978_0196871_2_154	3300033979	Freshwater	LAFYVWQHPHLVQNIDDLIRVSTIIFSDDEMAMLGGIIGFWFGSRSWQKK
Ga0334982_0485686_374_484	3300033981	Freshwater	MEDLIRVSDIIFSTDEMAMLGGIIGFWFGSRSWSKK
Ga0334992_0497229_417_527	3300033992	Freshwater	MDDLIRVTDVIFSSDEMAMLGGIIGFWFGSRSWAKK
Ga0335003_0332121_539_649	3300033995	Freshwater	MDDLIRVSDIIFSTDEMAMLGGIIGFWFGSRGWNKK
Ga0334979_0687701_2_145	3300033996	Freshwater	YVYSRPSLVTNMDDLIRVTDIIFSSDEMAMLGGIIGFWFGSRSWAKK
Ga0334979_0752912_3_119	3300033996	Freshwater	TSIDDVLKYADLLFSADEMAMLGGIIGFWFGSRGWSKK
Ga0334986_0035009_2_121	3300034012	Freshwater	IKSMDDVLKYSDIIFSPDEMAMLSGILGFWFGSRTWSKK
Ga0334986_0039223_9_131	3300034012	Freshwater	MIKSMDDVLRYSDIIFSPDEMAMLGGIIGFWFGTRTWGKK
Ga0334986_0279042_2_130	3300034012	Freshwater	PHLVLNINDLVRVAEIIFSSDEMAMLGAIVGFWFGSRGWNKK
Ga0335028_0655132_3_113	3300034071	Freshwater	MDDIILYSDLIFSADEMAILGGILGYWFGSRTWSKK
Ga0310127_260902_476_586	3300034072	Fracking Water	MDDIVKFADVIFSSDEMAMLGGIIGFWFGSRNWQKR
Ga0335020_0611971_23_133	3300034082	Freshwater	MDDLIRLSDIIFSTDEMAMLGGIIGFWFGSRGWAKK
Ga0335027_0792704_2_109	3300034101	Freshwater	DDVIKYSDLIFSSDEMAMLGGIIGFWFGSRNWGKK
Ga0335029_0115726_3_113	3300034102	Freshwater	IDDVVKYSSLIFSSDEMAMLGGIIGFWFGSRQWSKK
Ga0335031_0747325_54_170	3300034104	Freshwater	MSMDDLIRVSDIIFSTDEMAMLGGSIGFWFGSRGWNKK
Ga0335036_0391759_767_895	3300034106	Freshwater	PGMIKSMDDVLRYSDIIFSPDEMAMLSGILGFWFGSRTWSKK
Ga0335036_0560293_574_684	3300034106	Freshwater	MDDVLRYTDIIFSPDEMAMLGGIIGFWFGSRGWSKK
Ga0335036_0567552_584_694	3300034106	Freshwater	NIDDLLRVTEVIFTDDEMAMLGGIIGFWFGSRSWKK
Ga0335037_0695582_19_129	3300034107	Freshwater	MYDLIQVTDIIFSSDEMAMLGAIIGFWFGSRSWSKK
Ga0335055_0416415_3_113	3300034110	Freshwater	MDDLIRVTDIIFSSDEMAMLGGIIGFWFGSRSWAKK
Ga0335066_0472080_561_668	3300034112	Freshwater	IDDLLRVTEVIFTDDEMAMLGGIIGFWFGSRSWKK
Ga0335066_0622189_430_552	3300034112	Freshwater	MIKSMDDVLKYSDIIFSPDEMAMLGGIIGFWFGSRNWAKK
Ga0335066_0635029_416_526	3300034112	Freshwater	MDDLIRLSDIIFSTDEMAMLGGIIGFWFGSRGWSKK
Ga0335016_0538443_514_624	3300034166	Freshwater	MDDVLRYSDIIFSPDEMAMLGGIIGFWFGTRTWGKK
Ga0335049_0066091_2526_2648	3300034272	Freshwater	LITSIDDVLRYADIIFSPDEMAILGGIIGFWFGSRNWSKK
Ga0335007_0683051_55_165	3300034283	Freshwater	MDDLIRLSDIIFSSDEMAMLGGIIGFWFGSRSWAKK
Ga0335039_0568044_32_142	3300034355	Freshwater	MEDLIKVAEIIFSDDEMAMLGGIIGFWFGSRSWNKK

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters