| Basic Information | |
|---|---|
| Family ID | F033031 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 178 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MDDLIRLSDIIFSTDEMAMLGGIIGFWFGSRGWSKK |
| Number of Associated Samples | 133 |
| Number of Associated Scaffolds | 178 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 1.14 % |
| % of genes near scaffold ends (potentially truncated) | 88.20 % |
| % of genes from short scaffolds (< 2000 bps) | 85.39 % |
| Associated GOLD sequencing projects | 126 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (45.506 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (17.977 % of family members) |
| Environment Ontology (ENVO) | Unclassified (47.753 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (43.820 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 45.31% β-sheet: 0.00% Coil/Unstructured: 54.69% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 178 Family Scaffolds |
|---|---|---|
| PF00959 | Phage_lysozyme | 86.52 |
| PF01541 | GIY-YIG | 3.93 |
| PF07460 | NUMOD3 | 1.69 |
| PF13392 | HNH_3 | 1.12 |
| PF13730 | HTH_36 | 0.56 |
| PF00622 | SPRY | 0.56 |
| PF07508 | Recombinase | 0.56 |
| PF00149 | Metallophos | 0.56 |
| PF13884 | Peptidase_S74 | 0.56 |
| PF12708 | Pectate_lyase_3 | 0.56 |
| PF03819 | MazG | 0.56 |
| PF03837 | RecT | 0.56 |
| PF09588 | YqaJ | 0.56 |
| PF10991 | DUF2815 | 0.56 |
| COG ID | Name | Functional Category | % Frequency in 178 Family Scaffolds |
|---|---|---|---|
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.56 |
| COG3723 | Recombinational DNA repair protein RecT | Replication, recombination and repair [L] | 0.56 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 54.49 % |
| Unclassified | root | N/A | 45.51 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002274|B570J29581_108093 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 643 | Open in IMG/M |
| 3300002408|B570J29032_109074576 | Not Available | 586 | Open in IMG/M |
| 3300003393|JGI25909J50240_1061388 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300003411|JGI25911J50253_10070990 | Not Available | 1127 | Open in IMG/M |
| 3300003412|JGI25912J50252_10130084 | Not Available | 588 | Open in IMG/M |
| 3300003497|JGI25925J51416_10158626 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 511 | Open in IMG/M |
| 3300004481|Ga0069718_15578940 | Not Available | 779 | Open in IMG/M |
| 3300004481|Ga0069718_15996498 | Not Available | 746 | Open in IMG/M |
| 3300005517|Ga0070374_10384259 | Not Available | 707 | Open in IMG/M |
| 3300005527|Ga0068876_10327833 | Not Available | 865 | Open in IMG/M |
| 3300005527|Ga0068876_10563685 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 620 | Open in IMG/M |
| 3300005528|Ga0068872_10288586 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
| 3300005581|Ga0049081_10165138 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 805 | Open in IMG/M |
| 3300005582|Ga0049080_10183200 | Not Available | 695 | Open in IMG/M |
| 3300006484|Ga0070744_10133039 | Not Available | 715 | Open in IMG/M |
| 3300006802|Ga0070749_10034630 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3127 | Open in IMG/M |
| 3300006803|Ga0075467_10648664 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 538 | Open in IMG/M |
| 3300007171|Ga0102977_1081451 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2433 | Open in IMG/M |
| 3300007538|Ga0099851_1074273 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1314 | Open in IMG/M |
| 3300007538|Ga0099851_1295433 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 572 | Open in IMG/M |
| 3300007549|Ga0102879_1120950 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 808 | Open in IMG/M |
| 3300007622|Ga0102863_1243051 | Not Available | 528 | Open in IMG/M |
| 3300007629|Ga0102895_1074591 | Not Available | 873 | Open in IMG/M |
| 3300007640|Ga0070751_1391146 | Not Available | 502 | Open in IMG/M |
| 3300007653|Ga0102868_1188708 | Not Available | 503 | Open in IMG/M |
| 3300007973|Ga0105746_1314987 | Not Available | 543 | Open in IMG/M |
| 3300008107|Ga0114340_1240230 | Not Available | 563 | Open in IMG/M |
| 3300008108|Ga0114341_10248725 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 959 | Open in IMG/M |
| 3300008116|Ga0114350_1019067 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7326 | Open in IMG/M |
| 3300008261|Ga0114336_1004587 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 16067 | Open in IMG/M |
| 3300008265|Ga0114361_1099773 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1310 | Open in IMG/M |
| 3300008266|Ga0114363_1033319 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2156 | Open in IMG/M |
| 3300008266|Ga0114363_1130415 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 860 | Open in IMG/M |
| 3300008266|Ga0114363_1159815 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 738 | Open in IMG/M |
| 3300008448|Ga0114876_1129736 | Not Available | 953 | Open in IMG/M |
| 3300008448|Ga0114876_1158698 | Not Available | 815 | Open in IMG/M |
| 3300008450|Ga0114880_1104673 | All Organisms → Viruses → Predicted Viral | 1088 | Open in IMG/M |
| 3300008450|Ga0114880_1167881 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 771 | Open in IMG/M |
| 3300008996|Ga0102831_1099800 | Not Available | 967 | Open in IMG/M |
| 3300009075|Ga0105090_10949089 | Not Available | 524 | Open in IMG/M |
| 3300009086|Ga0102812_10759811 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 536 | Open in IMG/M |
| 3300009152|Ga0114980_10404654 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Podoviridae sp. ctwJH20 | 782 | Open in IMG/M |
| 3300009165|Ga0105102_10267524 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
| 3300009165|Ga0105102_10546746 | Not Available | 634 | Open in IMG/M |
| 3300009165|Ga0105102_10745876 | Not Available | 553 | Open in IMG/M |
| 3300009168|Ga0105104_10771635 | Not Available | 557 | Open in IMG/M |
| 3300009170|Ga0105096_10191904 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1032 | Open in IMG/M |
| 3300009181|Ga0114969_10299312 | Not Available | 949 | Open in IMG/M |
| 3300009426|Ga0115547_1244328 | Not Available | 561 | Open in IMG/M |
| 3300010354|Ga0129333_10095821 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2742 | Open in IMG/M |
| 3300010354|Ga0129333_10555095 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Podoviridae sp. ctwJH20 | 1001 | Open in IMG/M |
| 3300010354|Ga0129333_10784770 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Podoviridae sp. ctwJH20 | 813 | Open in IMG/M |
| 3300010370|Ga0129336_10030519 | Not Available | 3262 | Open in IMG/M |
| 3300010370|Ga0129336_10079690 | All Organisms → Viruses → Predicted Viral | 1933 | Open in IMG/M |
| 3300010370|Ga0129336_10206406 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1116 | Open in IMG/M |
| 3300010370|Ga0129336_10699160 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 537 | Open in IMG/M |
| 3300011184|Ga0136709_1008942 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1426 | Open in IMG/M |
| 3300012665|Ga0157210_1039899 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 725 | Open in IMG/M |
| 3300012665|Ga0157210_1071710 | Not Available | 522 | Open in IMG/M |
| 3300013004|Ga0164293_10914901 | Not Available | 551 | Open in IMG/M |
| 3300013005|Ga0164292_10837182 | Not Available | 580 | Open in IMG/M |
| (restricted) 3300013131|Ga0172373_10492099 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 748 | Open in IMG/M |
| 3300014258|Ga0075315_1081549 | Not Available | 589 | Open in IMG/M |
| 3300014711|Ga0134314_113539 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 539 | Open in IMG/M |
| (restricted) 3300014720|Ga0172376_10150264 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1554 | Open in IMG/M |
| (restricted) 3300014720|Ga0172376_10431507 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 751 | Open in IMG/M |
| 3300017716|Ga0181350_1008915 | Not Available | 2880 | Open in IMG/M |
| 3300017723|Ga0181362_1098264 | Not Available | 583 | Open in IMG/M |
| 3300017736|Ga0181365_1076504 | Not Available | 822 | Open in IMG/M |
| 3300017747|Ga0181352_1053665 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1168 | Open in IMG/M |
| 3300017747|Ga0181352_1196012 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 520 | Open in IMG/M |
| 3300017754|Ga0181344_1113431 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 783 | Open in IMG/M |
| 3300017754|Ga0181344_1136289 | Not Available | 703 | Open in IMG/M |
| 3300017761|Ga0181356_1206942 | Not Available | 578 | Open in IMG/M |
| 3300017774|Ga0181358_1060011 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Moraxella → Moraxella osloensis | 1421 | Open in IMG/M |
| 3300017774|Ga0181358_1145377 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 814 | Open in IMG/M |
| 3300017777|Ga0181357_1000425 | All Organisms → cellular organisms → Bacteria | 15712 | Open in IMG/M |
| 3300017780|Ga0181346_1242892 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 632 | Open in IMG/M |
| 3300017785|Ga0181355_1087065 | All Organisms → Viruses → Predicted Viral | 1301 | Open in IMG/M |
| 3300017785|Ga0181355_1115057 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1104 | Open in IMG/M |
| 3300020048|Ga0207193_1132241 | Not Available | 2153 | Open in IMG/M |
| 3300020159|Ga0211734_10052601 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1018 | Open in IMG/M |
| 3300020162|Ga0211735_10935875 | Not Available | 645 | Open in IMG/M |
| 3300020172|Ga0211729_11089286 | All Organisms → Viruses → Predicted Viral | 2181 | Open in IMG/M |
| 3300020498|Ga0208050_1032712 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 511 | Open in IMG/M |
| 3300020536|Ga0207939_1037762 | Not Available | 615 | Open in IMG/M |
| 3300020550|Ga0208600_1035386 | Not Available | 773 | Open in IMG/M |
| 3300020551|Ga0208360_1048874 | Not Available | 533 | Open in IMG/M |
| 3300021960|Ga0222715_10478074 | Not Available | 665 | Open in IMG/M |
| 3300021962|Ga0222713_10427423 | Not Available | 809 | Open in IMG/M |
| 3300021962|Ga0222713_10501394 | Not Available | 726 | Open in IMG/M |
| 3300022179|Ga0181353_1023506 | Not Available | 1626 | Open in IMG/M |
| 3300022190|Ga0181354_1143844 | Not Available | 751 | Open in IMG/M |
| 3300022407|Ga0181351_1074494 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1367 | Open in IMG/M |
| 3300023174|Ga0214921_10298653 | Not Available | 899 | Open in IMG/M |
| 3300024346|Ga0244775_10039628 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4155 | Open in IMG/M |
| 3300024503|Ga0255152_1032743 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 964 | Open in IMG/M |
| 3300025091|Ga0209616_1007671 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1195 | Open in IMG/M |
| 3300025635|Ga0208147_1107337 | Not Available | 673 | Open in IMG/M |
| 3300025756|Ga0255239_1036586 | Not Available | 774 | Open in IMG/M |
| 3300025889|Ga0208644_1304870 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 631 | Open in IMG/M |
| 3300026473|Ga0255166_1032111 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1087 | Open in IMG/M |
| 3300026473|Ga0255166_1096093 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 537 | Open in IMG/M |
| 3300026478|Ga0255156_1094095 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 526 | Open in IMG/M |
| 3300026566|Ga0256334_1143883 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 541 | Open in IMG/M |
| 3300027365|Ga0209300_1003896 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5106 | Open in IMG/M |
| 3300027396|Ga0255146_1106882 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 573 | Open in IMG/M |
| 3300027597|Ga0255088_1100048 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 533 | Open in IMG/M |
| 3300027608|Ga0208974_1105802 | Not Available | 747 | Open in IMG/M |
| 3300027608|Ga0208974_1185548 | Not Available | 510 | Open in IMG/M |
| 3300027631|Ga0208133_1083837 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 749 | Open in IMG/M |
| 3300027710|Ga0209599_10145183 | Not Available | 631 | Open in IMG/M |
| 3300027743|Ga0209593_10094266 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1106 | Open in IMG/M |
| 3300027772|Ga0209768_10002101 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12466 | Open in IMG/M |
| 3300027804|Ga0209358_10059864 | Not Available | 2219 | Open in IMG/M |
| 3300027805|Ga0209229_10305158 | Not Available | 701 | Open in IMG/M |
| 3300027805|Ga0209229_10394684 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 601 | Open in IMG/M |
| 3300027808|Ga0209354_10437781 | Not Available | 504 | Open in IMG/M |
| 3300027899|Ga0209668_10696456 | Not Available | 682 | Open in IMG/M |
| 3300027917|Ga0209536_101632750 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 782 | Open in IMG/M |
| 3300028025|Ga0247723_1009900 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3775 | Open in IMG/M |
| 3300028025|Ga0247723_1133872 | Not Available | 594 | Open in IMG/M |
| 3300031707|Ga0315291_10566119 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1038 | Open in IMG/M |
| 3300031758|Ga0315907_10343037 | Not Available | 1217 | Open in IMG/M |
| 3300031758|Ga0315907_11023725 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 594 | Open in IMG/M |
| 3300031758|Ga0315907_11153547 | Not Available | 546 | Open in IMG/M |
| 3300031758|Ga0315907_11281822 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 507 | Open in IMG/M |
| 3300031784|Ga0315899_11661746 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 527 | Open in IMG/M |
| 3300031787|Ga0315900_10004466 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 19703 | Open in IMG/M |
| 3300031787|Ga0315900_10644377 | Not Available | 763 | Open in IMG/M |
| 3300031787|Ga0315900_11004855 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 548 | Open in IMG/M |
| 3300031857|Ga0315909_10036108 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4726 | Open in IMG/M |
| 3300031857|Ga0315909_10601054 | Not Available | 735 | Open in IMG/M |
| 3300031857|Ga0315909_10792415 | Not Available | 600 | Open in IMG/M |
| 3300031885|Ga0315285_10900334 | Not Available | 541 | Open in IMG/M |
| 3300031951|Ga0315904_10082937 | Not Available | 3425 | Open in IMG/M |
| 3300031951|Ga0315904_10604098 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 943 | Open in IMG/M |
| 3300031951|Ga0315904_10758378 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 805 | Open in IMG/M |
| 3300031951|Ga0315904_11230621 | Not Available | 572 | Open in IMG/M |
| 3300031963|Ga0315901_10298742 | All Organisms → Viruses → Predicted Viral | 1335 | Open in IMG/M |
| 3300032050|Ga0315906_10084842 | All Organisms → Viruses → Predicted Viral | 3184 | Open in IMG/M |
| 3300032050|Ga0315906_10550344 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio cincinnatiensis | 963 | Open in IMG/M |
| 3300032050|Ga0315906_10986589 | Not Available | 635 | Open in IMG/M |
| 3300032093|Ga0315902_10867712 | Not Available | 700 | Open in IMG/M |
| 3300032116|Ga0315903_10733564 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Podoviridae sp. ctwJH20 | 733 | Open in IMG/M |
| 3300033418|Ga0316625_101548018 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 630 | Open in IMG/M |
| 3300033482|Ga0316627_101919566 | Not Available | 612 | Open in IMG/M |
| 3300033488|Ga0316621_11174887 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 579 | Open in IMG/M |
| 3300033979|Ga0334978_0196871 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 990 | Open in IMG/M |
| 3300033981|Ga0334982_0485686 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 548 | Open in IMG/M |
| 3300033992|Ga0334992_0497229 | Not Available | 529 | Open in IMG/M |
| 3300033995|Ga0335003_0332121 | Not Available | 672 | Open in IMG/M |
| 3300033996|Ga0334979_0687701 | Not Available | 535 | Open in IMG/M |
| 3300033996|Ga0334979_0752912 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 505 | Open in IMG/M |
| 3300034012|Ga0334986_0035009 | All Organisms → Viruses → Predicted Viral | 3290 | Open in IMG/M |
| 3300034012|Ga0334986_0039223 | All Organisms → Viruses → Predicted Viral | 3075 | Open in IMG/M |
| 3300034012|Ga0334986_0279042 | Not Available | 895 | Open in IMG/M |
| 3300034071|Ga0335028_0655132 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Podoviridae sp. ctwJH20 | 556 | Open in IMG/M |
| 3300034072|Ga0310127_260902 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 610 | Open in IMG/M |
| 3300034082|Ga0335020_0611971 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 508 | Open in IMG/M |
| 3300034101|Ga0335027_0792704 | Not Available | 550 | Open in IMG/M |
| 3300034102|Ga0335029_0115726 | All Organisms → cellular organisms → Bacteria | 1874 | Open in IMG/M |
| 3300034104|Ga0335031_0747325 | Not Available | 555 | Open in IMG/M |
| 3300034106|Ga0335036_0391759 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Podoviridae sp. ctwJH20 | 895 | Open in IMG/M |
| 3300034106|Ga0335036_0560293 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 701 | Open in IMG/M |
| 3300034106|Ga0335036_0567552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → unclassified Methylococcaceae → Methylococcaceae bacterium | 694 | Open in IMG/M |
| 3300034107|Ga0335037_0695582 | Not Available | 531 | Open in IMG/M |
| 3300034110|Ga0335055_0416415 | Not Available | 552 | Open in IMG/M |
| 3300034112|Ga0335066_0472080 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → unclassified Methylococcaceae → Methylococcaceae bacterium | 670 | Open in IMG/M |
| 3300034112|Ga0335066_0622189 | Not Available | 555 | Open in IMG/M |
| 3300034112|Ga0335066_0635029 | Not Available | 548 | Open in IMG/M |
| 3300034166|Ga0335016_0538443 | Not Available | 649 | Open in IMG/M |
| 3300034272|Ga0335049_0066091 | Not Available | 2666 | Open in IMG/M |
| 3300034283|Ga0335007_0683051 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 578 | Open in IMG/M |
| 3300034355|Ga0335039_0568044 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 560 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 17.98% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 16.29% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 11.80% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 5.06% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 4.49% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 4.49% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 3.93% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 3.93% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 3.37% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 2.25% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 2.25% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.25% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.69% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.69% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.69% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.69% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 1.12% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.12% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 1.12% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.12% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.12% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.12% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 1.12% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 1.12% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 1.12% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 0.56% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.56% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.56% |
| Surface Water | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Surface Water | 0.56% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 0.56% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.56% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 0.56% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.56% |
| Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 0.56% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002274 | Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
| 3300003411 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD | Environmental | Open in IMG/M |
| 3300003412 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD | Environmental | Open in IMG/M |
| 3300003497 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN | Environmental | Open in IMG/M |
| 3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007171 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface layer) 8 sequencing projects | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007549 | Estuarine microbial communities from the Columbia River estuary - metaG 1548B-02 | Environmental | Open in IMG/M |
| 3300007622 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02 | Environmental | Open in IMG/M |
| 3300007629 | Estuarine microbial communities from the Columbia River estuary - metaG 1554B-3 | Environmental | Open in IMG/M |
| 3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
| 3300007653 | Estuarine microbial communities from the Columbia River estuary - metaG 1546C-3 | Environmental | Open in IMG/M |
| 3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
| 3300008265 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0126-100-LTR | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008996 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 | Environmental | Open in IMG/M |
| 3300009075 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
| 3300009086 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009170 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009426 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100420 | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300011184 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA - Floc-Cal metaG | Environmental | Open in IMG/M |
| 3300012665 | Freshwater microbial communities from Talbot River, Ontario, Canada - S11 | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
| 3300014258 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleA_D1 | Environmental | Open in IMG/M |
| 3300014711 | Surface water microbial communities from Bangladesh - BaraHaldiaSW0111 | Environmental | Open in IMG/M |
| 3300014720 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m | Environmental | Open in IMG/M |
| 3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
| 3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300019781 | Freshwater viral communities from Lake Michigan, USA - Sp13.ND.MM15.S.D | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020498 | Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020536 | Freshwater microbial communities from Lake Mendota, WI - 02JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020550 | Freshwater microbial communities from Lake Mendota, WI - 08OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020551 | Freshwater microbial communities from Lake Mendota, WI - 27JUL2010 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024503 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8h | Environmental | Open in IMG/M |
| 3300025091 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA - Floc-Cal metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025635 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025756 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300026473 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_8d | Environmental | Open in IMG/M |
| 3300026478 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8h | Environmental | Open in IMG/M |
| 3300026566 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027365 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT (SPAdes) | Environmental | Open in IMG/M |
| 3300027396 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_8h | Environmental | Open in IMG/M |
| 3300027597 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepB_8d | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
| 3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
| 3300027743 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027772 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027804 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
| 3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031885 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
| 3300033488 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D1_C | Environmental | Open in IMG/M |
| 3300033979 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME30Aug2017-rr0003 | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300033992 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035 | Environmental | Open in IMG/M |
| 3300033995 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
| 3300034071 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110 | Environmental | Open in IMG/M |
| 3300034072 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-3-A | Environmental | Open in IMG/M |
| 3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034107 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Apr2017-rr0133 | Environmental | Open in IMG/M |
| 3300034110 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Jun2009D10-rr0171 | Environmental | Open in IMG/M |
| 3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
| 3300034166 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Sep2012-rr0079 | Environmental | Open in IMG/M |
| 3300034272 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156 | Environmental | Open in IMG/M |
| 3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
| 3300034355 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Oct2015-rr0135 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| B570J29581_1080931 | 3300002274 | Freshwater | PSLVNNMDDLIRVTDVIFSSDEMAMLGGIIGFWFGSRSWAKK* |
| B570J29032_1090745761 | 3300002408 | Freshwater | ELIALSDIIFSTDEMAMLGGIIGFWFGSRSWAKK* |
| JGI25909J50240_10613882 | 3300003393 | Freshwater Lake | VSNMDDLIRITDIIFSADEMAMLGGIIGFWFGSRSWSKK* |
| JGI25911J50253_100709902 | 3300003411 | Freshwater Lake | VVNNMDDLIRVTDVIFSADEMAMLGGIIGFWFGSRSWSKK* |
| JGI25912J50252_101300842 | 3300003412 | Freshwater Lake | PNLVSSMDDLIRITDILFSADEMAMLGGIIGFWFGSRSWSKK* |
| JGI25925J51416_101586261 | 3300003497 | Freshwater Lake | SLVNNMDDLIRVTDVIFSSDEMAMLGGIIGFWFGSRSWAKK* |
| Ga0069718_155789402 | 3300004481 | Sediment | WYNEKLITNLEELVKFSDIIFSTDEMAMLGGIIGFWFGSRGWSKK* |
| Ga0069718_159964981 | 3300004481 | Sediment | GLITNMDDVLRYADIIFSPDEMAMLGGIIGFWFGSRNWSKK* |
| Ga0070374_103842591 | 3300005517 | Freshwater Lake | VQNIDDLIRLSEIIFSTDEMAMLGGIIGFWFGSRGWAKK* |
| Ga0068876_103278331 | 3300005527 | Freshwater Lake | MDDLIRLSDIIFSTDEMAMLGGIIGFWFGSRGWSKK* |
| Ga0068876_105636851 | 3300005527 | Freshwater Lake | HPGLINSVEDVIRYSELVFSSDEMSMLGGIIGFWFGSRGWAKK* |
| Ga0068872_102885863 | 3300005528 | Freshwater Lake | DVIRYSELVFSSDEMSMLGGIIGFWFGSRGWAKK* |
| Ga0049081_101651384 | 3300005581 | Freshwater Lentic | GVITSIDDVLKFSDVVFSQDEMAMLGGIIGYWFGSRGWAKK* |
| Ga0049080_101832002 | 3300005582 | Freshwater Lentic | DDLIRLSDIIFSTDEMAMLGGIIGFWFGSRGWSKK* |
| Ga0070744_101330391 | 3300006484 | Estuarine | IYTRPSLVQNMDDLIRLSDIIFSSDEMAMLGGIIGFWFGSRGWNKK* |
| Ga0070749_100346301 | 3300006802 | Aqueous | IDDVIRYADIVFSSDEMAMLGRIIGYWFGSRGWRKK* |
| Ga0075467_106486642 | 3300006803 | Aqueous | VSGMDDVLRYADIIFSPDEMAMLGGIIGFWFGSRNWGKK* |
| Ga0102977_10814511 | 3300007171 | Freshwater Lake | IQNIDDVLKYADIVFSSDEMAMLGGIIGFWFGSRGWSKK* |
| Ga0099851_10742734 | 3300007538 | Aqueous | QNIDDLIRVSAIIFSDDEMAMLGGIIGFWFGSRSWQKK* |
| Ga0099851_12954332 | 3300007538 | Aqueous | LIMSIEDLIRLSDIIFSTDEMAMLGGIIGFWFGSRNWKK* |
| Ga0102879_11209501 | 3300007549 | Estuarine | TNMDDLIRVSDIIFSGDEMAMLGAIIGFWFGSRSWSKK* |
| Ga0102863_12430512 | 3300007622 | Estuarine | SRPSLVTSMDDLIRVSDIIFSSDEMAMLGGIIGFWFGSRGWAKK* |
| Ga0102895_10745911 | 3300007629 | Estuarine | TNMDDLIRVTDIIFSSDEMAMLGGIIGFWFGSRSWSKK* |
| Ga0070751_13911462 | 3300007640 | Aqueous | FTHPNLIQNIDDVIRFSEIIFSSDEMAMLGGIIGFWFGSRSWQRK* |
| Ga0102868_11887082 | 3300007653 | Estuarine | YVYSRPSLVNNMDDLIRVTDIIFSSDEMAMLGAIIGFWFGSRSWSKK* |
| Ga0105746_13149872 | 3300007973 | Estuary Water | YTNPGMIKSMDDVLKYSDIIFSPDEMAMLGGIIGFWFGSRNWNKK* |
| Ga0114340_12402302 | 3300008107 | Freshwater, Plankton | VTSMDDLIQVTDIIFSGDEMAMLGAIIGFWFGSRSWSKK* |
| Ga0114341_102487251 | 3300008108 | Freshwater, Plankton | SMEDLIRLSDIIFSTDEMAMLGGIIGFWFGSRSWSKK* |
| Ga0114341_103106101 | 3300008108 | Freshwater, Plankton | IFSLPGVITSIDDVIRFSDVVFSESEMSMLGGIIGYWFGSRGWSKK* |
| Ga0114350_10190674 | 3300008116 | Freshwater, Plankton | MDDVLKYSDIIFSPDEMAMLSGILGFWFGSRTWSKK* |
| Ga0114336_10045878 | 3300008261 | Freshwater, Plankton | MSMEDLIRLSDIIFSTDEMAMLGGIIGFWFGSRSWSKK* |
| Ga0114361_10997734 | 3300008265 | Freshwater, Plankton | SRPSLVNNMDDLIRVTDVIFSSDEMAMLGGIIGFWFGSRSWAKK* |
| Ga0114363_10333191 | 3300008266 | Freshwater, Plankton | PGVINNIDDVLKFADVVFSQDEMAMLGGIVGYWFGSRGWAKK* |
| Ga0114363_11304153 | 3300008266 | Freshwater, Plankton | SIDDVIKFSDVVFSEDEMAMLGGIIGYWFGSRGWSKK* |
| Ga0114363_11598152 | 3300008266 | Freshwater, Plankton | SNHPELITSIDNLIAVSDIIFSSDEMAMLGGIIGFWFGSRSWSKK* |
| Ga0114876_11297363 | 3300008448 | Freshwater Lake | LPGVITSIDDVIKFSDVVFSEDEMAMLGGIIGYWFGSRGWSKK* |
| Ga0114876_11586983 | 3300008448 | Freshwater Lake | MDDLIRLSDIIFSSDEMAMLGGIIGFWFGSRGWAKK* |
| Ga0114880_11046731 | 3300008450 | Freshwater Lake | SLVTNMEDLIRLTDILFSADEMAMLGGIIGFWFGSRSWAKK* |
| Ga0114880_11678812 | 3300008450 | Freshwater Lake | IDNLIAVSDIIFSSDEMAMLGGIIGFWFGSRSWSKK* |
| Ga0102831_10998003 | 3300008996 | Estuarine | YSRPSLVTSMDDLIRVSDIIFSSDEMAMLGGIIGFWFGSRSWSKK* |
| Ga0105090_109490892 | 3300009075 | Freshwater Sediment | PHLVASVGDVEKVAELIFSSDEMAMLGGIIGFWFGSRGWAKK* |
| Ga0102812_107598112 | 3300009086 | Estuarine | YSRPSLVTNMDDLIRVSDVIFSSDEMAMLGGIIGFWFGSRSWSKK* |
| Ga0114980_104046543 | 3300009152 | Freshwater Lake | RPSLVTSMDDLIRVSDIIFSTDEMAMLGAVIGYWFGSRSWNKK* |
| Ga0105102_102675243 | 3300009165 | Freshwater Sediment | TVDDFIRASDLIFSSEELSMLGAIIGYWFGSRGWSKK* |
| Ga0105102_105467462 | 3300009165 | Freshwater Sediment | PGMISSMDDVLRYADIIFSPDEMAMLGGIIGFWFGSRNWSKK* |
| Ga0105102_107458761 | 3300009165 | Freshwater Sediment | LWQNPGLITSMDDVLRYADIIFSPDEMAMLGGIIGFWFGSRNWSKK* |
| Ga0105104_107716351 | 3300009168 | Freshwater Sediment | MDDVLRYADIIFSPDEMAMLGGIIGFWFGSRNWSKK* |
| Ga0105097_103411341 | 3300009169 | Freshwater Sediment | DLEIIGEMIFSSDEMAMLGGIIGFWFGSRNWDKKK* |
| Ga0105096_101919041 | 3300009170 | Freshwater Sediment | LWSNPGLITSMDDVLRYADIIFSPDEMAMLGGIIGFWFGSRNWSKK* |
| Ga0114969_102993121 | 3300009181 | Freshwater Lake | SLVTSMDDLIRVSDIIFSSDEMAMLGGIIGFWFGSRSWAKK* |
| Ga0115547_12443282 | 3300009426 | Pelagic Marine | SRPNLVMSMEDLIRLSDIIFSTDEMAMLGGIIGFWFGSRSWSKK* |
| Ga0129333_100958211 | 3300010354 | Freshwater To Marine Saline Gradient | LIKSVDDIIKYSELIFSSDEMAMLGGIIGFWFGSRQWGKK* |
| Ga0129333_105550953 | 3300010354 | Freshwater To Marine Saline Gradient | FTHPSLIQNIDDLLRVTEVIFTDDEMAMLGAVIGYWFGSRSWSKK* |
| Ga0129333_107847701 | 3300010354 | Freshwater To Marine Saline Gradient | SMDDVLKYSDIIFSPDEMAMLSGILGFWFGSRTWSKK* |
| Ga0129336_100305191 | 3300010370 | Freshwater To Marine Saline Gradient | MDDIILYSDLIFSADEMAILGGIIGYWFGSRQWSKK* |
| Ga0129336_100796901 | 3300010370 | Freshwater To Marine Saline Gradient | IDDVIKFADVVFSESEMSMLGGIIGFWFGSRGWSKK* |
| Ga0129336_102064063 | 3300010370 | Freshwater To Marine Saline Gradient | ELIKSVDDIIKYSDLIFSSDEMAMLGGIIGFWFGSRQWGKK* |
| Ga0129336_106991602 | 3300010370 | Freshwater To Marine Saline Gradient | SLPGVINNIDDVLKFADVVFSEDEMAMLGGIVGYWFGSRGWAKK* |
| Ga0136709_10089424 | 3300011184 | Freshwater | IYTRPTLVQNMDDLIRLSDIIFSSDEMAMLGGIIGFWFGSRGWNKK* |
| Ga0157210_10398991 | 3300012665 | Freshwater | NMDDLIRVSEIIFSTDEMAMLGGIIGFWFGSRSWSKK* |
| Ga0157210_10717102 | 3300012665 | Freshwater | ALVTSMDDLVRLTDILFSTDEMAMLGGIIGFWFGSRSWSKK* |
| Ga0164293_109149012 | 3300013004 | Freshwater | SIDDVIRYSDLIFSSDEMAMLGGIIGFWFGSRQWSKK* |
| Ga0164292_108371822 | 3300013005 | Freshwater | YVYLNPHLVLNMGDLISLSDIIFSSDEMAMLGGIIGFWFGSRSWAKK* |
| (restricted) Ga0172373_104920991 | 3300013131 | Freshwater | IDDVIKFSDVVFSQDEMAMLGGIIGYWFGSRGWAKK* |
| Ga0075315_10815491 | 3300014258 | Natural And Restored Wetlands | EEMSAASDVIFSSDEMAMLGGIIGFWFGSRNWQKK* |
| Ga0134314_1135391 | 3300014711 | Surface Water | IDTLIKFSDIIFSEDEMSMLGGIIGFWFGSRGWSKK* |
| (restricted) Ga0172376_101502641 | 3300014720 | Freshwater | NIDDLIRVSAIIFSEDEMAMLGGIIGFWFGSRSWQKK* |
| (restricted) Ga0172376_104315072 | 3300014720 | Freshwater | IDDVLKFADVVFSEDEMAMLGGIVGYWFGSRGWAKK* |
| Ga0181350_10089151 | 3300017716 | Freshwater Lake | NNMDDLIRVTDVIFSSDEMAMLGGIIGFWFGSRSWAKK |
| Ga0181362_10982641 | 3300017723 | Freshwater Lake | QNIDDLIRLSEIIFSTDEMAMLGGIIGFWFGSRGWAKK |
| Ga0181365_10765043 | 3300017736 | Freshwater Lake | RPTLVMSIEDLIRLSDIIFSTDEMAMLGGIIGFWFGSRSWSKK |
| Ga0181352_10536651 | 3300017747 | Freshwater Lake | TNPGMIKSMDEVLRYSDIIFSPDEMAMLGGILGFWFGTRTWSKK |
| Ga0181352_11960121 | 3300017747 | Freshwater Lake | NLVTSMDDLTRLTDVLFSADETAMLGGIIGFWFGTRSWGKK |
| Ga0181344_11134313 | 3300017754 | Freshwater Lake | LFNHGTLITNVDDFLKATDMIFSEDEMAMLGAIIGYWFGSRGWSKK |
| Ga0181344_11362892 | 3300017754 | Freshwater Lake | IIKDIDSLIAITDVLFSSDEMAMLGGIIGFWFGSRSWAKK |
| Ga0181356_12069421 | 3300017761 | Freshwater Lake | NMDDLIRLSEIIFSTDEMAMLGGIIGFWFGSRGWAKK |
| Ga0181358_10600114 | 3300017774 | Freshwater Lake | RPSLVMSMDDLIRLSDIIFSTDEMAMLGGIIGFWFGSRGWSKK |
| Ga0181358_11453773 | 3300017774 | Freshwater Lake | DDLIRLSEIIFSTDEMAMLGGIIGFWFGSRGWAKK |
| Ga0181357_10004251 | 3300017777 | Freshwater Lake | SIDDIIRYSDLIFSADEMAMLGGIIGFWFGSRQWSKK |
| Ga0181346_12428921 | 3300017780 | Freshwater Lake | PNLIQNMDDVLRYTDIIFSPDEMAMLGGIIGFWFGSRGWSKK |
| Ga0181355_10870651 | 3300017785 | Freshwater Lake | SVGDLEKVAELIFSSDEMAMLGGIIGFWFGSRGWAKK |
| Ga0181355_11150571 | 3300017785 | Freshwater Lake | GMIKSMDDVLKYSDIIFSPDEMSMLGAIIGFWFGTRTWGKK |
| Ga0181360_1078981 | 3300019781 | Freshwater Lake | VSDLDVIGELIFSSDEMAMLGGIVGFWFGSRNWDKKK |
| Ga0207193_11322414 | 3300020048 | Freshwater Lake Sediment | VQNVDDLIKYASIIFSDDEMAMLGGIIGFWFGSRNWSKK |
| Ga0211734_100526013 | 3300020159 | Freshwater | MSMDDLIRLSDLIFSADEMAMLGGILGFWFGSRTWSKK |
| Ga0211735_109358751 | 3300020162 | Freshwater | IDDLIRLSDIIFSTDEMAMLGGIIGFWFGSRGWSKK |
| Ga0211729_110892865 | 3300020172 | Freshwater | MDDLIRLSDIIFSTDEMAMLGGIIGFWFGSRGWNKK |
| Ga0208050_10327122 | 3300020498 | Freshwater | MIKSMDDVLRYSDIIFSPDEMSMLGAIIGFWFGTRTWGKK |
| Ga0207939_10377622 | 3300020536 | Freshwater | WNHPNLIQSMDDIIQYADLIFSADEMAILGGILGYWFGSRTWSKK |
| Ga0208600_10353863 | 3300020550 | Freshwater | QSIDDVIRYSDLIFSADEMAMLGGIIGFWFGSRGWSKK |
| Ga0208360_10488741 | 3300020551 | Freshwater | PGMIKSMDDVLRYSDIIFSPDEMAMLGGIIGFWFGSRNWNKK |
| Ga0222715_104780741 | 3300021960 | Estuarine Water | SLVTNMEDLIRLTDILFSADEMAMLGGIIGFWFGSRSWSKK |
| Ga0222713_104274233 | 3300021962 | Estuarine Water | MDDVLKYADIIFSPDEMAMLGGIIGFWFGSRNWGKK |
| Ga0222713_105013941 | 3300021962 | Estuarine Water | VWYNEKLITNLEDLVRFSDIIFSTDEMAMLGGIIGFWFGSRGWSKK |
| Ga0181353_10235061 | 3300022179 | Freshwater Lake | DMDDLIRVSEIIFSTDEMAMLGGIIGFWFGSRSWSKK |
| Ga0181354_11438441 | 3300022190 | Freshwater Lake | RTGMITSIDDIVKYSDLIFSSDEMAMLGGIIGFWFGSRQWSKK |
| Ga0181351_10744941 | 3300022407 | Freshwater Lake | IDDIIRYSDLIFSADEMAMLGGIIGFWFGSRQWSKK |
| Ga0214921_102986531 | 3300023174 | Freshwater | MDDLIKVTDIIFSSDEMAMLGGIIGFWFGSRSWSKK |
| Ga0244775_1003962810 | 3300024346 | Estuarine | NNMDDLIRVTDIIFSGDEMAMLGGIIGFWFGSRSWSKK |
| Ga0255152_10327431 | 3300024503 | Freshwater | NVLNNIDDVIKFADVVFSESEMSMLGGIIGFWFGSRGWSKK |
| Ga0209616_10076713 | 3300025091 | Freshwater | IYTRPTLVQNMDDLIRLSDIIFSSDEMAMLGGIIGFWFGSRGWNKK |
| Ga0208147_11073371 | 3300025635 | Aqueous | VDDVVKYSEIIFSPDEMSMLGGIIGFWFGSRNWSKK |
| Ga0255239_10365861 | 3300025756 | Freshwater | DDIIKYSDLIFSSDEMAMLGGIIGFWFGSRQWGKK |
| Ga0208644_13048702 | 3300025889 | Aqueous | IDSLIKVTDVVFNEDEMAMLGGIIGFWFGSRSWSKKK |
| Ga0255166_10321114 | 3300026473 | Freshwater | HMPHLVASTGDLEKVAELIFSSDEMAMLGGIIGFWFGSRGWSKK |
| Ga0255166_10960931 | 3300026473 | Freshwater | TIPSLVSSVGDLERVSELIFSSDEMAMLGGIIGFWFGSRGWQKK |
| Ga0255156_10940951 | 3300026478 | Freshwater | NVDDFIKATDMIFSEDEMAMLGAIIGYWFGSRGWSKK |
| Ga0256334_11438831 | 3300026566 | Freshwater | QTLIEFSDVIFSAEEMSMLGGIIGFWFGSRGWAKK |
| Ga0209300_10038966 | 3300027365 | Deep Subsurface | HPGLITNIDDVIKYADLIFSADEMAMLGGIIGFWFGSRGWSKK |
| Ga0255146_11068822 | 3300027396 | Freshwater | PALIVDVQTLIEFSDVIFSAEEMSMLGGIIGFWFGSRGWAKK |
| Ga0255088_11000481 | 3300027597 | Freshwater | KSIDDVVRYSELIFSSDEMSMLGGIIGFWFGSRGFKK |
| Ga0208974_11058023 | 3300027608 | Freshwater Lentic | DDLIRVTDVIFSSDEMAMLGGIIGFWFGSRSWAKK |
| Ga0208974_11855481 | 3300027608 | Freshwater Lentic | SLVNNMDDLIRVTDIIFSGDEMAMLGGIIGFWFGSRSWSKK |
| Ga0208133_10838372 | 3300027631 | Estuarine | MDDLIRVTDIIFSGDEMAMLGGIIGFWFGSRSWSKK |
| Ga0209599_101451831 | 3300027710 | Deep Subsurface | IDDVIRYSEIIFSSDEMAMLGGILGFWFGSRTWSKK |
| Ga0209593_100942661 | 3300027743 | Freshwater Sediment | LIGGIDDVLKYADIVFSEAEMVMLSGIVSFWFGSRNWSKK |
| Ga0209768_1000210116 | 3300027772 | Freshwater Lake | NMDDLIRVTDVIFSSDEMAMLGGIIGFWFGSRSWAKK |
| Ga0209358_100598643 | 3300027804 | Freshwater Lake | EDLIRLSDIIFSTDEMAMLGGIIGFWFGSRSWSKK |
| Ga0209229_103051582 | 3300027805 | Freshwater And Sediment | NMGDLISLSDIIFSSDEMAMLGGIIGFWFGSRSWAKK |
| Ga0209229_103946841 | 3300027805 | Freshwater And Sediment | IQNIDDVIKYSGLIFSSDEMAMLGGIIGFWFGSRGWAKK |
| Ga0209354_104377811 | 3300027808 | Freshwater Lake | MDDLIRITDIIFSADEMAMLGGIIGFWFGSRSWSKK |
| Ga0209668_106964561 | 3300027899 | Freshwater Lake Sediment | HLVQSMEDLIKVAEIIFSDDEMAMLGGIIGFWFGSRSWNKK |
| Ga0209536_1016327503 | 3300027917 | Marine Sediment | GTIQSVDDMIRASDVIFSSDEMAMLGGIIGFWFGSRGWGKK |
| Ga0247723_100990011 | 3300028025 | Deep Subsurface Sediment | LTYMFYHNELITNVDDFIRATDIIFSDDEMAMLGACIGYWFGSRGWSKK |
| Ga0247723_11338721 | 3300028025 | Deep Subsurface Sediment | VYSRPSLVNNMDDLIRITDVIFSSDEMAMLGGIIGFWFGSRSWAKK |
| Ga0315291_105661191 | 3300031707 | Sediment | DDLIRVSDIIFSGDEMAMLGAIIGFWFGSRSWSKK |
| Ga0315907_103430371 | 3300031758 | Freshwater | PHLIQTIDDVIKYSEIIFSSDEMAMLGGIIGFWFGSRGFKK |
| Ga0315907_110237251 | 3300031758 | Freshwater | HLVQNIDDLIRVSAIIFSDDEMAMLGGIIGFWFGSRSWQKK |
| Ga0315907_111535472 | 3300031758 | Freshwater | GDVEKVAELIFSSDEMAMLGGIIGFWFGSRGWAKK |
| Ga0315907_112818222 | 3300031758 | Freshwater | HPELITNIDNLIAVSDIIFSSDEMAMLGGIIGFWFGSRSWSKK |
| Ga0315899_116617461 | 3300031784 | Freshwater | LDDLMRYVDIIFSQDEMAMLGGIIGFWFGSRSMGQKQ |
| Ga0315900_100044661 | 3300031787 | Freshwater | MIKSMDDVLKYSDIIFSPDEMAMLGGIIGFWFGSRNWNKK |
| Ga0315900_106443773 | 3300031787 | Freshwater | KSMDDVLRYSDIIFSPDEMAMLGGIIGFWFGTRTWGRK |
| Ga0315900_110048551 | 3300031787 | Freshwater | LPGVINNIDDVLKFADVVFSQDEMAMLGGIVGYWFGSRGWAKK |
| Ga0315909_1003610812 | 3300031857 | Freshwater | PGVINNIDDVLKFADVVFSQDEMAMLGGIVGYWFGSRGWAKK |
| Ga0315909_106010543 | 3300031857 | Freshwater | IDDLIRVSAIIFSDDEMAMLGGIIGFWFGSRSWQKK |
| Ga0315909_107924151 | 3300031857 | Freshwater | GMIKSMDDVLRYSDIIFSPDEMAMLGGIIGFWFGTRTWGRK |
| Ga0315285_109003341 | 3300031885 | Sediment | DDLIRLSDIIFSTDEMAMLGGIIGFWFGSRGWNKK |
| Ga0315904_100829371 | 3300031951 | Freshwater | IKSMDDVLKYSDIIFSPDEMAMLGGIIGFWFGSRNWNKK |
| Ga0315904_106040983 | 3300031951 | Freshwater | IQSIDDVIKYADLIFSSDEMAMLGGILGFWFGSRTWSKK |
| Ga0315904_107583781 | 3300031951 | Freshwater | PGVITSIDDVIRFSDVVFSESEMSMLGGIIGYWFGSRGWSKK |
| Ga0315904_112306211 | 3300031951 | Freshwater | RPSLVNNMDDLIRVTDVIFSSDEMAMLGGIIGFWFGSRSWAKK |
| Ga0315901_102987421 | 3300031963 | Freshwater | DDVLRYSDIIFSPDEMAMLGGIIGFWFGTRTWGKK |
| Ga0315906_100848421 | 3300032050 | Freshwater | SLVMSIEDLIRLSDIIFSTDEMAMLGGIIGFWFGSRSWSKK |
| Ga0315906_105503444 | 3300032050 | Freshwater | SIDDVLKFSDVVFSQDEMAMLGGIIGYWFGSRGWAKK |
| Ga0315906_109865892 | 3300032050 | Freshwater | LWQRPDLITGIDDVIRYSDIIFSSDEMAMLGGILGFWFGSRTWSKK |
| Ga0315902_108677121 | 3300032093 | Freshwater | DDLIQVTDIIFSGDEMAMLGAIIGFWFGSRSWSKK |
| Ga0315903_107335641 | 3300032116 | Freshwater | NNVDDLIRITTVIFSDDEMAMLGGILGFWFGSRSWSKK |
| Ga0316625_1015480182 | 3300033418 | Soil | SNIDDVIKFSDVIFSESEMSMLGGIIGFWFGSRGWQKK |
| Ga0316627_1019195662 | 3300033482 | Soil | IDDLVRVSTIIFSDDEMAMLGGIIGFWFGSRSWQKK |
| Ga0316621_111748872 | 3300033488 | Soil | PHLVQNIDDLIRVSAIIFSDDEMAMLGGIIGFWFGSRSWQKK |
| Ga0334978_0196871_2_154 | 3300033979 | Freshwater | LAFYVWQHPHLVQNIDDLIRVSTIIFSDDEMAMLGGIIGFWFGSRSWQKK |
| Ga0334982_0485686_374_484 | 3300033981 | Freshwater | MEDLIRVSDIIFSTDEMAMLGGIIGFWFGSRSWSKK |
| Ga0334992_0497229_417_527 | 3300033992 | Freshwater | MDDLIRVTDVIFSSDEMAMLGGIIGFWFGSRSWAKK |
| Ga0335003_0332121_539_649 | 3300033995 | Freshwater | MDDLIRVSDIIFSTDEMAMLGGIIGFWFGSRGWNKK |
| Ga0334979_0687701_2_145 | 3300033996 | Freshwater | YVYSRPSLVTNMDDLIRVTDIIFSSDEMAMLGGIIGFWFGSRSWAKK |
| Ga0334979_0752912_3_119 | 3300033996 | Freshwater | TSIDDVLKYADLLFSADEMAMLGGIIGFWFGSRGWSKK |
| Ga0334986_0035009_2_121 | 3300034012 | Freshwater | IKSMDDVLKYSDIIFSPDEMAMLSGILGFWFGSRTWSKK |
| Ga0334986_0039223_9_131 | 3300034012 | Freshwater | MIKSMDDVLRYSDIIFSPDEMAMLGGIIGFWFGTRTWGKK |
| Ga0334986_0279042_2_130 | 3300034012 | Freshwater | PHLVLNINDLVRVAEIIFSSDEMAMLGAIVGFWFGSRGWNKK |
| Ga0335028_0655132_3_113 | 3300034071 | Freshwater | MDDIILYSDLIFSADEMAILGGILGYWFGSRTWSKK |
| Ga0310127_260902_476_586 | 3300034072 | Fracking Water | MDDIVKFADVIFSSDEMAMLGGIIGFWFGSRNWQKR |
| Ga0335020_0611971_23_133 | 3300034082 | Freshwater | MDDLIRLSDIIFSTDEMAMLGGIIGFWFGSRGWAKK |
| Ga0335027_0792704_2_109 | 3300034101 | Freshwater | DDVIKYSDLIFSSDEMAMLGGIIGFWFGSRNWGKK |
| Ga0335029_0115726_3_113 | 3300034102 | Freshwater | IDDVVKYSSLIFSSDEMAMLGGIIGFWFGSRQWSKK |
| Ga0335031_0747325_54_170 | 3300034104 | Freshwater | MSMDDLIRVSDIIFSTDEMAMLGGSIGFWFGSRGWNKK |
| Ga0335036_0391759_767_895 | 3300034106 | Freshwater | PGMIKSMDDVLRYSDIIFSPDEMAMLSGILGFWFGSRTWSKK |
| Ga0335036_0560293_574_684 | 3300034106 | Freshwater | MDDVLRYTDIIFSPDEMAMLGGIIGFWFGSRGWSKK |
| Ga0335036_0567552_584_694 | 3300034106 | Freshwater | NIDDLLRVTEVIFTDDEMAMLGGIIGFWFGSRSWKK |
| Ga0335037_0695582_19_129 | 3300034107 | Freshwater | MYDLIQVTDIIFSSDEMAMLGAIIGFWFGSRSWSKK |
| Ga0335055_0416415_3_113 | 3300034110 | Freshwater | MDDLIRVTDIIFSSDEMAMLGGIIGFWFGSRSWAKK |
| Ga0335066_0472080_561_668 | 3300034112 | Freshwater | IDDLLRVTEVIFTDDEMAMLGGIIGFWFGSRSWKK |
| Ga0335066_0622189_430_552 | 3300034112 | Freshwater | MIKSMDDVLKYSDIIFSPDEMAMLGGIIGFWFGSRNWAKK |
| Ga0335066_0635029_416_526 | 3300034112 | Freshwater | MDDLIRLSDIIFSTDEMAMLGGIIGFWFGSRGWSKK |
| Ga0335016_0538443_514_624 | 3300034166 | Freshwater | MDDVLRYSDIIFSPDEMAMLGGIIGFWFGTRTWGKK |
| Ga0335049_0066091_2526_2648 | 3300034272 | Freshwater | LITSIDDVLRYADIIFSPDEMAILGGIIGFWFGSRNWSKK |
| Ga0335007_0683051_55_165 | 3300034283 | Freshwater | MDDLIRLSDIIFSSDEMAMLGGIIGFWFGSRSWAKK |
| Ga0335039_0568044_32_142 | 3300034355 | Freshwater | MEDLIKVAEIIFSDDEMAMLGGIIGFWFGSRSWNKK |
| ⦗Top⦘ |