Metagenome / Metatranscriptome Family F033018

Basic Information
Family ID	F033018
Family Type	Metagenome / Metatranscriptome
Number of Sequences	178
Average Sequence Length	40 residues
Representative Sequence	MAQAALSRILVGPYGLHAFVAVMLALFVAFLWVFNFTTFF
Number of Associated Samples	154
Number of Associated Scaffolds	178

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	65.73 %
% of genes near scaffold ends (potentially truncated)	25.28 %
% of genes from short scaffolds (< 2000 bps)	79.21 %
Associated GOLD sequencing projects	148
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.51

Most Common Taxonomy
Group	Bacteria (79.775 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (13.483 % of family members)
Environment Ontology (ENVO)	Unclassified (21.348 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (49.438 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 48.53% β-sheet: 0.00% Coil/Unstructured: 51.47%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 178 Family Scaffolds
PF07369	DUF1488	46.07
PF01165	Ribosomal_S21	7.30
PF00075	RNase_H	6.18
PF00313	CSD	3.93
PF08379	Bact_transglu_N	1.69
PF00487	FA_desaturase	1.12
PF04546	Sigma70_ner	1.12
PF01636	APH	1.12
PF05977	MFS_3	1.12
PF04392	ABC_sub_bind	1.12
PF01527	HTH_Tnp_1	0.56
PF01266	DAO	0.56
PF13505	OMP_b-brl	0.56
PF02738	MoCoBD_1	0.56
PF00905	Transpeptidase	0.56
PF13683	rve_3	0.56
PF14534	DUF4440	0.56
PF02622	DUF179	0.56
PF07995	GSDH	0.56
PF06897	DUF1269	0.56
PF05940	NnrS	0.56
PF02195	ParBc	0.56
PF01936	NYN	0.56
PF00271	Helicase_C	0.56
PF00270	DEAD	0.56
PF03401	TctC	0.56

COG ID	Name	Functional Category	% Frequency in 178 Family Scaffolds
COG0828	Ribosomal protein S21	Translation, ribosomal structure and biogenesis [J]	7.30
COG1305	Transglutaminase-like enzyme, putative cysteine protease	Posttranslational modification, protein turnover, chaperones [O]	1.69
COG0568	DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)	Transcription [K]	1.12
COG1398	Fatty-acid desaturase	Lipid transport and metabolism [I]	1.12
COG2814	Predicted arabinose efflux permease AraJ, MFS family	Carbohydrate transport and metabolism [G]	1.12
COG2984	ABC-type uncharacterized transport system, periplasmic component	General function prediction only [R]	1.12
COG3239	Fatty acid desaturase	Lipid transport and metabolism [I]	1.12
COG1432	NYN domain, predicted PIN-related RNAse, tRNA/rRNA maturation	General function prediction only [R]	0.56
COG1678	Putative transcriptional regulator, AlgH/UPF0301 family	Transcription [K]	0.56
COG2133	Glucose/arabinose dehydrogenase, beta-propeller fold	Carbohydrate transport and metabolism [G]	0.56
COG3181	Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC	Energy production and conversion [C]	0.56
COG3213	Nitric oxide response protein NnrS	Signal transduction mechanisms [T]	0.56
COG4803	Uncharacterized membrane protein	Function unknown [S]	0.56

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	79.78 %
Unclassified	root	N/A	20.22 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	79.78 %
Unclassified	root	N/A	20.22 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	79.78 %
Unclassified	root	N/A	20.22 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	73.60 %
Unclassified	root	N/A	20.22 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.56 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	45.51 %
Unclassified	root	N/A	20.22 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.56 %

Name	Rank	Taxonomy	Distribution
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	37.64 %
Unclassified	root	N/A	20.22 %
unclassified Alphaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria	1.69 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	0.56 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.56 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	20.22 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	10.11 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1.69 %
unclassified Rhodospirillales	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales	0.56 %
Streptomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales	0.56 %
Hyphomicrobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	0.56 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	20.22 %
unclassified Bradyrhizobiaceae	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae	4.49 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	3.93 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1.69 %
Rhodospirillales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium	0.56 %
Streptomycetaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae	0.56 %
Hyphomicrobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	0.56 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	20.22 %
Bradyrhizobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium	4.49 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1.69 %
unclassified Bradyrhizobium	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium	0.56 %
Streptomyces	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces	0.56 %
Rhodospirillales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium	0.56 %
Hyphomicrobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	0.56 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	20.22 %
Bradyrhizobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium	4.49 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1.69 %
Bradyrhizobium sp. 187	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 187	0.56 %
Streptomyces afghaniensis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces afghaniensis	0.56 %
Rhodospirillales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium	0.56 %
Hyphomicrobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	0.56 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	20.22 %
Bradyrhizobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium	4.49 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1.69 %
Streptomyces afghaniensis 772	strain	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces afghaniensis → Streptomyces afghaniensis 772	0.56 %
Bradyrhizobium sp. 187	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 187	0.56 %
Rhodospirillales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium	0.56 %
Hyphomicrobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	0.56 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2170459003\|FZN2CUW02H6STK	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium	501	Open in IMG/M
2199352025\|deepsgr__Contig_14841	Not Available	965	Open in IMG/M
3300000364\|INPhiseqgaiiFebDRAFT_100328568	Not Available	503	Open in IMG/M
3300000787\|JGI11643J11755_11557205	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium	663	Open in IMG/M
3300000956\|JGI10216J12902_100697441	All Organisms → cellular organisms → Bacteria	736	Open in IMG/M
3300001686\|C688J18823_11115735	All Organisms → cellular organisms → Bacteria → Proteobacteria	500	Open in IMG/M
3300001991\|JGI24743J22301_10064048	All Organisms → cellular organisms → Bacteria → Proteobacteria	760	Open in IMG/M
3300002245\|JGIcombinedJ26739_100160831	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2123	Open in IMG/M
3300002568\|C688J35102_120976367	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	4226	Open in IMG/M
3300004062\|Ga0055500_10155819	Not Available	543	Open in IMG/M
3300004114\|Ga0062593_101027833	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	848	Open in IMG/M
3300004152\|Ga0062386_100387948	All Organisms → cellular organisms → Bacteria → Proteobacteria	1123	Open in IMG/M
3300004152\|Ga0062386_100619709	All Organisms → cellular organisms → Bacteria → Proteobacteria	885	Open in IMG/M
3300004153\|Ga0063455_100810653	Not Available	650	Open in IMG/M
3300004156\|Ga0062589_102062893	All Organisms → cellular organisms → Bacteria → Proteobacteria	580	Open in IMG/M
3300004479\|Ga0062595_101307604	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	653	Open in IMG/M
3300004778\|Ga0062383_10224115	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	877	Open in IMG/M
3300005164\|Ga0066815_10080004	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium	587	Open in IMG/M
3300005169\|Ga0066810_10087188	All Organisms → cellular organisms → Bacteria → Proteobacteria	672	Open in IMG/M
3300005179\|Ga0066684_10195486	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium	1306	Open in IMG/M
3300005184\|Ga0066671_10661663	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	677	Open in IMG/M
3300005355\|Ga0070671_100464338	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	1087	Open in IMG/M
3300005436\|Ga0070713_100231806	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	1679	Open in IMG/M
3300005545\|Ga0070695_100643554	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	836	Open in IMG/M
3300005569\|Ga0066705_10086917	Not Available	1836	Open in IMG/M
3300005575\|Ga0066702_10520228	Not Available	722	Open in IMG/M
3300005576\|Ga0066708_10851131	All Organisms → cellular organisms → Bacteria → Proteobacteria	570	Open in IMG/M
3300005598\|Ga0066706_10746736	Not Available	776	Open in IMG/M
3300005713\|Ga0066905_100994107	Not Available	739	Open in IMG/M
3300005713\|Ga0066905_101518994	All Organisms → cellular organisms → Bacteria → Proteobacteria	610	Open in IMG/M
3300005718\|Ga0068866_10003446	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	6473	Open in IMG/M
3300005981\|Ga0081538_10152388	All Organisms → cellular organisms → Bacteria	1044	Open in IMG/M
3300005983\|Ga0081540_1009217	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	6807	Open in IMG/M
3300006031\|Ga0066651_10630800	Not Available	571	Open in IMG/M
3300006038\|Ga0075365_10005288	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	6945	Open in IMG/M
3300006046\|Ga0066652_101348384	All Organisms → cellular organisms → Bacteria → Proteobacteria	670	Open in IMG/M
3300006047\|Ga0075024_100054819	All Organisms → cellular organisms → Bacteria → Proteobacteria	1673	Open in IMG/M
3300006057\|Ga0075026_100696288	All Organisms → cellular organisms → Bacteria → Proteobacteria	607	Open in IMG/M
3300006057\|Ga0075026_100733509	All Organisms → cellular organisms → Bacteria → Proteobacteria	593	Open in IMG/M
3300006057\|Ga0075026_100816306	Not Available	567	Open in IMG/M
3300006576\|Ga0074047_12046019	All Organisms → cellular organisms → Bacteria → Proteobacteria	1343	Open in IMG/M
3300006581\|Ga0074048_13126719	All Organisms → cellular organisms → Bacteria → Proteobacteria	581	Open in IMG/M
3300006797\|Ga0066659_10140700	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1703	Open in IMG/M
3300006800\|Ga0066660_10088918	All Organisms → cellular organisms → Bacteria	2153	Open in IMG/M
3300006852\|Ga0075433_10113671	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2402	Open in IMG/M
3300006852\|Ga0075433_10136080	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2184	Open in IMG/M
3300006854\|Ga0075425_100014240	All Organisms → cellular organisms → Bacteria	8582	Open in IMG/M
3300007788\|Ga0099795_10438032	All Organisms → cellular organisms → Bacteria → Proteobacteria	600	Open in IMG/M
3300009012\|Ga0066710_100211872	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2769	Open in IMG/M
3300009090\|Ga0099827_10421284	All Organisms → cellular organisms → Bacteria → Proteobacteria	1142	Open in IMG/M
3300009094\|Ga0111539_10062067	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	4425	Open in IMG/M
3300009553\|Ga0105249_12756408	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium	563	Open in IMG/M
3300009813\|Ga0105057_1017213	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium	1032	Open in IMG/M
3300009840\|Ga0126313_10027489	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3867	Open in IMG/M
3300010036\|Ga0126305_10031863	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2879	Open in IMG/M
3300010037\|Ga0126304_10463527	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	849	Open in IMG/M
3300010040\|Ga0126308_10639822	All Organisms → cellular organisms → Bacteria → Proteobacteria	728	Open in IMG/M
3300010041\|Ga0126312_11421246	All Organisms → cellular organisms → Bacteria → Proteobacteria	514	Open in IMG/M
3300010154\|Ga0127503_10208223	All Organisms → cellular organisms → Bacteria → Proteobacteria	1168	Open in IMG/M
3300010339\|Ga0074046_10087268	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2021	Open in IMG/M
3300010360\|Ga0126372_10337172	Not Available	1345	Open in IMG/M
3300010373\|Ga0134128_12151297	Not Available	614	Open in IMG/M
3300010379\|Ga0136449_100419698	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2363	Open in IMG/M
3300010391\|Ga0136847_12544594	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 187	856	Open in IMG/M
3300010396\|Ga0134126_11479989	Not Available	749	Open in IMG/M
3300010396\|Ga0134126_12611995	All Organisms → cellular organisms → Bacteria → Proteobacteria	548	Open in IMG/M
3300010397\|Ga0134124_11462481	Not Available	710	Open in IMG/M
3300010864\|Ga0126357_1067693	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	506	Open in IMG/M
3300010865\|Ga0126346_1393247	Not Available	825	Open in IMG/M
3300010867\|Ga0126347_1006958	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	513	Open in IMG/M
3300010867\|Ga0126347_1066391	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	633	Open in IMG/M
3300010867\|Ga0126347_1464541	Not Available	514	Open in IMG/M
3300011119\|Ga0105246_10167342	Not Available	1680	Open in IMG/M
3300011120\|Ga0150983_10279270	All Organisms → cellular organisms → Bacteria → Proteobacteria	889	Open in IMG/M
3300011120\|Ga0150983_10617777	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1481	Open in IMG/M
3300011423\|Ga0137436_1035149	All Organisms → cellular organisms → Bacteria	1263	Open in IMG/M
3300012096\|Ga0137389_10327052	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1301	Open in IMG/M
3300012199\|Ga0137383_11108606	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium	573	Open in IMG/M
3300012203\|Ga0137399_11010017	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	700	Open in IMG/M
3300012203\|Ga0137399_11023067	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	696	Open in IMG/M
3300012204\|Ga0137374_10015604	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	8749	Open in IMG/M
3300012204\|Ga0137374_10020663	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	7464	Open in IMG/M
3300012204\|Ga0137374_10021773	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	7247	Open in IMG/M
3300012212\|Ga0150985_103615718	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	6730	Open in IMG/M
3300012212\|Ga0150985_117796713	All Organisms → cellular organisms → Bacteria → Proteobacteria	771	Open in IMG/M
3300012383\|Ga0134033_1043550	All Organisms → cellular organisms → Bacteria	743	Open in IMG/M
3300012389\|Ga0134040_1242787	All Organisms → cellular organisms → Bacteria	656	Open in IMG/M
3300012469\|Ga0150984_104211309	All Organisms → cellular organisms → Bacteria → Proteobacteria	507	Open in IMG/M
3300012469\|Ga0150984_106827344	All Organisms → cellular organisms → Bacteria → Proteobacteria	1201	Open in IMG/M
3300012469\|Ga0150984_121830977	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1180	Open in IMG/M
3300012915\|Ga0157302_10135491	All Organisms → cellular organisms → Bacteria	820	Open in IMG/M
3300012917\|Ga0137395_10091148	All Organisms → cellular organisms → Bacteria → Proteobacteria	2008	Open in IMG/M
3300012986\|Ga0164304_10354504	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1026	Open in IMG/M
3300013102\|Ga0157371_11338249	All Organisms → cellular organisms → Bacteria → Proteobacteria	555	Open in IMG/M
3300013306\|Ga0163162_11353677	All Organisms → cellular organisms → Bacteria → Proteobacteria	809	Open in IMG/M
3300014501\|Ga0182024_10308236	All Organisms → cellular organisms → Bacteria → Proteobacteria	2088	Open in IMG/M
3300014745\|Ga0157377_11112162	All Organisms → cellular organisms → Bacteria → Proteobacteria	606	Open in IMG/M
3300014965\|Ga0120193_10098249	Not Available	509	Open in IMG/M
3300015201\|Ga0173478_10020143	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1885	Open in IMG/M
3300015201\|Ga0173478_10791702	Not Available	519	Open in IMG/M
3300015245\|Ga0137409_10944868	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces afghaniensis → Streptomyces afghaniensis 772	699	Open in IMG/M
3300015371\|Ga0132258_10230779	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	4509	Open in IMG/M
3300015371\|Ga0132258_10344477	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3683	Open in IMG/M
3300015372\|Ga0132256_101908265	All Organisms → cellular organisms → Bacteria → Proteobacteria	701	Open in IMG/M
3300016341\|Ga0182035_10685354	Not Available	892	Open in IMG/M
3300016422\|Ga0182039_11409202	Not Available	633	Open in IMG/M
3300018027\|Ga0184605_10013162	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3212	Open in IMG/M
3300018054\|Ga0184621_10129077	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	906	Open in IMG/M
3300018056\|Ga0184623_10200657	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium	917	Open in IMG/M
3300018062\|Ga0187784_11497890	Not Available	534	Open in IMG/M
3300018067\|Ga0184611_1016111	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2235	Open in IMG/M
3300018071\|Ga0184618_10257198	Not Available	739	Open in IMG/M
3300018081\|Ga0184625_10399433	All Organisms → cellular organisms → Bacteria → Proteobacteria	709	Open in IMG/M
3300018429\|Ga0190272_12035523	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	609	Open in IMG/M
3300018431\|Ga0066655_10367331	All Organisms → cellular organisms → Bacteria → Proteobacteria	947	Open in IMG/M
3300018469\|Ga0190270_12529961	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium	575	Open in IMG/M
3300018481\|Ga0190271_10415393	All Organisms → cellular organisms → Bacteria → Proteobacteria	1443	Open in IMG/M
3300019263\|Ga0184647_1072869	All Organisms → cellular organisms → Bacteria → Proteobacteria	737	Open in IMG/M
3300019356\|Ga0173481_10222658	Not Available	832	Open in IMG/M
3300019767\|Ga0190267_10130193	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1062	Open in IMG/M
3300019889\|Ga0193743_1186529	All Organisms → cellular organisms → Bacteria → Proteobacteria	674	Open in IMG/M
3300020002\|Ga0193730_1068782	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1010	Open in IMG/M
3300021180\|Ga0210396_11162330	Not Available	647	Open in IMG/M
3300021401\|Ga0210393_10110234	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2196	Open in IMG/M
3300021420\|Ga0210394_10808898	All Organisms → cellular organisms → Bacteria → Proteobacteria	818	Open in IMG/M
3300025900\|Ga0207710_10028299	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2433	Open in IMG/M
3300025904\|Ga0207647_10769959	Not Available	520	Open in IMG/M
3300025915\|Ga0207693_10046342	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3415	Open in IMG/M
3300025920\|Ga0207649_11580184	All Organisms → cellular organisms → Bacteria → Proteobacteria	519	Open in IMG/M
3300025931\|Ga0207644_10364326	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1176	Open in IMG/M
3300025986\|Ga0207658_10300535	All Organisms → cellular organisms → Bacteria → Proteobacteria	1382	Open in IMG/M
3300026215\|Ga0209849_1075877	All Organisms → cellular organisms → Bacteria → Proteobacteria	593	Open in IMG/M
3300026552\|Ga0209577_10041424	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3942	Open in IMG/M
3300026557\|Ga0179587_10221384	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1204	Open in IMG/M
3300027273\|Ga0209886_1011425	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1286	Open in IMG/M
3300027625\|Ga0208044_1079670	All Organisms → cellular organisms → Bacteria	984	Open in IMG/M
3300027703\|Ga0207862_1223936	All Organisms → cellular organisms → Bacteria → Proteobacteria	555	Open in IMG/M
3300027812\|Ga0209656_10066762	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1972	Open in IMG/M
3300027812\|Ga0209656_10418851	All Organisms → cellular organisms → Bacteria → Proteobacteria	597	Open in IMG/M
3300027824\|Ga0209040_10029586	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	3479	Open in IMG/M
3300027866\|Ga0209813_10113608	All Organisms → cellular organisms → Bacteria → Proteobacteria	936	Open in IMG/M
3300027882\|Ga0209590_10069873	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2019	Open in IMG/M
3300027905\|Ga0209415_10015696	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	12249	Open in IMG/M
3300027907\|Ga0207428_10084660	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2470	Open in IMG/M
3300027907\|Ga0207428_10864541	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	640	Open in IMG/M
3300027908\|Ga0209006_10190185	Not Available	1787	Open in IMG/M
3300027915\|Ga0209069_10082936	All Organisms → cellular organisms → Bacteria → Proteobacteria	1533	Open in IMG/M
3300028379\|Ga0268266_11571202	Not Available	633	Open in IMG/M
3300028577\|Ga0265318_10397217	Not Available	504	Open in IMG/M
3300028710\|Ga0307322_10240149	Not Available	502	Open in IMG/M
3300028712\|Ga0307285_10042693	All Organisms → cellular organisms → Bacteria → Proteobacteria	1115	Open in IMG/M
3300028712\|Ga0307285_10136244	All Organisms → cellular organisms → Bacteria → Proteobacteria	666	Open in IMG/M
3300028713\|Ga0307303_10061825	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	811	Open in IMG/M
3300028782\|Ga0307306_10106992	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	750	Open in IMG/M
3300028793\|Ga0307299_10202529	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	746	Open in IMG/M
3300028793\|Ga0307299_10296465	Not Available	607	Open in IMG/M
3300028807\|Ga0307305_10097767	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1356	Open in IMG/M
3300028810\|Ga0307294_10356056	All Organisms → cellular organisms → Bacteria → Proteobacteria	542	Open in IMG/M
3300028876\|Ga0307286_10235094	Not Available	669	Open in IMG/M
3300031091\|Ga0308201_10095549	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	848	Open in IMG/M
3300031198\|Ga0307500_10059454	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	944	Open in IMG/M
3300031226\|Ga0307497_10031361	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1735	Open in IMG/M
3300031247\|Ga0265340_10010344	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	4991	Open in IMG/M
3300031247\|Ga0265340_10419250	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	590	Open in IMG/M
3300031446\|Ga0170820_12748131	All Organisms → cellular organisms → Bacteria → Proteobacteria	518	Open in IMG/M
3300031576\|Ga0247727_10886592	Not Available	628	Open in IMG/M
3300031720\|Ga0307469_10092351	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2095	Open in IMG/M
3300031720\|Ga0307469_10579587	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	999	Open in IMG/M
3300031740\|Ga0307468_100116835	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1631	Open in IMG/M
3300031740\|Ga0307468_100779202	Not Available	812	Open in IMG/M
3300031879\|Ga0306919_10341946	Not Available	1142	Open in IMG/M
3300031942\|Ga0310916_10087690	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2474	Open in IMG/M
3300031946\|Ga0310910_11152326	All Organisms → cellular organisms → Bacteria → Proteobacteria	602	Open in IMG/M
3300032001\|Ga0306922_10771723	All Organisms → cellular organisms → Bacteria	1007	Open in IMG/M
3300032013\|Ga0310906_11009143	All Organisms → cellular organisms → Bacteria → Proteobacteria	598	Open in IMG/M
3300032035\|Ga0310911_10298611	Not Available	927	Open in IMG/M
3300034268\|Ga0372943_0029485	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2971	Open in IMG/M
3300034820\|Ga0373959_0144321	All Organisms → cellular organisms → Bacteria → Proteobacteria	598	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	79.78%
Host-Associated	Host-Associated	20.22%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	67.42%
Plants	Host-Associated → Plants	20.22%
Aquatic	Environmental → Aquatic	12.36%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	66.85%
Rhizosphere	Host-Associated → Plants → Rhizosphere	13.48%
Sediment	Environmental → Aquatic → Sediment	6.74%
Freshwater	Environmental → Aquatic → Freshwater	5.06%
Rhizoplane	Host-Associated → Plants → Rhizoplane	5.06%
Roots	Host-Associated → Plants → Roots	1.69%
Marine	Environmental → Aquatic → Marine	0.56%
Cave	Environmental → Terrestrial → Cave	0.56%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	56.18%
Loam	Environmental → Terrestrial → Soil → Loam	7.30%
Soil	Host-Associated → Plants → Rhizosphere → Soil	7.30%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	6.74%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	6.18%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	3.37%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	2.25%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	2.25%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	2.81%
Sand	Environmental → Terrestrial → Soil → Sand	1.12%
Bulk Soil	Host-Associated → Plants → Roots → Bulk Soil	1.12%
Sediment	Environmental → Aquatic → Freshwater → Sediment	0.56%
Lake	Environmental → Aquatic → Freshwater → Lake	0.56%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	0.56%
Wetlands	Environmental → Aquatic → Marine → Wetlands	0.56%
Unclassified	Environmental → Terrestrial → Cave → Unclassified	0.56%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.56%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	35.39%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	9.55%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	8.99%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	7.30%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	6.74%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	6.18%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	3.93%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	2.25%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog	2.81%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	2.81%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	1.69%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	1.69%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	1.69%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	1.12%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost	1.12%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	1.12%
Unclassified	Host-Associated → Plants → Roots → Bulk Soil → Unclassified	1.12%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	0.56%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	0.56%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	0.56%
Unclassified	Environmental → Aquatic → Freshwater → Groundwater → Unclassified	0.56%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	0.56%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	0.56%
Unclassified	Environmental → Terrestrial → Cave → Unclassified → Unclassified	0.56%
Unclassified	Host-Associated → Plants → Roots → Rhizosphere → Unclassified	0.56%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	13.48%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	7.87%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	7.30%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	3.93%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	3.37%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	3.37%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	2.25%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	2.25%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	2.25%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	2.25%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	2.25%
Bog Forest Soil	Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil	2.81%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	2.81%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	2.81%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	2.81%
Boreal Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil	2.81%
Peatlands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil	1.69%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	1.69%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	1.69%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	1.69%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	1.69%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere	1.69%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere	1.69%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	1.12%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	1.12%
Groundwater Sand	Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand	1.12%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	1.12%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	1.12%
Populus Endosphere	Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere	1.12%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.12%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	0.56%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment	0.56%
Wetland Sediment	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment	0.56%
Soil	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil	0.56%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	0.56%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	0.56%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	0.56%
Terrestrial	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial	0.56%
Grass Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil	0.56%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	0.56%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	0.56%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	0.56%
Bog Forest Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil	0.56%
Soil	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil	0.56%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost	0.56%
Biofilm	Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm	0.56%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	0.56%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	0.56%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.56%
Corn, Switchgrass And Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	0.56%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.56%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere	0.56%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.56%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.56%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.56%
Rhizosphere Soil	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil	0.56%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	0.56%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	0.56%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2170459003	Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm	Environmental	Open in IMG/M
2199352025	Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL	Environmental	Open in IMG/M
3300000364	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300000787	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental	Open in IMG/M
3300000956	Soil microbial communities from Great Prairies - Kansas, Native Prairie soil	Environmental	Open in IMG/M
3300001686	Grasslands soil microbial communities from Hopland, California, USA	Environmental	Open in IMG/M
3300001991	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2	Host-Associated	Open in IMG/M
3300002245	Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)	Environmental	Open in IMG/M
3300002568	Grasslands soil microbial communities from Hopland, California, USA - 2	Environmental	Open in IMG/M
3300004062	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D2	Environmental	Open in IMG/M
3300004114	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5	Environmental	Open in IMG/M
3300004152	Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3	Environmental	Open in IMG/M
3300004153	Grasslands soil microbial communities from Hopland, California, USA (version 2)	Environmental	Open in IMG/M
3300004156	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1	Environmental	Open in IMG/M
3300004479	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs	Environmental	Open in IMG/M
3300004778	Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh	Environmental	Open in IMG/M
3300005164	Soil and rhizosphere microbial communities from Laval, Canada - mgLAC	Environmental	Open in IMG/M
3300005169	Soil and rhizosphere microbial communities from Laval, Canada - mgHPA	Environmental	Open in IMG/M
3300005179	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133	Environmental	Open in IMG/M
3300005184	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120	Environmental	Open in IMG/M
3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Host-Associated	Open in IMG/M
3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Environmental	Open in IMG/M
3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Environmental	Open in IMG/M
3300005569	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154	Environmental	Open in IMG/M
3300005575	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151	Environmental	Open in IMG/M
3300005576	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157	Environmental	Open in IMG/M
3300005598	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155	Environmental	Open in IMG/M
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental	Open in IMG/M
3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Host-Associated	Open in IMG/M
3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Host-Associated	Open in IMG/M
3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Host-Associated	Open in IMG/M
3300006031	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100	Environmental	Open in IMG/M
3300006038	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Host-Associated	Open in IMG/M
3300006046	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101	Environmental	Open in IMG/M
3300006047	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013	Environmental	Open in IMG/M
3300006057	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012	Environmental	Open in IMG/M
3300006576	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPA (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006581	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006797	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108	Environmental	Open in IMG/M
3300006800	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109	Environmental	Open in IMG/M
3300006852	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Host-Associated	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300007788	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2	Environmental	Open in IMG/M
3300009012	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159	Environmental	Open in IMG/M
3300009090	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG	Environmental	Open in IMG/M
3300009094	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)	Host-Associated	Open in IMG/M
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated	Open in IMG/M
3300009813	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_10_20	Environmental	Open in IMG/M
3300009840	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A	Environmental	Open in IMG/M
3300010036	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26	Environmental	Open in IMG/M
3300010037	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25	Environmental	Open in IMG/M
3300010040	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55	Environmental	Open in IMG/M
3300010041	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A	Environmental	Open in IMG/M
3300010154	Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010339	Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3	Environmental	Open in IMG/M
3300010360	Tropical forest soil microbial communities from Panama - MetaG Plot_6	Environmental	Open in IMG/M
3300010373	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4	Environmental	Open in IMG/M
3300010379	Sb_50d combined assembly	Environmental	Open in IMG/M
3300010391	Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406	Environmental	Open in IMG/M
3300010396	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2	Environmental	Open in IMG/M
3300010397	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4	Environmental	Open in IMG/M
3300010864	Boreal forest soil eukaryotic communities from Alaska, USA - W3-5 Metatranscriptome (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300010865	Boreal forest soil eukaryotic communities from Alaska, USA - C3-3 Metatranscriptome (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300010867	Boreal forest soil eukaryotic communities from Alaska, USA - C3-5 Metatranscriptome (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Host-Associated	Open in IMG/M
3300011120	Combined assembly of Microbial Forest Soil metaT	Environmental	Open in IMG/M
3300011423	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT119_2	Environmental	Open in IMG/M
3300012096	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG	Environmental	Open in IMG/M
3300012199	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG	Environmental	Open in IMG/M
3300012203	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG	Environmental	Open in IMG/M
3300012204	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG	Environmental	Open in IMG/M
3300012212	Combined assembly of Hopland grassland soil	Host-Associated	Open in IMG/M
3300012383	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_4_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012389	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_16_2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012469	Combined assembly of Soil carbon rhizosphere	Host-Associated	Open in IMG/M
3300012915	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2	Environmental	Open in IMG/M
3300012917	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG	Environmental	Open in IMG/M
3300012986	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG	Environmental	Open in IMG/M
3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Host-Associated	Open in IMG/M
3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Host-Associated	Open in IMG/M
3300014501	Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)	Environmental	Open in IMG/M
3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Host-Associated	Open in IMG/M
3300014965	Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T2	Environmental	Open in IMG/M
3300015201	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)	Environmental	Open in IMG/M
3300015245	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015372	Soil combined assembly	Host-Associated	Open in IMG/M
3300016341	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170	Environmental	Open in IMG/M
3300016422	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111	Environmental	Open in IMG/M
3300018027	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex	Environmental	Open in IMG/M
3300018054	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1	Environmental	Open in IMG/M
3300018056	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1	Environmental	Open in IMG/M
3300018062	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG	Environmental	Open in IMG/M
3300018067	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex	Environmental	Open in IMG/M
3300018071	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1	Environmental	Open in IMG/M
3300018081	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1	Environmental	Open in IMG/M
3300018429	Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T	Environmental	Open in IMG/M
3300018431	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104	Environmental	Open in IMG/M
3300018469	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T	Environmental	Open in IMG/M
3300018481	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T	Environmental	Open in IMG/M
3300019263	Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300019356	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)	Environmental	Open in IMG/M
3300019767	Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T	Environmental	Open in IMG/M
3300019889	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2c2	Environmental	Open in IMG/M
3300020002	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1	Environmental	Open in IMG/M
3300021180	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O	Environmental	Open in IMG/M
3300021401	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O	Environmental	Open in IMG/M
3300021420	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M	Environmental	Open in IMG/M
3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)	Host-Associated	Open in IMG/M
3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026215	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 (SPAdes)	Environmental	Open in IMG/M
3300026552	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)	Environmental	Open in IMG/M
3300026557	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal	Environmental	Open in IMG/M
3300027273	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_40_50 (SPAdes)	Environmental	Open in IMG/M
3300027625	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes)	Environmental	Open in IMG/M
3300027703	Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes)	Environmental	Open in IMG/M
3300027812	Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes)	Environmental	Open in IMG/M
3300027824	Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes)	Environmental	Open in IMG/M
3300027866	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes)	Host-Associated	Open in IMG/M
3300027882	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)	Environmental	Open in IMG/M
3300027905	Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)	Environmental	Open in IMG/M
3300027907	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)	Host-Associated	Open in IMG/M
3300027908	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)	Environmental	Open in IMG/M
3300027915	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)	Environmental	Open in IMG/M
3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300028577	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG	Host-Associated	Open in IMG/M
3300028710	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380	Environmental	Open in IMG/M
3300028712	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139	Environmental	Open in IMG/M
3300028713	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184	Environmental	Open in IMG/M
3300028782	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193	Environmental	Open in IMG/M
3300028793	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159	Environmental	Open in IMG/M
3300028807	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186	Environmental	Open in IMG/M
3300028810	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151	Environmental	Open in IMG/M
3300028876	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140	Environmental	Open in IMG/M
3300031091	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031198	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_S	Environmental	Open in IMG/M
3300031226	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S	Environmental	Open in IMG/M
3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Host-Associated	Open in IMG/M
3300031446	Fir Summer Coassembly Site 11 - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031576	Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25	Environmental	Open in IMG/M
3300031720	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515	Environmental	Open in IMG/M
3300031740	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05	Environmental	Open in IMG/M
3300031879	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)	Environmental	Open in IMG/M
3300031942	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176	Environmental	Open in IMG/M
3300031946	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172	Environmental	Open in IMG/M
3300032001	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)	Environmental	Open in IMG/M
3300032013	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3	Environmental	Open in IMG/M
3300032035	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170	Environmental	Open in IMG/M
3300034268	Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2	Environmental	Open in IMG/M
3300034820	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2	Host-Associated	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.51
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.51
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F033018

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
E4A_03038700	2170459003	Grass Soil	MTQPAISRILVGPYGLHAFGAAVLVLFLAFLWVFN
deepsgr_02435550	2199352025	Soil	MAQAALSRILVGPYGLHAFVAVMLALFVAFLWVFNFTTFF
INPhiseqgaiiFebDRAFT_1003285682	3300000364	Soil	MAHEAISRVLVGPYGLHAFAAGVLALFAVFLWIFNFTSFF*
JGI11643J11755_115572052	3300000787	Soil	MAQTALARILVGPYGLHAFLGVMLALFVAFLWVFNFTTFF*
JGI10216J12902_1006974411	3300000956	Soil	MAQAALSRILIGPYGLHAFIGVMLALFVTFLWVFNFT
C688J18823_111157351	3300001686	Soil	MGQAALSRILIGPYGLHAFIGVMLALFVTFLWVFNFTTFF*
JGI24743J22301_100640482	3300001991	Corn, Switchgrass And Miscanthus Rhizosphere	MAQAALSRXLIGPYGLHAFIGVMLALFVAFLWVFNFTTFF*
JGIcombinedJ26739_1001608312	3300002245	Forest Soil	MEQSAMSKVLVGPYGLHAFGGVLLIMFFVFLWVFNFTSFF*
C688J35102_1209763673	3300002568	Soil	MASTAASKLLIGPYGLHAFLAVVLALFLGFLWLFNFTSFF*
Ga0055500_101558191	3300004062	Natural And Restored Wetlands	MAQAAISRVLIGPYGLHAFGIALLVLFAVFLWVFNFTHFFGGGAS*
Ga0062593_1010278332	3300004114	Soil	MAQTAFARILVGPYGLHAVLGVMLALFVAFLWVFNFTTFF*
Ga0062386_1003879482	3300004152	Bog Forest Soil	MGDAKAMAPTVASRILIGPYGLHAFLAVLLALFLGFLWLFNFTAFF*
Ga0062386_1006197092	3300004152	Bog Forest Soil	MGDAKAMAPTAASRILIGPYGLHAFLGVVLALFLGFLWLFNFTAFF*
Ga0063455_1008106531	3300004153	Soil	MAQAALARILIGPYGLHAFIGVMLALFAAFLWVFNFTTFF*
Ga0062589_1020628932	3300004156	Soil	MAQAALSRILIGPYGLHAFIGVMLALFVTFLWVFNFTTFF*
Ga0062595_1013076042	3300004479	Soil	MAQAAISRVLIGPYGLHAFGITLLVLFAVFLWAFNFTHFFGGGAF*
Ga0062383_102241153	3300004778	Wetland Sediment	MEQSATARILIGPYGLHGFSIVALVLFLLFLWAFNFTSFF*
Ga0066815_100800042	3300005164	Soil	MAQAALSRILVGPYGLHAFVAVMLALFVAFLWVFNFTTFF*
Ga0066810_100871882	3300005169	Soil	MAQAALSRILVGPYGLHAFVAVMLALFAAFLWVFNFTTFF*
Ga0066684_101954862	3300005179	Soil	MARSAASRVLVGPHGLHAFGLAAIAGLIVFLWIFNFTNFF*
Ga0066671_106616633	3300005184	Soil	MEQSAIARILVGPYGLHAFGFVVLSFFLAFLWVFNFTAFF*
Ga0070671_1004643381	3300005355	Switchgrass Rhizosphere	MAQTALARILVGPYGLHACLGVMLALFVAFLWVFNFTTFF*
Ga0070713_1002318063	3300005436	Corn, Switchgrass And Miscanthus Rhizosphere	MAQAALSRFLIGPYGLHAFIGVMLALFVAFLWVFNFTTFF*
Ga0070695_1006435542	3300005545	Corn, Switchgrass And Miscanthus Rhizosphere	MAQETIARTLVGPYGLHLFGAALLLMFIGFLVVFNFTNFF*
Ga0066705_100869173	3300005569	Soil	MEHSGSPKILAGSYGLYAFGLVALSLFLAFLWLFNFTSFF*
Ga0066702_105202281	3300005575	Soil	MEQSAIARILVGPYGLHAFGFVVLGFFLAFLWVFNFTTFF*
Ga0066708_108511312	3300005576	Soil	MCAMEQSAIARVLVGPYGLHAFGFVVLGFFLAFLWVFNFTTFF*
Ga0066706_107467362	3300005598	Soil	MEHSDSPKILAGSYGLYAFGLVALSLFLAFLWLFNFTSFF*
Ga0066905_1009941071	3300005713	Tropical Forest Soil	STASRILVGPYGLHAFGFVVLAFFPPFLWVFNFTSFF*
Ga0066905_1015189942	3300005713	Tropical Forest Soil	MQQAALARILSGPFGLHAAGIVTLALFALFLWAFNFTTFF*
Ga0068866_100034465	3300005718	Miscanthus Rhizosphere	MAQAALSRLLIGPYGLHAFIGVMLALFVAFLWVFNFTTFF*
Ga0081538_101523882	3300005981	Tabebuia Heterophylla Rhizosphere	MPQATLSRLLIGPFGLHAFIAGALVLFAGFLWVFNFTNFF*
Ga0081540_10092176	3300005983	Tabebuia Heterophylla Rhizosphere	MQQAALTRILGRPFGLHAAGIVMLALFALFLWAFNFTTFF*
Ga0066651_106308002	3300006031	Soil	MASTAASRLLIGPYGLHAFLAVVLALFLGFLWLFNFTSFC*
Ga0075365_100052881	3300006038	Populus Endosphere	MAQAALSRILVGPYGLHAFIAVMLAFFIAFLWVFNFTTFF*
Ga0066652_1013483842	3300006046	Soil	MASTAASRLLIGPYGLHAVVAVVLALFLGFLWLFNFTSFF*
Ga0075024_1000548192	3300006047	Watersheds	MENSAVARILVGPYGLHAFGAVVLSLFLAFLWVFNFTSFF*
Ga0075026_1006962882	3300006057	Watersheds	MAQAAISRVLIGPYGLHAFGFTLLALFAVFLWLFNFTHFFGGGAS*
Ga0075026_1007335091	3300006057	Watersheds	MMMSETCAMTQAVASRMRIGRYGLRAFGAVVLALFLAFLWVFNFTTFF*
Ga0075026_1008163062	3300006057	Watersheds	MAQAAISRVLIGPYGLHAFGIALLVLFAVFLWVFNFTHFFGGGAF*
Ga0074047_120460191	3300006576	Soil	AMAQAALSRILIGPYGLHAFIGVMLALFVAFLWVFNFTTFF*
Ga0074048_131267192	3300006581	Soil	LSRILVGPYGLHAFVAVMLALFAAFLWVFNFTTFF*
Ga0066659_101407001	3300006797	Soil	MEQSAIARILVGPYGLHAFGFVVLGFFLAFLWVFNFTAFF*
Ga0066660_100889181	3300006800	Soil	MEQSAIARVLVGPYGLHAFGFVVLGFFLAFLWVFNFTAFF*
Ga0075433_101136712	3300006852	Populus Rhizosphere	MQSGTLSRVFVGPFGLHAFGIVVLALFALFLWAFNFTTFF*
Ga0075433_101360803	3300006852	Populus Rhizosphere	MAQTALARILVGPYGLHAFLGVMLALFLAFLWVFNFTTFF*
Ga0075425_1000142407	3300006854	Populus Rhizosphere	MQSGTLTRVFIGPFGLHAFGIVVLALFALFLWAFNFTTFF*
Ga0099795_104380323	3300007788	Vadose Zone Soil	MAQAALSRILVGPYGLHAFVAVTLALFVAFLWVFNFTTFF*
Ga0066710_1002118728	3300009012	Grasslands Soil	MEHSDSPKILAGSYGLYAFGLVALSLFLAFLWLFNFTSFF
Ga0099827_104212842	3300009090	Vadose Zone Soil	MEQSAASRMLIGPYGLHAFGAVLLIFFLAFLWVFNFTNFF*
Ga0111539_100620673	3300009094	Populus Rhizosphere	MTIAALARILVGPGGLHAFGAVTLALFLAFLWFFNFTAFF*
Ga0105249_127564082	3300009553	Switchgrass Rhizosphere	MEQSAVSRILIGPYGLHAFGFGGLVVFVIFLWIFNFTKFF*
Ga0105057_10172132	3300009813	Groundwater Sand	MERSATSIFIGPYGLHGFGIVALVFFLVFLWAFNFTTFF*
Ga0126313_100274895	3300009840	Serpentine Soil	MPEAALSRFLIGPFGLHAFIAGALVLFAGFLWVFNFTNFF*
Ga0126305_100318632	3300010036	Serpentine Soil	MPEATLSRSLIGPFGLHAFIAGALVLFAGFLWVFNFTNFF*
Ga0126304_104635272	3300010037	Serpentine Soil	MAPSVFSRVLVGPNGIHALGFVLLALFLAFIWIFNFTSFF*
Ga0126308_106398222	3300010040	Serpentine Soil	MAQAALSRILIGPYGLHAFIGVMLALFVAFLWVFNFTTFF*
Ga0126312_114212461	3300010041	Serpentine Soil	VMPEATLSRSLIGPFGLHAFIAGALVLFAGFLWVFNFTNFF*
Ga0127503_102082232	3300010154	Soil	MTQAVASRMLVGRYGLRAFGAVVLALFLAFLWVFNFTTFF*
Ga0074046_100872682	3300010339	Bog Forest Soil	LKLLGPAASMGDAKAMAPTVASRILIGPYGLHAFLAVLLALFLGFLWLFNFTAFF*
Ga0126372_103371721	3300010360	Tropical Forest Soil	LSRVFIGPFGLHAFGFVVLALFALFLWAFNFTTFF*
Ga0134128_121512972	3300010373	Terrestrial Soil	MRAMTQMAASRILIGPYGLHAFVVAVLVLFLGFLWLFNFTTFF*
Ga0136449_1004196982	3300010379	Peatlands Soil	MAESAVSRILVGPYGLHAFGAVALVLFFIFLWAFNFTTFF*
Ga0136847_125445942	3300010391	Freshwater Sediment	SRIFVGPYGLHAVSLAMLFLFLGFLWVFNFTSFF*
Ga0134126_114799891	3300010396	Terrestrial Soil	MPALTQMAVSRILIGPYGLHAFVVAVLVLFLGFLWLFNFTTFF*
Ga0134126_126119951	3300010396	Terrestrial Soil	MAQAALSRFLIGPYGLHAFIGVMLALFVAFLWVFNFTTFC*
Ga0134124_114624811	3300010397	Terrestrial Soil	ARPMESSATARILIGPYGLHAFGLILLSLFLGFLWVFNFTTFFGGSAVITQ*
Ga0126357_10676932	3300010864	Boreal Forest Soil	MAQATIARTLAGPYGLHVWGTALVALFVGFLVVFNFTNFF*
Ga0126346_13932473	3300010865	Boreal Forest Soil	MTQATIAKTLVGPYGLHAVGAALVALFVGFLVVFNFTNFF*
Ga0126347_10069582	3300010867	Boreal Forest Soil	MAQATIARALVGPYGLHAVGAVLLVLFVGFLAVFNFTNFF*
Ga0126347_10663913	3300010867	Boreal Forest Soil	MAQATIARTLAGPYGLHVWGAALVALFVGFLVVFNFTNFF*
Ga0126347_14645412	3300010867	Boreal Forest Soil	MTQATIAKTLVGPYGLHAVGAALVALFVGFLVEIS
Ga0105246_101673421	3300011119	Miscanthus Rhizosphere	MAQTALARILVGPYGLHAFLGVMLALFVAFLWVFNFTTF
Ga0150983_102792703	3300011120	Forest Soil	MDNQAMEQSAMSKVLVGPYGLHAFGGVLLIMFFVFLWVFNFTSFF*
Ga0150983_106177774	3300011120	Forest Soil	ASRILVGPYGLHAFGLVVLTFFVVFLWVFNFTSFF*
Ga0137436_10351491	3300011423	Soil	MEQTAIARILVGPYGLHAFGFVVLGFFLMFLWVFNFTAFF*
Ga0137389_103270523	3300012096	Vadose Zone Soil	MEQTAIARILVGPYGLHAFGFVVLGFFLAFLWVFNFTAFF*
Ga0137383_111086062	3300012199	Vadose Zone Soil	MEHSATSRILIGPYGLHAFGFAVFAFFLIFLWVFNFTKF
Ga0137399_110100173	3300012203	Vadose Zone Soil	ARILVGPYGLHAAGFVMLGFFLAFLWVFNFTTFF*
Ga0137399_110230671	3300012203	Vadose Zone Soil	ALSRILVGPYGLHAFVAVTLALFVAFLWVFNFTTFF*
Ga0137374_100156043	3300012204	Vadose Zone Soil	MWPATSRILIGPYGLHGFAIVTLLFFLVFLWAFNFTSFF*
Ga0137374_100206636	3300012204	Vadose Zone Soil	MGQTNMNQILVGPYGLHAFLGVALALFLGFLYVFNFTAFF*
Ga0137374_100217734	3300012204	Vadose Zone Soil	MEPSAISRTLVGPFGLHAFGGVVLALFLVFLWVFNFTNFF*
Ga0150985_1036157183	3300012212	Avena Fatua Rhizosphere	MASTAVSKLLIGPYGLHAFLAVVLALFLGFLWLFNFTSFF*
Ga0150985_1177967131	3300012212	Avena Fatua Rhizosphere	MGAMAQAALSRILIGPYGLHAFIGVMLALFVAFLWVFKFTPFF*
Ga0134033_10435502	3300012383	Grasslands Soil	MRAMTQAAVTRMLIGPYGLHAFLAFLLALFVGFLWLFNFTTFF*
Ga0134040_12427872	3300012389	Grasslands Soil	MRAMTQAAVTRRLIGPYGLHAFLAFLLALFVGFLWLFNFTTFF*
Ga0150984_1042113092	3300012469	Avena Fatua Rhizosphere	MAQAALSRLLIGPYGLHALIGVMLALFVAFLWVFNFTTFF*
Ga0150984_1068273444	3300012469	Avena Fatua Rhizosphere	MAQAALARFLIGPYGLHAFIGVMLALFVAFLWVFNFTTFF*
Ga0150984_1218309771	3300012469	Avena Fatua Rhizosphere	MAQAALSRILVGPYGLHAFIAVMLALFIAFLWVFNFTTFF*
Ga0157302_101354912	3300012915	Soil	DRMRAMTQMAVSRILIGPYGLHAFVATVLVLFLGFLWLFNFTTFF*
Ga0137395_100911483	3300012917	Vadose Zone Soil	MCTMEQSAVARILVGPYGLHAAGFVMLGFFLAFLWAFNFTTFF*
Ga0164304_103545041	3300012986	Soil	AALSRILVGPYGLHAFVAVMLALFVAFLWVFNFTTFF*
Ga0157371_113382491	3300013102	Corn Rhizosphere	QAALSRILIGPYGLHAFIGVMLALFVTFLWVFNFTTFF*
Ga0163162_113536773	3300013306	Switchgrass Rhizosphere	MAQTAFARILVGPYGLHACLGVMLALFVAFLWVFNFTTFF*
Ga0182024_103082362	3300014501	Permafrost	MENSAVSRILVGPYGLHAFGLVLLTFFVVFLWVFNFTSFF*
Ga0157377_111121622	3300014745	Miscanthus Rhizosphere	MGAMAQAALSRLLIGPYGLHAFIGVMLALFVAFLWVFNFTTFF*
Ga0120193_100982492	3300014965	Terrestrial	MRAMQPATLSRILAGPFVLRAMAAAALALFAAFLWIFNFTTFF*
Ga0173478_100201433	3300015201	Soil	MAQAALSRLLIGPYGLHAFIGVMLALFVTFLWVFNFTTFF*
Ga0173478_107917022	3300015201	Soil	MAQTALARILVGPYGLHAFLGVMLALFVAFLWVFNFT
Ga0137409_109448681	3300015245	Vadose Zone Soil	MEQTAIARILVGPYGLHAFGLGMLTLFVAFLWVFNFTSFF*
Ga0132258_102307793	3300015371	Arabidopsis Rhizosphere	MAQIEASRILIGPYGLYAFVAAVLLFFLGFLWVFNFTTFF*
Ga0132258_103444772	3300015371	Arabidopsis Rhizosphere	MQIALSRILIGPYGLHAFAAVALTLFLGFLWVFNFTTFF*
Ga0132256_1019082652	3300015372	Arabidopsis Rhizosphere	MQPGTLSRFFIGPFGLHAFGFGVLALFALFLWAFNFTTFF*
Ga0182035_106853542	3300016341	Soil	MTQTAISRILIGPYGLHALVAAVLVLFLGFLWVFNFTTFF
Ga0182039_114092021	3300016422	Soil	MAQTAISRILIGPYGLHALVAAVLVLFLGFLSVFNFTTFF
Ga0184605_100131622	3300018027	Groundwater Sediment	MAQAALSRILVGPYGLHAFVAVTLALFVAFLWVFNFTTFF
Ga0184621_101290772	3300018054	Groundwater Sediment	MAQAALSRILVGPYGLHAFVAVTLALFVAFLWVFNFTSDAADA
Ga0184623_102006571	3300018056	Groundwater Sediment	MAQADIARMLIGPYGLHAFLGIFAILFLAFLWVFNFTTFF
Ga0187784_114978903	3300018062	Tropical Peatland	MGQTAVSRILIGPYGLYAFIAIVLLLFLGFLWVFNF
Ga0184611_10161115	3300018067	Groundwater Sediment	MAQAALARFLIGPYGLHAFIGVMLALFVAFLWVFNFTTFF
Ga0184618_102571981	3300018071	Groundwater Sediment	MAQAALSRILVGPYGLHAFVAVMLALFVAFLWVFNFTT
Ga0184625_103994332	3300018081	Groundwater Sediment	MGCAMPEATLSRLLIGPFGLHAFIAAALILFAGFLWVFNFTNFF
Ga0190272_120355232	3300018429	Soil	MENIAMAPAIASSILGPYGLHAFGAVAVVLFLAFLWVFNFTSFF
Ga0066655_103673312	3300018431	Grasslands Soil	MASTAASKLLIGPYGLHAFLAVVLALFLGFLWLFNFTSFF
Ga0190270_125299611	3300018469	Soil	MGARAMSQSAVSRILVGPHGMHAVGALVLALFLAFLWAFNFTSFF
Ga0190271_104153934	3300018481	Soil	MEQAALSRLLIGPYGLHAFIGVMLALFVAFLWVFNFTTFF
Ga0184647_10728691	3300019263	Groundwater Sediment	MAQAALSRLLIGPYGLHAFIGVMLALFVAFLWVFNFTTFF
Ga0173481_102226582	3300019356	Soil	MAQTALARILVGPYGLHAFLGVMLALFVAFLWVFNFTTFF
Ga0190267_101301931	3300019767	Soil	MAQAALARILIGPYGLHAFIGVMLALFVAFLWVFNFTTFF
Ga0193743_11865291	3300019889	Soil	MAQAALSRILIGPYGLHAFIGVMLALFVAFLWVFNFTTFF
Ga0193730_10687823	3300020002	Soil	MAQAALSKILVGPYGLHAFIAVMLGLFAAFLWVFNFTTFF
Ga0210396_111623302	3300021180	Soil	MENSAASRILVGPYGLHAFGLVLLTFFAVFLWAFNFTNFF
Ga0210393_101102341	3300021401	Soil	MENSAASRILVGPYGLHAFGLVLLTFFVVFLWVFNFTSFF
Ga0210394_108088981	3300021420	Soil	MENSAASRILVGPYGLHAFGLVLLTSFVVFLWVFNFTSFF
Ga0207710_100282991	3300025900	Switchgrass Rhizosphere	AALSRFLIGPYGLHAFIGVMLALFVAFLWVFNFTTFF
Ga0207647_107699592	3300025904	Corn Rhizosphere	MAQTALARILVGPYGLHAFLGVMLALFVAFLWVFNF
Ga0207693_100463425	3300025915	Corn, Switchgrass And Miscanthus Rhizosphere	MAQAALSRFLIGPYGLHAFIGVMLALFVAFLWVFNFTTFF
Ga0207649_115801842	3300025920	Corn Rhizosphere	LSRLLIGPYGLHAFIGVMLALFVAFLWVFNFTTFF
Ga0207644_103643263	3300025931	Switchgrass Rhizosphere	MAQTALARILVGPYGLHACLGVMLALFVAFLWVFNFTTFF
Ga0207658_103005351	3300025986	Switchgrass Rhizosphere	QAALSRLLIGPYGLHAFIGVMLALFVAFLWVFNFTTFF
Ga0209849_10758772	3300026215	Soil	MESSAISRILVGPCGLHAFGLVLLSFFIVFLWVFNFTNFF
Ga0209577_100414242	3300026552	Soil	MEQSAIARILVGPYGLHAFGFVVLGFFLAFLWVFNFTAFF
Ga0179587_102213843	3300026557	Vadose Zone Soil	MAQAAIARVLVGPYGLHAFGAVLLLLFVGFLVVFNFTSFF
Ga0209886_10114251	3300027273	Groundwater Sand	MERSATSIFIGPYGLHGFGIVALVFFLVFLWAFNFTTFF
Ga0208044_10796701	3300027625	Peatlands Soil	MAESAVSRILVGPYGLHAFGAVALVLFFIFLWAFNFTTFF
Ga0207862_12239361	3300027703	Tropical Forest Soil	AMAPEAISRVLVGPYGLHAFAAAVLALFAVFLWVFNFTNFF
Ga0209656_100667623	3300027812	Bog Forest Soil	MGDAKAMAPTAASRILIGPYGLHAFLGVVLALFLGFLWLFNFTTFF
Ga0209656_104188511	3300027812	Bog Forest Soil	MGDAKAMAPTVASRILIGPYGLHAFLAVLLALFLGFLWLFNFTAFF
Ga0209040_100295866	3300027824	Bog Forest Soil	MGDAKAMAPTAASRILIGPYGLHAFLGVVLALFLGFLWLFNFTAFF
Ga0209813_101136082	3300027866	Populus Endosphere	MAQAALSRILIGPYGLHAFIGVMLALFVTFLWVFNFTTFF
Ga0209590_100698733	3300027882	Vadose Zone Soil	MNQILVGPYGLHAFLGVALALFLGFLYVFNFTTFF
Ga0209415_100156966	3300027905	Peatlands Soil	MAESAVSRILVGPYGLHAFGAVALVLFFTFLWAFNFTTFF
Ga0207428_100846603	3300027907	Populus Rhizosphere	MTIAALARILVGPGGLHAFGAVTLALFLAFLWFFNFTAFF
Ga0207428_108645412	3300027907	Populus Rhizosphere	MQSGTLTRVFIGPFGLHAFGIVVLALFALFLWAFNFTTFF
Ga0209006_101901854	3300027908	Forest Soil	MEQSAMSKVLVGPYGLHAFGGVLLIMFFVFLWVFNFTSFF
Ga0209069_100829363	3300027915	Watersheds	MENSAVARILVGPYGLHAFGAVVLSLFLAFLWVFNFTSFF
Ga0268266_115712022	3300028379	Switchgrass Rhizosphere	MAQAALARILIGPYGLHAFIGVMLALFAAFLWVFNFTTFF
Ga0265318_103972172	3300028577	Rhizosphere	QATIAKTLVGPYGLHAVGAALVALFVGFLVVFNFTNFF
Ga0307322_102401491	3300028710	Soil	MAQAALSRILVGPYGLHAFVAVTLALFVAFLWVFNF
Ga0307285_100426933	3300028712	Soil	MAQAALSRILVGPYGLHAFVAVTLALFVAFLLVFNFTTFF
Ga0307285_101362443	3300028712	Soil	AQAALSRLLIGPYGLHAFIGVMLALFVAFLWVFNFTTFF
Ga0307303_100618251	3300028713	Soil	MAQAALSRILVGPYGLHAFVAVTLALFVAFLWVFNFTTF
Ga0307306_101069921	3300028782	Soil	AQAALSRILVGPYGLHAFVAVTLALFVAFLWVFNFTTFF
Ga0307299_102025291	3300028793	Soil	AALSRILVGPYGLHAFVAVTLALFVAFLWVFNFTTFF
Ga0307299_102964651	3300028793	Soil	MAQAALSRILVGPYGLHAFVAVTLALFVAFLWVFNFT
Ga0307305_100977674	3300028807	Soil	NQGGMGAMAQAALSRILVGPYGLHAFVAVMLALFVAFLWVFNFTTFF
Ga0307294_103560562	3300028810	Soil	AQAALSRILVGPYGLHAFVAVMLALFVAFLWVFNFTTFF
Ga0307286_102350941	3300028876	Soil	MAQAALSRLLIGPYGLHAFIGVMLALFVAFLWVFNF
Ga0308201_100955491	3300031091	Soil	MAQAALSRLLIGPYGLHAFIGVMLALFVAFLWVFNCTTVF
Ga0307500_100594543	3300031198	Soil	VSLAQAALSRILVGPYGLHAFVAVMLALFVAFLWVFNFTTFF
Ga0307497_100313614	3300031226	Soil	LSRILVGPYGLHAFVAVMLALFVAFLWVFNFTTFF
Ga0265340_100103446	3300031247	Rhizosphere	MTQATIAKTLVGPYGLHAVGAALVALFVGFLVVFNFTNFF
Ga0265340_104192502	3300031247	Rhizosphere	MAQATIARTLVGPYGLHVAGAALVALFAGFLYVFNFTNFF
Ga0170820_127481311	3300031446	Forest Soil	MAQAALSRILVGPYGLHAFVAVMLALFAAFLWVFNFTTFF
Ga0247727_108865922	3300031576	Biofilm	MERSAAARLFIGPYGLHGFSIVALLVFLVFLWAFNFTSFF
Ga0307469_100923516	3300031720	Hardwood Forest Soil	MTQSAVSRIFVGPYGLRAFGIVVLTPFVTFLWAFNFTNFF
Ga0307469_105795872	3300031720	Hardwood Forest Soil	MTRSAVSRIFVGPYGLHAFGIVVLTLLVTFVWAFNFTNFF
Ga0307468_1001168352	3300031740	Hardwood Forest Soil	MTRSAVSRIFVGPYGLRAFGIVVLTLFVTFLWAFNFTNFF
Ga0307468_1007792022	3300031740	Hardwood Forest Soil	MQQADMARILIGPFGLHAAGIVMLALFALFLWAFNFTTFF
Ga0306919_103419461	3300031879	Soil	MTQTAISGILIGPYGLHALVAAVLVLFLGFLSVFNFTTFF
Ga0310916_100876905	3300031942	Soil	MAQTTVSKTLVGPYGLHAFLVVLLVLFLGFLWLFNFTTFF
Ga0310910_111523261	3300031946	Soil	MKQSTASRILVGPYGLHPFGFVVLAFFLAFLWVFN
Ga0306922_107717234	3300032001	Soil	TTVSKTLVGPYGLHAFLVVLLVLFLGFLWLFNFTTFF
Ga0310906_110091431	3300032013	Soil	MAQTALARILVGPYGLHAFLGVMLALFLAFLWVFNFTTFF
Ga0310911_102986112	3300032035	Soil	MTQTAISRILIGPYGLHALVAAVLVLFLGFLSVFNFTTFF
Ga0372943_0029485_852_974	3300034268	Soil	MQQSAAAKIMVGPYGLHAFGLLVLAVFTTFLWLFNFTTFF
Ga0373959_0144321_167_298	3300034820	Rhizosphere Soil	MGAMAQAALSRILIGPYGLHAFIGVMLALFVAFLWVFNFTTFF

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign