Basic Information | |
---|---|
Family ID | F033018 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 178 |
Average Sequence Length | 40 residues |
Representative Sequence | MAQAALSRILVGPYGLHAFVAVMLALFVAFLWVFNFTTFF |
Number of Associated Samples | 154 |
Number of Associated Scaffolds | 178 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 65.73 % |
% of genes near scaffold ends (potentially truncated) | 25.28 % |
% of genes from short scaffolds (< 2000 bps) | 79.21 % |
Associated GOLD sequencing projects | 148 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.51 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (79.775 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (13.483 % of family members) |
Environment Ontology (ENVO) | Unclassified (21.348 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.438 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 48.53% β-sheet: 0.00% Coil/Unstructured: 51.47% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 178 Family Scaffolds |
---|---|---|
PF07369 | DUF1488 | 46.07 |
PF01165 | Ribosomal_S21 | 7.30 |
PF00075 | RNase_H | 6.18 |
PF00313 | CSD | 3.93 |
PF08379 | Bact_transglu_N | 1.69 |
PF00487 | FA_desaturase | 1.12 |
PF04546 | Sigma70_ner | 1.12 |
PF01636 | APH | 1.12 |
PF05977 | MFS_3 | 1.12 |
PF04392 | ABC_sub_bind | 1.12 |
PF01527 | HTH_Tnp_1 | 0.56 |
PF01266 | DAO | 0.56 |
PF13505 | OMP_b-brl | 0.56 |
PF02738 | MoCoBD_1 | 0.56 |
PF00905 | Transpeptidase | 0.56 |
PF13683 | rve_3 | 0.56 |
PF14534 | DUF4440 | 0.56 |
PF02622 | DUF179 | 0.56 |
PF07995 | GSDH | 0.56 |
PF06897 | DUF1269 | 0.56 |
PF05940 | NnrS | 0.56 |
PF02195 | ParBc | 0.56 |
PF01936 | NYN | 0.56 |
PF00271 | Helicase_C | 0.56 |
PF00270 | DEAD | 0.56 |
PF03401 | TctC | 0.56 |
COG ID | Name | Functional Category | % Frequency in 178 Family Scaffolds |
---|---|---|---|
COG0828 | Ribosomal protein S21 | Translation, ribosomal structure and biogenesis [J] | 7.30 |
COG1305 | Transglutaminase-like enzyme, putative cysteine protease | Posttranslational modification, protein turnover, chaperones [O] | 1.69 |
COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 1.12 |
COG1398 | Fatty-acid desaturase | Lipid transport and metabolism [I] | 1.12 |
COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 1.12 |
COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 1.12 |
COG3239 | Fatty acid desaturase | Lipid transport and metabolism [I] | 1.12 |
COG1432 | NYN domain, predicted PIN-related RNAse, tRNA/rRNA maturation | General function prediction only [R] | 0.56 |
COG1678 | Putative transcriptional regulator, AlgH/UPF0301 family | Transcription [K] | 0.56 |
COG2133 | Glucose/arabinose dehydrogenase, beta-propeller fold | Carbohydrate transport and metabolism [G] | 0.56 |
COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.56 |
COG3213 | Nitric oxide response protein NnrS | Signal transduction mechanisms [T] | 0.56 |
COG4803 | Uncharacterized membrane protein | Function unknown [S] | 0.56 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 79.78 % |
Unclassified | root | N/A | 20.22 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459003|FZN2CUW02H6STK | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium | 501 | Open in IMG/M |
2199352025|deepsgr__Contig_14841 | Not Available | 965 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_100328568 | Not Available | 503 | Open in IMG/M |
3300000787|JGI11643J11755_11557205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 663 | Open in IMG/M |
3300000956|JGI10216J12902_100697441 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
3300001686|C688J18823_11115735 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 500 | Open in IMG/M |
3300001991|JGI24743J22301_10064048 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 760 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100160831 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2123 | Open in IMG/M |
3300002568|C688J35102_120976367 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4226 | Open in IMG/M |
3300004062|Ga0055500_10155819 | Not Available | 543 | Open in IMG/M |
3300004114|Ga0062593_101027833 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 848 | Open in IMG/M |
3300004152|Ga0062386_100387948 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1123 | Open in IMG/M |
3300004152|Ga0062386_100619709 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 885 | Open in IMG/M |
3300004153|Ga0063455_100810653 | Not Available | 650 | Open in IMG/M |
3300004156|Ga0062589_102062893 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 580 | Open in IMG/M |
3300004479|Ga0062595_101307604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 653 | Open in IMG/M |
3300004778|Ga0062383_10224115 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 877 | Open in IMG/M |
3300005164|Ga0066815_10080004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium | 587 | Open in IMG/M |
3300005169|Ga0066810_10087188 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 672 | Open in IMG/M |
3300005179|Ga0066684_10195486 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium | 1306 | Open in IMG/M |
3300005184|Ga0066671_10661663 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 677 | Open in IMG/M |
3300005355|Ga0070671_100464338 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1087 | Open in IMG/M |
3300005436|Ga0070713_100231806 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1679 | Open in IMG/M |
3300005545|Ga0070695_100643554 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 836 | Open in IMG/M |
3300005569|Ga0066705_10086917 | Not Available | 1836 | Open in IMG/M |
3300005575|Ga0066702_10520228 | Not Available | 722 | Open in IMG/M |
3300005576|Ga0066708_10851131 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 570 | Open in IMG/M |
3300005598|Ga0066706_10746736 | Not Available | 776 | Open in IMG/M |
3300005713|Ga0066905_100994107 | Not Available | 739 | Open in IMG/M |
3300005713|Ga0066905_101518994 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 610 | Open in IMG/M |
3300005718|Ga0068866_10003446 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 6473 | Open in IMG/M |
3300005981|Ga0081538_10152388 | All Organisms → cellular organisms → Bacteria | 1044 | Open in IMG/M |
3300005983|Ga0081540_1009217 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 6807 | Open in IMG/M |
3300006031|Ga0066651_10630800 | Not Available | 571 | Open in IMG/M |
3300006038|Ga0075365_10005288 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 6945 | Open in IMG/M |
3300006046|Ga0066652_101348384 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 670 | Open in IMG/M |
3300006047|Ga0075024_100054819 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1673 | Open in IMG/M |
3300006057|Ga0075026_100696288 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 607 | Open in IMG/M |
3300006057|Ga0075026_100733509 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 593 | Open in IMG/M |
3300006057|Ga0075026_100816306 | Not Available | 567 | Open in IMG/M |
3300006576|Ga0074047_12046019 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1343 | Open in IMG/M |
3300006581|Ga0074048_13126719 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 581 | Open in IMG/M |
3300006797|Ga0066659_10140700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1703 | Open in IMG/M |
3300006800|Ga0066660_10088918 | All Organisms → cellular organisms → Bacteria | 2153 | Open in IMG/M |
3300006852|Ga0075433_10113671 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2402 | Open in IMG/M |
3300006852|Ga0075433_10136080 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2184 | Open in IMG/M |
3300006854|Ga0075425_100014240 | All Organisms → cellular organisms → Bacteria | 8582 | Open in IMG/M |
3300007788|Ga0099795_10438032 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 600 | Open in IMG/M |
3300009012|Ga0066710_100211872 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2769 | Open in IMG/M |
3300009090|Ga0099827_10421284 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1142 | Open in IMG/M |
3300009094|Ga0111539_10062067 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4425 | Open in IMG/M |
3300009553|Ga0105249_12756408 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium | 563 | Open in IMG/M |
3300009813|Ga0105057_1017213 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium | 1032 | Open in IMG/M |
3300009840|Ga0126313_10027489 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3867 | Open in IMG/M |
3300010036|Ga0126305_10031863 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2879 | Open in IMG/M |
3300010037|Ga0126304_10463527 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 849 | Open in IMG/M |
3300010040|Ga0126308_10639822 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 728 | Open in IMG/M |
3300010041|Ga0126312_11421246 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 514 | Open in IMG/M |
3300010154|Ga0127503_10208223 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1168 | Open in IMG/M |
3300010339|Ga0074046_10087268 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2021 | Open in IMG/M |
3300010360|Ga0126372_10337172 | Not Available | 1345 | Open in IMG/M |
3300010373|Ga0134128_12151297 | Not Available | 614 | Open in IMG/M |
3300010379|Ga0136449_100419698 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2363 | Open in IMG/M |
3300010391|Ga0136847_12544594 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 187 | 856 | Open in IMG/M |
3300010396|Ga0134126_11479989 | Not Available | 749 | Open in IMG/M |
3300010396|Ga0134126_12611995 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 548 | Open in IMG/M |
3300010397|Ga0134124_11462481 | Not Available | 710 | Open in IMG/M |
3300010864|Ga0126357_1067693 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 506 | Open in IMG/M |
3300010865|Ga0126346_1393247 | Not Available | 825 | Open in IMG/M |
3300010867|Ga0126347_1006958 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 513 | Open in IMG/M |
3300010867|Ga0126347_1066391 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 633 | Open in IMG/M |
3300010867|Ga0126347_1464541 | Not Available | 514 | Open in IMG/M |
3300011119|Ga0105246_10167342 | Not Available | 1680 | Open in IMG/M |
3300011120|Ga0150983_10279270 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 889 | Open in IMG/M |
3300011120|Ga0150983_10617777 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1481 | Open in IMG/M |
3300011423|Ga0137436_1035149 | All Organisms → cellular organisms → Bacteria | 1263 | Open in IMG/M |
3300012096|Ga0137389_10327052 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1301 | Open in IMG/M |
3300012199|Ga0137383_11108606 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium | 573 | Open in IMG/M |
3300012203|Ga0137399_11010017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 700 | Open in IMG/M |
3300012203|Ga0137399_11023067 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 696 | Open in IMG/M |
3300012204|Ga0137374_10015604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 8749 | Open in IMG/M |
3300012204|Ga0137374_10020663 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 7464 | Open in IMG/M |
3300012204|Ga0137374_10021773 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 7247 | Open in IMG/M |
3300012212|Ga0150985_103615718 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 6730 | Open in IMG/M |
3300012212|Ga0150985_117796713 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 771 | Open in IMG/M |
3300012383|Ga0134033_1043550 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
3300012389|Ga0134040_1242787 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
3300012469|Ga0150984_104211309 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 507 | Open in IMG/M |
3300012469|Ga0150984_106827344 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1201 | Open in IMG/M |
3300012469|Ga0150984_121830977 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1180 | Open in IMG/M |
3300012915|Ga0157302_10135491 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
3300012917|Ga0137395_10091148 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2008 | Open in IMG/M |
3300012986|Ga0164304_10354504 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1026 | Open in IMG/M |
3300013102|Ga0157371_11338249 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 555 | Open in IMG/M |
3300013306|Ga0163162_11353677 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 809 | Open in IMG/M |
3300014501|Ga0182024_10308236 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2088 | Open in IMG/M |
3300014745|Ga0157377_11112162 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 606 | Open in IMG/M |
3300014965|Ga0120193_10098249 | Not Available | 509 | Open in IMG/M |
3300015201|Ga0173478_10020143 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1885 | Open in IMG/M |
3300015201|Ga0173478_10791702 | Not Available | 519 | Open in IMG/M |
3300015245|Ga0137409_10944868 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces afghaniensis → Streptomyces afghaniensis 772 | 699 | Open in IMG/M |
3300015371|Ga0132258_10230779 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4509 | Open in IMG/M |
3300015371|Ga0132258_10344477 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3683 | Open in IMG/M |
3300015372|Ga0132256_101908265 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 701 | Open in IMG/M |
3300016341|Ga0182035_10685354 | Not Available | 892 | Open in IMG/M |
3300016422|Ga0182039_11409202 | Not Available | 633 | Open in IMG/M |
3300018027|Ga0184605_10013162 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3212 | Open in IMG/M |
3300018054|Ga0184621_10129077 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 906 | Open in IMG/M |
3300018056|Ga0184623_10200657 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium | 917 | Open in IMG/M |
3300018062|Ga0187784_11497890 | Not Available | 534 | Open in IMG/M |
3300018067|Ga0184611_1016111 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2235 | Open in IMG/M |
3300018071|Ga0184618_10257198 | Not Available | 739 | Open in IMG/M |
3300018081|Ga0184625_10399433 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 709 | Open in IMG/M |
3300018429|Ga0190272_12035523 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 609 | Open in IMG/M |
3300018431|Ga0066655_10367331 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 947 | Open in IMG/M |
3300018469|Ga0190270_12529961 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium | 575 | Open in IMG/M |
3300018481|Ga0190271_10415393 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1443 | Open in IMG/M |
3300019263|Ga0184647_1072869 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 737 | Open in IMG/M |
3300019356|Ga0173481_10222658 | Not Available | 832 | Open in IMG/M |
3300019767|Ga0190267_10130193 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1062 | Open in IMG/M |
3300019889|Ga0193743_1186529 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 674 | Open in IMG/M |
3300020002|Ga0193730_1068782 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1010 | Open in IMG/M |
3300021180|Ga0210396_11162330 | Not Available | 647 | Open in IMG/M |
3300021401|Ga0210393_10110234 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2196 | Open in IMG/M |
3300021420|Ga0210394_10808898 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 818 | Open in IMG/M |
3300025900|Ga0207710_10028299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2433 | Open in IMG/M |
3300025904|Ga0207647_10769959 | Not Available | 520 | Open in IMG/M |
3300025915|Ga0207693_10046342 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3415 | Open in IMG/M |
3300025920|Ga0207649_11580184 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 519 | Open in IMG/M |
3300025931|Ga0207644_10364326 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1176 | Open in IMG/M |
3300025986|Ga0207658_10300535 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1382 | Open in IMG/M |
3300026215|Ga0209849_1075877 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 593 | Open in IMG/M |
3300026552|Ga0209577_10041424 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3942 | Open in IMG/M |
3300026557|Ga0179587_10221384 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1204 | Open in IMG/M |
3300027273|Ga0209886_1011425 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1286 | Open in IMG/M |
3300027625|Ga0208044_1079670 | All Organisms → cellular organisms → Bacteria | 984 | Open in IMG/M |
3300027703|Ga0207862_1223936 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 555 | Open in IMG/M |
3300027812|Ga0209656_10066762 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1972 | Open in IMG/M |
3300027812|Ga0209656_10418851 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 597 | Open in IMG/M |
3300027824|Ga0209040_10029586 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae | 3479 | Open in IMG/M |
3300027866|Ga0209813_10113608 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 936 | Open in IMG/M |
3300027882|Ga0209590_10069873 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2019 | Open in IMG/M |
3300027905|Ga0209415_10015696 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 12249 | Open in IMG/M |
3300027907|Ga0207428_10084660 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2470 | Open in IMG/M |
3300027907|Ga0207428_10864541 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 640 | Open in IMG/M |
3300027908|Ga0209006_10190185 | Not Available | 1787 | Open in IMG/M |
3300027915|Ga0209069_10082936 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1533 | Open in IMG/M |
3300028379|Ga0268266_11571202 | Not Available | 633 | Open in IMG/M |
3300028577|Ga0265318_10397217 | Not Available | 504 | Open in IMG/M |
3300028710|Ga0307322_10240149 | Not Available | 502 | Open in IMG/M |
3300028712|Ga0307285_10042693 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1115 | Open in IMG/M |
3300028712|Ga0307285_10136244 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 666 | Open in IMG/M |
3300028713|Ga0307303_10061825 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 811 | Open in IMG/M |
3300028782|Ga0307306_10106992 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 750 | Open in IMG/M |
3300028793|Ga0307299_10202529 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 746 | Open in IMG/M |
3300028793|Ga0307299_10296465 | Not Available | 607 | Open in IMG/M |
3300028807|Ga0307305_10097767 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1356 | Open in IMG/M |
3300028810|Ga0307294_10356056 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 542 | Open in IMG/M |
3300028876|Ga0307286_10235094 | Not Available | 669 | Open in IMG/M |
3300031091|Ga0308201_10095549 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 848 | Open in IMG/M |
3300031198|Ga0307500_10059454 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 944 | Open in IMG/M |
3300031226|Ga0307497_10031361 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1735 | Open in IMG/M |
3300031247|Ga0265340_10010344 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4991 | Open in IMG/M |
3300031247|Ga0265340_10419250 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 590 | Open in IMG/M |
3300031446|Ga0170820_12748131 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 518 | Open in IMG/M |
3300031576|Ga0247727_10886592 | Not Available | 628 | Open in IMG/M |
3300031720|Ga0307469_10092351 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2095 | Open in IMG/M |
3300031720|Ga0307469_10579587 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 999 | Open in IMG/M |
3300031740|Ga0307468_100116835 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1631 | Open in IMG/M |
3300031740|Ga0307468_100779202 | Not Available | 812 | Open in IMG/M |
3300031879|Ga0306919_10341946 | Not Available | 1142 | Open in IMG/M |
3300031942|Ga0310916_10087690 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2474 | Open in IMG/M |
3300031946|Ga0310910_11152326 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 602 | Open in IMG/M |
3300032001|Ga0306922_10771723 | All Organisms → cellular organisms → Bacteria | 1007 | Open in IMG/M |
3300032013|Ga0310906_11009143 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 598 | Open in IMG/M |
3300032035|Ga0310911_10298611 | Not Available | 927 | Open in IMG/M |
3300034268|Ga0372943_0029485 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2971 | Open in IMG/M |
3300034820|Ga0373959_0144321 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 598 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 13.48% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.87% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.30% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.93% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.37% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.37% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.25% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.25% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.25% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.25% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.25% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.81% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.81% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.81% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.81% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 2.81% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.69% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.69% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.69% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.69% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.69% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.69% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 1.69% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.12% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.12% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.12% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.12% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.12% |
Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 1.12% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.12% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.56% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.56% |
Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.56% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.56% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.56% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.56% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.56% |
Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.56% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.56% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.56% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.56% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.56% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.56% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.56% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.56% |
Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.56% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.56% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.56% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.56% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.56% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.56% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.56% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.56% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.56% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.56% |
Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.56% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.56% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.56% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459003 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm | Environmental | Open in IMG/M |
2199352025 | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL | Environmental | Open in IMG/M |
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000787 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Host-Associated | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300004062 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D2 | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300004778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh | Environmental | Open in IMG/M |
3300005164 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAC | Environmental | Open in IMG/M |
3300005169 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPA | Environmental | Open in IMG/M |
3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
3300006576 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006581 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009813 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_10_20 | Environmental | Open in IMG/M |
3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010864 | Boreal forest soil eukaryotic communities from Alaska, USA - W3-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010865 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010867 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300011423 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT119_2 | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012383 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012389 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
3300014965 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T2 | Environmental | Open in IMG/M |
3300015201 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2) | Environmental | Open in IMG/M |
3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018067 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex | Environmental | Open in IMG/M |
3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
3300019263 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
3300019889 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2c2 | Environmental | Open in IMG/M |
3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026215 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 (SPAdes) | Environmental | Open in IMG/M |
3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300027273 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_40_50 (SPAdes) | Environmental | Open in IMG/M |
3300027625 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027703 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes) | Environmental | Open in IMG/M |
3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027866 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) | Host-Associated | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Host-Associated | Open in IMG/M |
3300028710 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380 | Environmental | Open in IMG/M |
3300028712 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139 | Environmental | Open in IMG/M |
3300028713 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184 | Environmental | Open in IMG/M |
3300028782 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193 | Environmental | Open in IMG/M |
3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
3300028810 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151 | Environmental | Open in IMG/M |
3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
3300031091 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031198 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_S | Environmental | Open in IMG/M |
3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Host-Associated | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031576 | Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
3300034268 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 | Environmental | Open in IMG/M |
3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
E4A_03038700 | 2170459003 | Grass Soil | MTQPAISRILVGPYGLHAFGAAVLVLFLAFLWVFN |
deepsgr_02435550 | 2199352025 | Soil | MAQAALSRILVGPYGLHAFVAVMLALFVAFLWVFNFTTFF |
INPhiseqgaiiFebDRAFT_1003285682 | 3300000364 | Soil | MAHEAISRVLVGPYGLHAFAAGVLALFAVFLWIFNFTSFF* |
JGI11643J11755_115572052 | 3300000787 | Soil | MAQTALARILVGPYGLHAFLGVMLALFVAFLWVFNFTTFF* |
JGI10216J12902_1006974411 | 3300000956 | Soil | MAQAALSRILIGPYGLHAFIGVMLALFVTFLWVFNFT |
C688J18823_111157351 | 3300001686 | Soil | MGQAALSRILIGPYGLHAFIGVMLALFVTFLWVFNFTTFF* |
JGI24743J22301_100640482 | 3300001991 | Corn, Switchgrass And Miscanthus Rhizosphere | MAQAALSRXLIGPYGLHAFIGVMLALFVAFLWVFNFTTFF* |
JGIcombinedJ26739_1001608312 | 3300002245 | Forest Soil | MEQSAMSKVLVGPYGLHAFGGVLLIMFFVFLWVFNFTSFF* |
C688J35102_1209763673 | 3300002568 | Soil | MASTAASKLLIGPYGLHAFLAVVLALFLGFLWLFNFTSFF* |
Ga0055500_101558191 | 3300004062 | Natural And Restored Wetlands | MAQAAISRVLIGPYGLHAFGIALLVLFAVFLWVFNFTHFFGGGAS* |
Ga0062593_1010278332 | 3300004114 | Soil | MAQTAFARILVGPYGLHAVLGVMLALFVAFLWVFNFTTFF* |
Ga0062386_1003879482 | 3300004152 | Bog Forest Soil | MGDAKAMAPTVASRILIGPYGLHAFLAVLLALFLGFLWLFNFTAFF* |
Ga0062386_1006197092 | 3300004152 | Bog Forest Soil | MGDAKAMAPTAASRILIGPYGLHAFLGVVLALFLGFLWLFNFTAFF* |
Ga0063455_1008106531 | 3300004153 | Soil | MAQAALARILIGPYGLHAFIGVMLALFAAFLWVFNFTTFF* |
Ga0062589_1020628932 | 3300004156 | Soil | MAQAALSRILIGPYGLHAFIGVMLALFVTFLWVFNFTTFF* |
Ga0062595_1013076042 | 3300004479 | Soil | MAQAAISRVLIGPYGLHAFGITLLVLFAVFLWAFNFTHFFGGGAF* |
Ga0062383_102241153 | 3300004778 | Wetland Sediment | MEQSATARILIGPYGLHGFSIVALVLFLLFLWAFNFTSFF* |
Ga0066815_100800042 | 3300005164 | Soil | MAQAALSRILVGPYGLHAFVAVMLALFVAFLWVFNFTTFF* |
Ga0066810_100871882 | 3300005169 | Soil | MAQAALSRILVGPYGLHAFVAVMLALFAAFLWVFNFTTFF* |
Ga0066684_101954862 | 3300005179 | Soil | MARSAASRVLVGPHGLHAFGLAAIAGLIVFLWIFNFTNFF* |
Ga0066671_106616633 | 3300005184 | Soil | MEQSAIARILVGPYGLHAFGFVVLSFFLAFLWVFNFTAFF* |
Ga0070671_1004643381 | 3300005355 | Switchgrass Rhizosphere | MAQTALARILVGPYGLHACLGVMLALFVAFLWVFNFTTFF* |
Ga0070713_1002318063 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MAQAALSRFLIGPYGLHAFIGVMLALFVAFLWVFNFTTFF* |
Ga0070695_1006435542 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MAQETIARTLVGPYGLHLFGAALLLMFIGFLVVFNFTNFF* |
Ga0066705_100869173 | 3300005569 | Soil | MEHSGSPKILAGSYGLYAFGLVALSLFLAFLWLFNFTSFF* |
Ga0066702_105202281 | 3300005575 | Soil | MEQSAIARILVGPYGLHAFGFVVLGFFLAFLWVFNFTTFF* |
Ga0066708_108511312 | 3300005576 | Soil | MCAMEQSAIARVLVGPYGLHAFGFVVLGFFLAFLWVFNFTTFF* |
Ga0066706_107467362 | 3300005598 | Soil | MEHSDSPKILAGSYGLYAFGLVALSLFLAFLWLFNFTSFF* |
Ga0066905_1009941071 | 3300005713 | Tropical Forest Soil | STASRILVGPYGLHAFGFVVLAFFPPFLWVFNFTSFF* |
Ga0066905_1015189942 | 3300005713 | Tropical Forest Soil | MQQAALARILSGPFGLHAAGIVTLALFALFLWAFNFTTFF* |
Ga0068866_100034465 | 3300005718 | Miscanthus Rhizosphere | MAQAALSRLLIGPYGLHAFIGVMLALFVAFLWVFNFTTFF* |
Ga0081538_101523882 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MPQATLSRLLIGPFGLHAFIAGALVLFAGFLWVFNFTNFF* |
Ga0081540_10092176 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MQQAALTRILGRPFGLHAAGIVMLALFALFLWAFNFTTFF* |
Ga0066651_106308002 | 3300006031 | Soil | MASTAASRLLIGPYGLHAFLAVVLALFLGFLWLFNFTSFC* |
Ga0075365_100052881 | 3300006038 | Populus Endosphere | MAQAALSRILVGPYGLHAFIAVMLAFFIAFLWVFNFTTFF* |
Ga0066652_1013483842 | 3300006046 | Soil | MASTAASRLLIGPYGLHAVVAVVLALFLGFLWLFNFTSFF* |
Ga0075024_1000548192 | 3300006047 | Watersheds | MENSAVARILVGPYGLHAFGAVVLSLFLAFLWVFNFTSFF* |
Ga0075026_1006962882 | 3300006057 | Watersheds | MAQAAISRVLIGPYGLHAFGFTLLALFAVFLWLFNFTHFFGGGAS* |
Ga0075026_1007335091 | 3300006057 | Watersheds | MMMSETCAMTQAVASRMRIGRYGLRAFGAVVLALFLAFLWVFNFTTFF* |
Ga0075026_1008163062 | 3300006057 | Watersheds | MAQAAISRVLIGPYGLHAFGIALLVLFAVFLWVFNFTHFFGGGAF* |
Ga0074047_120460191 | 3300006576 | Soil | AMAQAALSRILIGPYGLHAFIGVMLALFVAFLWVFNFTTFF* |
Ga0074048_131267192 | 3300006581 | Soil | LSRILVGPYGLHAFVAVMLALFAAFLWVFNFTTFF* |
Ga0066659_101407001 | 3300006797 | Soil | MEQSAIARILVGPYGLHAFGFVVLGFFLAFLWVFNFTAFF* |
Ga0066660_100889181 | 3300006800 | Soil | MEQSAIARVLVGPYGLHAFGFVVLGFFLAFLWVFNFTAFF* |
Ga0075433_101136712 | 3300006852 | Populus Rhizosphere | MQSGTLSRVFVGPFGLHAFGIVVLALFALFLWAFNFTTFF* |
Ga0075433_101360803 | 3300006852 | Populus Rhizosphere | MAQTALARILVGPYGLHAFLGVMLALFLAFLWVFNFTTFF* |
Ga0075425_1000142407 | 3300006854 | Populus Rhizosphere | MQSGTLTRVFIGPFGLHAFGIVVLALFALFLWAFNFTTFF* |
Ga0099795_104380323 | 3300007788 | Vadose Zone Soil | MAQAALSRILVGPYGLHAFVAVTLALFVAFLWVFNFTTFF* |
Ga0066710_1002118728 | 3300009012 | Grasslands Soil | MEHSDSPKILAGSYGLYAFGLVALSLFLAFLWLFNFTSFF |
Ga0099827_104212842 | 3300009090 | Vadose Zone Soil | MEQSAASRMLIGPYGLHAFGAVLLIFFLAFLWVFNFTNFF* |
Ga0111539_100620673 | 3300009094 | Populus Rhizosphere | MTIAALARILVGPGGLHAFGAVTLALFLAFLWFFNFTAFF* |
Ga0105249_127564082 | 3300009553 | Switchgrass Rhizosphere | MEQSAVSRILIGPYGLHAFGFGGLVVFVIFLWIFNFTKFF* |
Ga0105057_10172132 | 3300009813 | Groundwater Sand | MERSATSIFIGPYGLHGFGIVALVFFLVFLWAFNFTTFF* |
Ga0126313_100274895 | 3300009840 | Serpentine Soil | MPEAALSRFLIGPFGLHAFIAGALVLFAGFLWVFNFTNFF* |
Ga0126305_100318632 | 3300010036 | Serpentine Soil | MPEATLSRSLIGPFGLHAFIAGALVLFAGFLWVFNFTNFF* |
Ga0126304_104635272 | 3300010037 | Serpentine Soil | MAPSVFSRVLVGPNGIHALGFVLLALFLAFIWIFNFTSFF* |
Ga0126308_106398222 | 3300010040 | Serpentine Soil | MAQAALSRILIGPYGLHAFIGVMLALFVAFLWVFNFTTFF* |
Ga0126312_114212461 | 3300010041 | Serpentine Soil | VMPEATLSRSLIGPFGLHAFIAGALVLFAGFLWVFNFTNFF* |
Ga0127503_102082232 | 3300010154 | Soil | MTQAVASRMLVGRYGLRAFGAVVLALFLAFLWVFNFTTFF* |
Ga0074046_100872682 | 3300010339 | Bog Forest Soil | LKLLGPAASMGDAKAMAPTVASRILIGPYGLHAFLAVLLALFLGFLWLFNFTAFF* |
Ga0126372_103371721 | 3300010360 | Tropical Forest Soil | LSRVFIGPFGLHAFGFVVLALFALFLWAFNFTTFF* |
Ga0134128_121512972 | 3300010373 | Terrestrial Soil | MRAMTQMAASRILIGPYGLHAFVVAVLVLFLGFLWLFNFTTFF* |
Ga0136449_1004196982 | 3300010379 | Peatlands Soil | MAESAVSRILVGPYGLHAFGAVALVLFFIFLWAFNFTTFF* |
Ga0136847_125445942 | 3300010391 | Freshwater Sediment | SRIFVGPYGLHAVSLAMLFLFLGFLWVFNFTSFF* |
Ga0134126_114799891 | 3300010396 | Terrestrial Soil | MPALTQMAVSRILIGPYGLHAFVVAVLVLFLGFLWLFNFTTFF* |
Ga0134126_126119951 | 3300010396 | Terrestrial Soil | MAQAALSRFLIGPYGLHAFIGVMLALFVAFLWVFNFTTFC* |
Ga0134124_114624811 | 3300010397 | Terrestrial Soil | ARPMESSATARILIGPYGLHAFGLILLSLFLGFLWVFNFTTFFGGSAVITQ* |
Ga0126357_10676932 | 3300010864 | Boreal Forest Soil | MAQATIARTLAGPYGLHVWGTALVALFVGFLVVFNFTNFF* |
Ga0126346_13932473 | 3300010865 | Boreal Forest Soil | MTQATIAKTLVGPYGLHAVGAALVALFVGFLVVFNFTNFF* |
Ga0126347_10069582 | 3300010867 | Boreal Forest Soil | MAQATIARALVGPYGLHAVGAVLLVLFVGFLAVFNFTNFF* |
Ga0126347_10663913 | 3300010867 | Boreal Forest Soil | MAQATIARTLAGPYGLHVWGAALVALFVGFLVVFNFTNFF* |
Ga0126347_14645412 | 3300010867 | Boreal Forest Soil | MTQATIAKTLVGPYGLHAVGAALVALFVGFLVEIS |
Ga0105246_101673421 | 3300011119 | Miscanthus Rhizosphere | MAQTALARILVGPYGLHAFLGVMLALFVAFLWVFNFTTF |
Ga0150983_102792703 | 3300011120 | Forest Soil | MDNQAMEQSAMSKVLVGPYGLHAFGGVLLIMFFVFLWVFNFTSFF* |
Ga0150983_106177774 | 3300011120 | Forest Soil | ASRILVGPYGLHAFGLVVLTFFVVFLWVFNFTSFF* |
Ga0137436_10351491 | 3300011423 | Soil | MEQTAIARILVGPYGLHAFGFVVLGFFLMFLWVFNFTAFF* |
Ga0137389_103270523 | 3300012096 | Vadose Zone Soil | MEQTAIARILVGPYGLHAFGFVVLGFFLAFLWVFNFTAFF* |
Ga0137383_111086062 | 3300012199 | Vadose Zone Soil | MEHSATSRILIGPYGLHAFGFAVFAFFLIFLWVFNFTKF |
Ga0137399_110100173 | 3300012203 | Vadose Zone Soil | ARILVGPYGLHAAGFVMLGFFLAFLWVFNFTTFF* |
Ga0137399_110230671 | 3300012203 | Vadose Zone Soil | ALSRILVGPYGLHAFVAVTLALFVAFLWVFNFTTFF* |
Ga0137374_100156043 | 3300012204 | Vadose Zone Soil | MWPATSRILIGPYGLHGFAIVTLLFFLVFLWAFNFTSFF* |
Ga0137374_100206636 | 3300012204 | Vadose Zone Soil | MGQTNMNQILVGPYGLHAFLGVALALFLGFLYVFNFTAFF* |
Ga0137374_100217734 | 3300012204 | Vadose Zone Soil | MEPSAISRTLVGPFGLHAFGGVVLALFLVFLWVFNFTNFF* |
Ga0150985_1036157183 | 3300012212 | Avena Fatua Rhizosphere | MASTAVSKLLIGPYGLHAFLAVVLALFLGFLWLFNFTSFF* |
Ga0150985_1177967131 | 3300012212 | Avena Fatua Rhizosphere | MGAMAQAALSRILIGPYGLHAFIGVMLALFVAFLWVFKFTPFF* |
Ga0134033_10435502 | 3300012383 | Grasslands Soil | MRAMTQAAVTRMLIGPYGLHAFLAFLLALFVGFLWLFNFTTFF* |
Ga0134040_12427872 | 3300012389 | Grasslands Soil | MRAMTQAAVTRRLIGPYGLHAFLAFLLALFVGFLWLFNFTTFF* |
Ga0150984_1042113092 | 3300012469 | Avena Fatua Rhizosphere | MAQAALSRLLIGPYGLHALIGVMLALFVAFLWVFNFTTFF* |
Ga0150984_1068273444 | 3300012469 | Avena Fatua Rhizosphere | MAQAALARFLIGPYGLHAFIGVMLALFVAFLWVFNFTTFF* |
Ga0150984_1218309771 | 3300012469 | Avena Fatua Rhizosphere | MAQAALSRILVGPYGLHAFIAVMLALFIAFLWVFNFTTFF* |
Ga0157302_101354912 | 3300012915 | Soil | DRMRAMTQMAVSRILIGPYGLHAFVATVLVLFLGFLWLFNFTTFF* |
Ga0137395_100911483 | 3300012917 | Vadose Zone Soil | MCTMEQSAVARILVGPYGLHAAGFVMLGFFLAFLWAFNFTTFF* |
Ga0164304_103545041 | 3300012986 | Soil | AALSRILVGPYGLHAFVAVMLALFVAFLWVFNFTTFF* |
Ga0157371_113382491 | 3300013102 | Corn Rhizosphere | QAALSRILIGPYGLHAFIGVMLALFVTFLWVFNFTTFF* |
Ga0163162_113536773 | 3300013306 | Switchgrass Rhizosphere | MAQTAFARILVGPYGLHACLGVMLALFVAFLWVFNFTTFF* |
Ga0182024_103082362 | 3300014501 | Permafrost | MENSAVSRILVGPYGLHAFGLVLLTFFVVFLWVFNFTSFF* |
Ga0157377_111121622 | 3300014745 | Miscanthus Rhizosphere | MGAMAQAALSRLLIGPYGLHAFIGVMLALFVAFLWVFNFTTFF* |
Ga0120193_100982492 | 3300014965 | Terrestrial | MRAMQPATLSRILAGPFVLRAMAAAALALFAAFLWIFNFTTFF* |
Ga0173478_100201433 | 3300015201 | Soil | MAQAALSRLLIGPYGLHAFIGVMLALFVTFLWVFNFTTFF* |
Ga0173478_107917022 | 3300015201 | Soil | MAQTALARILVGPYGLHAFLGVMLALFVAFLWVFNFT |
Ga0137409_109448681 | 3300015245 | Vadose Zone Soil | MEQTAIARILVGPYGLHAFGLGMLTLFVAFLWVFNFTSFF* |
Ga0132258_102307793 | 3300015371 | Arabidopsis Rhizosphere | MAQIEASRILIGPYGLYAFVAAVLLFFLGFLWVFNFTTFF* |
Ga0132258_103444772 | 3300015371 | Arabidopsis Rhizosphere | MQIALSRILIGPYGLHAFAAVALTLFLGFLWVFNFTTFF* |
Ga0132256_1019082652 | 3300015372 | Arabidopsis Rhizosphere | MQPGTLSRFFIGPFGLHAFGFGVLALFALFLWAFNFTTFF* |
Ga0182035_106853542 | 3300016341 | Soil | MTQTAISRILIGPYGLHALVAAVLVLFLGFLWVFNFTTFF |
Ga0182039_114092021 | 3300016422 | Soil | MAQTAISRILIGPYGLHALVAAVLVLFLGFLSVFNFTTFF |
Ga0184605_100131622 | 3300018027 | Groundwater Sediment | MAQAALSRILVGPYGLHAFVAVTLALFVAFLWVFNFTTFF |
Ga0184621_101290772 | 3300018054 | Groundwater Sediment | MAQAALSRILVGPYGLHAFVAVTLALFVAFLWVFNFTSDAADA |
Ga0184623_102006571 | 3300018056 | Groundwater Sediment | MAQADIARMLIGPYGLHAFLGIFAILFLAFLWVFNFTTFF |
Ga0187784_114978903 | 3300018062 | Tropical Peatland | MGQTAVSRILIGPYGLYAFIAIVLLLFLGFLWVFNF |
Ga0184611_10161115 | 3300018067 | Groundwater Sediment | MAQAALARFLIGPYGLHAFIGVMLALFVAFLWVFNFTTFF |
Ga0184618_102571981 | 3300018071 | Groundwater Sediment | MAQAALSRILVGPYGLHAFVAVMLALFVAFLWVFNFTT |
Ga0184625_103994332 | 3300018081 | Groundwater Sediment | MGCAMPEATLSRLLIGPFGLHAFIAAALILFAGFLWVFNFTNFF |
Ga0190272_120355232 | 3300018429 | Soil | MENIAMAPAIASSILGPYGLHAFGAVAVVLFLAFLWVFNFTSFF |
Ga0066655_103673312 | 3300018431 | Grasslands Soil | MASTAASKLLIGPYGLHAFLAVVLALFLGFLWLFNFTSFF |
Ga0190270_125299611 | 3300018469 | Soil | MGARAMSQSAVSRILVGPHGMHAVGALVLALFLAFLWAFNFTSFF |
Ga0190271_104153934 | 3300018481 | Soil | MEQAALSRLLIGPYGLHAFIGVMLALFVAFLWVFNFTTFF |
Ga0184647_10728691 | 3300019263 | Groundwater Sediment | MAQAALSRLLIGPYGLHAFIGVMLALFVAFLWVFNFTTFF |
Ga0173481_102226582 | 3300019356 | Soil | MAQTALARILVGPYGLHAFLGVMLALFVAFLWVFNFTTFF |
Ga0190267_101301931 | 3300019767 | Soil | MAQAALARILIGPYGLHAFIGVMLALFVAFLWVFNFTTFF |
Ga0193743_11865291 | 3300019889 | Soil | MAQAALSRILIGPYGLHAFIGVMLALFVAFLWVFNFTTFF |
Ga0193730_10687823 | 3300020002 | Soil | MAQAALSKILVGPYGLHAFIAVMLGLFAAFLWVFNFTTFF |
Ga0210396_111623302 | 3300021180 | Soil | MENSAASRILVGPYGLHAFGLVLLTFFAVFLWAFNFTNFF |
Ga0210393_101102341 | 3300021401 | Soil | MENSAASRILVGPYGLHAFGLVLLTFFVVFLWVFNFTSFF |
Ga0210394_108088981 | 3300021420 | Soil | MENSAASRILVGPYGLHAFGLVLLTSFVVFLWVFNFTSFF |
Ga0207710_100282991 | 3300025900 | Switchgrass Rhizosphere | AALSRFLIGPYGLHAFIGVMLALFVAFLWVFNFTTFF |
Ga0207647_107699592 | 3300025904 | Corn Rhizosphere | MAQTALARILVGPYGLHAFLGVMLALFVAFLWVFNF |
Ga0207693_100463425 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MAQAALSRFLIGPYGLHAFIGVMLALFVAFLWVFNFTTFF |
Ga0207649_115801842 | 3300025920 | Corn Rhizosphere | LSRLLIGPYGLHAFIGVMLALFVAFLWVFNFTTFF |
Ga0207644_103643263 | 3300025931 | Switchgrass Rhizosphere | MAQTALARILVGPYGLHACLGVMLALFVAFLWVFNFTTFF |
Ga0207658_103005351 | 3300025986 | Switchgrass Rhizosphere | QAALSRLLIGPYGLHAFIGVMLALFVAFLWVFNFTTFF |
Ga0209849_10758772 | 3300026215 | Soil | MESSAISRILVGPCGLHAFGLVLLSFFIVFLWVFNFTNFF |
Ga0209577_100414242 | 3300026552 | Soil | MEQSAIARILVGPYGLHAFGFVVLGFFLAFLWVFNFTAFF |
Ga0179587_102213843 | 3300026557 | Vadose Zone Soil | MAQAAIARVLVGPYGLHAFGAVLLLLFVGFLVVFNFTSFF |
Ga0209886_10114251 | 3300027273 | Groundwater Sand | MERSATSIFIGPYGLHGFGIVALVFFLVFLWAFNFTTFF |
Ga0208044_10796701 | 3300027625 | Peatlands Soil | MAESAVSRILVGPYGLHAFGAVALVLFFIFLWAFNFTTFF |
Ga0207862_12239361 | 3300027703 | Tropical Forest Soil | AMAPEAISRVLVGPYGLHAFAAAVLALFAVFLWVFNFTNFF |
Ga0209656_100667623 | 3300027812 | Bog Forest Soil | MGDAKAMAPTAASRILIGPYGLHAFLGVVLALFLGFLWLFNFTTFF |
Ga0209656_104188511 | 3300027812 | Bog Forest Soil | MGDAKAMAPTVASRILIGPYGLHAFLAVLLALFLGFLWLFNFTAFF |
Ga0209040_100295866 | 3300027824 | Bog Forest Soil | MGDAKAMAPTAASRILIGPYGLHAFLGVVLALFLGFLWLFNFTAFF |
Ga0209813_101136082 | 3300027866 | Populus Endosphere | MAQAALSRILIGPYGLHAFIGVMLALFVTFLWVFNFTTFF |
Ga0209590_100698733 | 3300027882 | Vadose Zone Soil | MNQILVGPYGLHAFLGVALALFLGFLYVFNFTTFF |
Ga0209415_100156966 | 3300027905 | Peatlands Soil | MAESAVSRILVGPYGLHAFGAVALVLFFTFLWAFNFTTFF |
Ga0207428_100846603 | 3300027907 | Populus Rhizosphere | MTIAALARILVGPGGLHAFGAVTLALFLAFLWFFNFTAFF |
Ga0207428_108645412 | 3300027907 | Populus Rhizosphere | MQSGTLTRVFIGPFGLHAFGIVVLALFALFLWAFNFTTFF |
Ga0209006_101901854 | 3300027908 | Forest Soil | MEQSAMSKVLVGPYGLHAFGGVLLIMFFVFLWVFNFTSFF |
Ga0209069_100829363 | 3300027915 | Watersheds | MENSAVARILVGPYGLHAFGAVVLSLFLAFLWVFNFTSFF |
Ga0268266_115712022 | 3300028379 | Switchgrass Rhizosphere | MAQAALARILIGPYGLHAFIGVMLALFAAFLWVFNFTTFF |
Ga0265318_103972172 | 3300028577 | Rhizosphere | QATIAKTLVGPYGLHAVGAALVALFVGFLVVFNFTNFF |
Ga0307322_102401491 | 3300028710 | Soil | MAQAALSRILVGPYGLHAFVAVTLALFVAFLWVFNF |
Ga0307285_100426933 | 3300028712 | Soil | MAQAALSRILVGPYGLHAFVAVTLALFVAFLLVFNFTTFF |
Ga0307285_101362443 | 3300028712 | Soil | AQAALSRLLIGPYGLHAFIGVMLALFVAFLWVFNFTTFF |
Ga0307303_100618251 | 3300028713 | Soil | MAQAALSRILVGPYGLHAFVAVTLALFVAFLWVFNFTTF |
Ga0307306_101069921 | 3300028782 | Soil | AQAALSRILVGPYGLHAFVAVTLALFVAFLWVFNFTTFF |
Ga0307299_102025291 | 3300028793 | Soil | AALSRILVGPYGLHAFVAVTLALFVAFLWVFNFTTFF |
Ga0307299_102964651 | 3300028793 | Soil | MAQAALSRILVGPYGLHAFVAVTLALFVAFLWVFNFT |
Ga0307305_100977674 | 3300028807 | Soil | NQGGMGAMAQAALSRILVGPYGLHAFVAVMLALFVAFLWVFNFTTFF |
Ga0307294_103560562 | 3300028810 | Soil | AQAALSRILVGPYGLHAFVAVMLALFVAFLWVFNFTTFF |
Ga0307286_102350941 | 3300028876 | Soil | MAQAALSRLLIGPYGLHAFIGVMLALFVAFLWVFNF |
Ga0308201_100955491 | 3300031091 | Soil | MAQAALSRLLIGPYGLHAFIGVMLALFVAFLWVFNCTTVF |
Ga0307500_100594543 | 3300031198 | Soil | VSLAQAALSRILVGPYGLHAFVAVMLALFVAFLWVFNFTTFF |
Ga0307497_100313614 | 3300031226 | Soil | LSRILVGPYGLHAFVAVMLALFVAFLWVFNFTTFF |
Ga0265340_100103446 | 3300031247 | Rhizosphere | MTQATIAKTLVGPYGLHAVGAALVALFVGFLVVFNFTNFF |
Ga0265340_104192502 | 3300031247 | Rhizosphere | MAQATIARTLVGPYGLHVAGAALVALFAGFLYVFNFTNFF |
Ga0170820_127481311 | 3300031446 | Forest Soil | MAQAALSRILVGPYGLHAFVAVMLALFAAFLWVFNFTTFF |
Ga0247727_108865922 | 3300031576 | Biofilm | MERSAAARLFIGPYGLHGFSIVALLVFLVFLWAFNFTSFF |
Ga0307469_100923516 | 3300031720 | Hardwood Forest Soil | MTQSAVSRIFVGPYGLRAFGIVVLTPFVTFLWAFNFTNFF |
Ga0307469_105795872 | 3300031720 | Hardwood Forest Soil | MTRSAVSRIFVGPYGLHAFGIVVLTLLVTFVWAFNFTNFF |
Ga0307468_1001168352 | 3300031740 | Hardwood Forest Soil | MTRSAVSRIFVGPYGLRAFGIVVLTLFVTFLWAFNFTNFF |
Ga0307468_1007792022 | 3300031740 | Hardwood Forest Soil | MQQADMARILIGPFGLHAAGIVMLALFALFLWAFNFTTFF |
Ga0306919_103419461 | 3300031879 | Soil | MTQTAISGILIGPYGLHALVAAVLVLFLGFLSVFNFTTFF |
Ga0310916_100876905 | 3300031942 | Soil | MAQTTVSKTLVGPYGLHAFLVVLLVLFLGFLWLFNFTTFF |
Ga0310910_111523261 | 3300031946 | Soil | MKQSTASRILVGPYGLHPFGFVVLAFFLAFLWVFN |
Ga0306922_107717234 | 3300032001 | Soil | TTVSKTLVGPYGLHAFLVVLLVLFLGFLWLFNFTTFF |
Ga0310906_110091431 | 3300032013 | Soil | MAQTALARILVGPYGLHAFLGVMLALFLAFLWVFNFTTFF |
Ga0310911_102986112 | 3300032035 | Soil | MTQTAISRILIGPYGLHALVAAVLVLFLGFLSVFNFTTFF |
Ga0372943_0029485_852_974 | 3300034268 | Soil | MQQSAAAKIMVGPYGLHAFGLLVLAVFTTFLWLFNFTTFF |
Ga0373959_0144321_167_298 | 3300034820 | Rhizosphere Soil | MGAMAQAALSRILIGPYGLHAFIGVMLALFVAFLWVFNFTTFF |
⦗Top⦘ |