| Basic Information | |
|---|---|
| Family ID | F032953 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 178 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MLPMLGAIAPLAKILFSTIEKAVPDKDLQAKLKADLQTQL |
| Number of Associated Samples | 146 |
| Number of Associated Scaffolds | 178 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 26.97 % |
| % of genes near scaffold ends (potentially truncated) | 98.31 % |
| % of genes from short scaffolds (< 2000 bps) | 87.64 % |
| Associated GOLD sequencing projects | 137 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.55 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (62.921 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (24.719 % of family members) |
| Environment Ontology (ENVO) | Unclassified (70.787 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (70.225 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.00% β-sheet: 0.00% Coil/Unstructured: 50.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.55 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 178 Family Scaffolds |
|---|---|---|
| PF00959 | Phage_lysozyme | 7.87 |
| PF08291 | Peptidase_M15_3 | 2.81 |
| PF11753 | DUF3310 | 2.25 |
| PF03237 | Terminase_6N | 2.25 |
| PF02945 | Endonuclease_7 | 1.69 |
| PF00011 | HSP20 | 0.56 |
| PF00149 | Metallophos | 0.56 |
| PF13640 | 2OG-FeII_Oxy_3 | 0.56 |
| COG ID | Name | Functional Category | % Frequency in 178 Family Scaffolds |
|---|---|---|---|
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.56 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 82.58 % |
| Unclassified | root | N/A | 17.42 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000176|TB03JUN2009E_c007905 | Not Available | 2021 | Open in IMG/M |
| 3300002835|B570J40625_100674055 | Not Available | 931 | Open in IMG/M |
| 3300003277|JGI25908J49247_10100107 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 699 | Open in IMG/M |
| 3300003411|JGI25911J50253_10185368 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 581 | Open in IMG/M |
| 3300003488|JGI25919J51413_1003218 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Epulopiscium → unclassified Epulopiscium → Epulopiscium sp. SCG-B10WGA-EpuloB | 1301 | Open in IMG/M |
| 3300004125|Ga0066182_10139919 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 596 | Open in IMG/M |
| 3300004460|Ga0066222_1042350 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1546 | Open in IMG/M |
| 3300004775|Ga0007798_10133980 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 564 | Open in IMG/M |
| 3300004836|Ga0007759_11466119 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 779 | Open in IMG/M |
| 3300005517|Ga0070374_10623549 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 534 | Open in IMG/M |
| 3300005527|Ga0068876_10145873 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Epulopiscium → unclassified Epulopiscium → Epulopiscium sp. SCG-B10WGA-EpuloB | 1393 | Open in IMG/M |
| 3300005583|Ga0049085_10136141 | Not Available | 834 | Open in IMG/M |
| 3300005585|Ga0049084_10054587 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1496 | Open in IMG/M |
| 3300005805|Ga0079957_1118752 | Not Available | 1402 | Open in IMG/M |
| 3300006805|Ga0075464_10303632 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 961 | Open in IMG/M |
| 3300006805|Ga0075464_11002793 | Not Available | 524 | Open in IMG/M |
| 3300006916|Ga0070750_10137341 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1113 | Open in IMG/M |
| 3300006920|Ga0070748_1089681 | Not Available | 1179 | Open in IMG/M |
| 3300007992|Ga0105748_10424186 | Not Available | 576 | Open in IMG/M |
| 3300008267|Ga0114364_1076630 | Not Available | 1108 | Open in IMG/M |
| 3300008267|Ga0114364_1182302 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 535 | Open in IMG/M |
| 3300008450|Ga0114880_1049050 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Epulopiscium → unclassified Epulopiscium → Epulopiscium sp. SCG-B10WGA-EpuloB | 1793 | Open in IMG/M |
| 3300009026|Ga0102829_1083607 | Not Available | 984 | Open in IMG/M |
| 3300009081|Ga0105098_10704500 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 536 | Open in IMG/M |
| 3300009085|Ga0105103_10830975 | Not Available | 538 | Open in IMG/M |
| 3300009151|Ga0114962_10321800 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 857 | Open in IMG/M |
| 3300009152|Ga0114980_10316220 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 904 | Open in IMG/M |
| 3300009152|Ga0114980_10405330 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 782 | Open in IMG/M |
| 3300009154|Ga0114963_10657194 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 545 | Open in IMG/M |
| 3300009155|Ga0114968_10135544 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1473 | Open in IMG/M |
| 3300009155|Ga0114968_10667561 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 546 | Open in IMG/M |
| 3300009159|Ga0114978_10368871 | Not Available | 865 | Open in IMG/M |
| 3300009164|Ga0114975_10485695 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300009169|Ga0105097_10093527 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1642 | Open in IMG/M |
| 3300009169|Ga0105097_10096691 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1613 | Open in IMG/M |
| 3300009180|Ga0114979_10313328 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 930 | Open in IMG/M |
| 3300009182|Ga0114959_10060001 | All Organisms → cellular organisms → Bacteria | 2176 | Open in IMG/M |
| 3300009183|Ga0114974_10697306 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 552 | Open in IMG/M |
| 3300009183|Ga0114974_10778010 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 515 | Open in IMG/M |
| 3300009184|Ga0114976_10599193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 559 | Open in IMG/M |
| 3300009184|Ga0114976_10669394 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 522 | Open in IMG/M |
| 3300009185|Ga0114971_10750183 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 531 | Open in IMG/M |
| 3300009433|Ga0115545_1224617 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 635 | Open in IMG/M |
| 3300010155|Ga0098047_10106083 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1095 | Open in IMG/M |
| 3300010157|Ga0114964_10245364 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 854 | Open in IMG/M |
| 3300010160|Ga0114967_10216548 | All Organisms → Viruses → Predicted Viral | 1021 | Open in IMG/M |
| 3300010354|Ga0129333_11452349 | Not Available | 563 | Open in IMG/M |
| 3300010370|Ga0129336_10205923 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1118 | Open in IMG/M |
| 3300010370|Ga0129336_10494429 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 660 | Open in IMG/M |
| 3300011010|Ga0139557_1005778 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2576 | Open in IMG/M |
| 3300011011|Ga0139556_1008245 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Epulopiscium → unclassified Epulopiscium → Epulopiscium sp. SCG-B10WGA-EpuloB | 1507 | Open in IMG/M |
| 3300012013|Ga0153805_1020543 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1125 | Open in IMG/M |
| 3300012013|Ga0153805_1022975 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Epulopiscium → unclassified Epulopiscium → Epulopiscium sp. SCG-B10WGA-EpuloB | 1061 | Open in IMG/M |
| 3300012017|Ga0153801_1003952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 2842 | Open in IMG/M |
| 3300012734|Ga0157615_1148273 | Not Available | 529 | Open in IMG/M |
| 3300013004|Ga0164293_10956778 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 536 | Open in IMG/M |
| (restricted) 3300013133|Ga0172362_10488823 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 846 | Open in IMG/M |
| (restricted) 3300013138|Ga0172371_10361645 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1109 | Open in IMG/M |
| 3300013295|Ga0170791_10695413 | All Organisms → Viruses → Predicted Viral | 1336 | Open in IMG/M |
| 3300014811|Ga0119960_1101698 | Not Available | 514 | Open in IMG/M |
| 3300015050|Ga0181338_1015690 | Not Available | 1209 | Open in IMG/M |
| 3300017701|Ga0181364_1070434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 535 | Open in IMG/M |
| 3300017707|Ga0181363_1062482 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 653 | Open in IMG/M |
| 3300017716|Ga0181350_1070185 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 901 | Open in IMG/M |
| 3300017716|Ga0181350_1109186 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 673 | Open in IMG/M |
| 3300017716|Ga0181350_1149646 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 545 | Open in IMG/M |
| 3300017722|Ga0181347_1198655 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 528 | Open in IMG/M |
| 3300017723|Ga0181362_1089516 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 617 | Open in IMG/M |
| 3300017736|Ga0181365_1007668 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2670 | Open in IMG/M |
| 3300017761|Ga0181356_1160054 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 692 | Open in IMG/M |
| 3300017761|Ga0181356_1198833 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 594 | Open in IMG/M |
| 3300017766|Ga0181343_1138353 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 681 | Open in IMG/M |
| 3300017766|Ga0181343_1191236 | Not Available | 562 | Open in IMG/M |
| 3300017777|Ga0181357_1303719 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 541 | Open in IMG/M |
| 3300017778|Ga0181349_1146777 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 850 | Open in IMG/M |
| 3300017780|Ga0181346_1244668 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 629 | Open in IMG/M |
| 3300017780|Ga0181346_1322376 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 519 | Open in IMG/M |
| 3300017785|Ga0181355_1376296 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 517 | Open in IMG/M |
| 3300018416|Ga0181553_10264811 | Not Available | 968 | Open in IMG/M |
| 3300018421|Ga0181592_10594887 | All Organisms → Viruses → environmental samples → uncultured virus | 751 | Open in IMG/M |
| 3300019783|Ga0181361_110174 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 731 | Open in IMG/M |
| 3300019784|Ga0181359_1065097 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1389 | Open in IMG/M |
| 3300019784|Ga0181359_1153431 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 787 | Open in IMG/M |
| 3300019784|Ga0181359_1172381 | Not Available | 722 | Open in IMG/M |
| 3300019784|Ga0181359_1242412 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 552 | Open in IMG/M |
| 3300020084|Ga0194110_10700264 | Not Available | 627 | Open in IMG/M |
| 3300020151|Ga0211736_10277229 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 522 | Open in IMG/M |
| 3300020161|Ga0211726_10282296 | Not Available | 634 | Open in IMG/M |
| 3300020161|Ga0211726_10930950 | All Organisms → Viruses → environmental samples → uncultured virus | 552 | Open in IMG/M |
| 3300020162|Ga0211735_11356650 | Not Available | 672 | Open in IMG/M |
| 3300020183|Ga0194115_10491911 | All Organisms → Viruses → environmental samples → uncultured virus | 503 | Open in IMG/M |
| 3300020220|Ga0194119_10070836 | All Organisms → cellular organisms → Bacteria | 2948 | Open in IMG/M |
| 3300020221|Ga0194127_10948244 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 520 | Open in IMG/M |
| 3300020536|Ga0207939_1033146 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 669 | Open in IMG/M |
| 3300020537|Ga0208722_1034200 | Not Available | 709 | Open in IMG/M |
| 3300020551|Ga0208360_1053160 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 507 | Open in IMG/M |
| 3300020553|Ga0208855_1000201 | Not Available | 17285 | Open in IMG/M |
| 3300020556|Ga0208486_1039386 | Not Available | 702 | Open in IMG/M |
| 3300020557|Ga0208231_1070857 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 517 | Open in IMG/M |
| 3300021140|Ga0214168_1005064 | Not Available | 4617 | Open in IMG/M |
| 3300021962|Ga0222713_10784289 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 534 | Open in IMG/M |
| 3300022179|Ga0181353_1007722 | All Organisms → Viruses | 2624 | Open in IMG/M |
| 3300022179|Ga0181353_1032165 | All Organisms → cellular organisms → Bacteria | 1390 | Open in IMG/M |
| 3300022190|Ga0181354_1083250 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C281 | 1053 | Open in IMG/M |
| 3300022407|Ga0181351_1141457 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 877 | Open in IMG/M |
| 3300023184|Ga0214919_10351484 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Epulopiscium → unclassified Epulopiscium → Epulopiscium sp. SCG-B10WGA-EpuloB | 983 | Open in IMG/M |
| 3300025137|Ga0209336_10117278 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 733 | Open in IMG/M |
| 3300025635|Ga0208147_1035153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1314 | Open in IMG/M |
| 3300025655|Ga0208795_1039976 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1431 | Open in IMG/M |
| 3300025674|Ga0208162_1189012 | All Organisms → Viruses | 532 | Open in IMG/M |
| 3300027144|Ga0255102_1015432 | All Organisms → Viruses | 1394 | Open in IMG/M |
| 3300027146|Ga0255104_1022835 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Epulopiscium → unclassified Epulopiscium → Epulopiscium sp. SCG-B10WGA-EpuloB | 1148 | Open in IMG/M |
| 3300027581|Ga0209651_1060463 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Epulopiscium → unclassified Epulopiscium → Epulopiscium sp. SCG-B10WGA-EpuloB | 1112 | Open in IMG/M |
| 3300027595|Ga0255122_1004623 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Epulopiscium → unclassified Epulopiscium → Epulopiscium sp. SCG-B10WGA-EpuloB | 3016 | Open in IMG/M |
| 3300027608|Ga0208974_1128622 | All Organisms → Viruses | 657 | Open in IMG/M |
| 3300027621|Ga0208951_1107149 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 758 | Open in IMG/M |
| 3300027659|Ga0208975_1017640 | All Organisms → Viruses | 2373 | Open in IMG/M |
| 3300027659|Ga0208975_1032327 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Epulopiscium → unclassified Epulopiscium → Epulopiscium sp. SCG-B10WGA-EpuloB | 1665 | Open in IMG/M |
| 3300027679|Ga0209769_1262448 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 523 | Open in IMG/M |
| 3300027688|Ga0209553_1047195 | All Organisms → Viruses | 1710 | Open in IMG/M |
| 3300027688|Ga0209553_1255413 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 547 | Open in IMG/M |
| 3300027689|Ga0209551_1009532 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Epulopiscium → unclassified Epulopiscium → Epulopiscium sp. SCG-B10WGA-EpuloB | 3396 | Open in IMG/M |
| 3300027689|Ga0209551_1242013 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 543 | Open in IMG/M |
| 3300027707|Ga0209443_1307608 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 525 | Open in IMG/M |
| 3300027708|Ga0209188_1043673 | All Organisms → Viruses | 2035 | Open in IMG/M |
| 3300027708|Ga0209188_1072395 | All Organisms → Viruses | 1454 | Open in IMG/M |
| 3300027720|Ga0209617_10113972 | All Organisms → Viruses | 1082 | Open in IMG/M |
| 3300027720|Ga0209617_10242201 | All Organisms → Viruses | 685 | Open in IMG/M |
| 3300027733|Ga0209297_1315745 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 577 | Open in IMG/M |
| 3300027734|Ga0209087_1176049 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 840 | Open in IMG/M |
| 3300027736|Ga0209190_1284941 | All Organisms → Viruses | 638 | Open in IMG/M |
| 3300027741|Ga0209085_1007573 | Not Available | 5558 | Open in IMG/M |
| 3300027741|Ga0209085_1008902 | Not Available | 5095 | Open in IMG/M |
| 3300027743|Ga0209593_10131505 | All Organisms → Viruses | 907 | Open in IMG/M |
| 3300027749|Ga0209084_1005234 | All Organisms → cellular organisms → Bacteria | 8869 | Open in IMG/M |
| 3300027770|Ga0209086_10006435 | All Organisms → Viruses | 8361 | Open in IMG/M |
| 3300027772|Ga0209768_10121039 | All Organisms → Viruses | 1259 | Open in IMG/M |
| 3300027772|Ga0209768_10186440 | All Organisms → Viruses | 942 | Open in IMG/M |
| 3300027782|Ga0209500_10240344 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 796 | Open in IMG/M |
| 3300027797|Ga0209107_10133280 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Epulopiscium → unclassified Epulopiscium → Epulopiscium sp. SCG-B10WGA-EpuloB | 1289 | Open in IMG/M |
| 3300027808|Ga0209354_10152424 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 943 | Open in IMG/M |
| 3300027969|Ga0209191_1041282 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2153 | Open in IMG/M |
| 3300028083|Ga0255190_1007428 | All Organisms → Viruses | 1921 | Open in IMG/M |
| 3300028392|Ga0304729_1134188 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 811 | Open in IMG/M |
| 3300028392|Ga0304729_1144513 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 771 | Open in IMG/M |
| 3300028394|Ga0304730_1019371 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3726 | Open in IMG/M |
| (restricted) 3300028559|Ga0247831_1036705 | All Organisms → Viruses | 2821 | Open in IMG/M |
| (restricted) 3300028559|Ga0247831_1286507 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 556 | Open in IMG/M |
| (restricted) 3300028581|Ga0247840_10139743 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1481 | Open in IMG/M |
| 3300031673|Ga0307377_10277548 | All Organisms → Viruses | 1277 | Open in IMG/M |
| 3300031746|Ga0315293_10391122 | Not Available | 1096 | Open in IMG/M |
| 3300031787|Ga0315900_10630709 | All Organisms → Viruses | 776 | Open in IMG/M |
| 3300031963|Ga0315901_10884826 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 637 | Open in IMG/M |
| 3300032046|Ga0315289_10704362 | Not Available | 913 | Open in IMG/M |
| 3300032092|Ga0315905_11230170 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 609 | Open in IMG/M |
| 3300032092|Ga0315905_11464073 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 538 | Open in IMG/M |
| 3300032093|Ga0315902_11044433 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 608 | Open in IMG/M |
| 3300032173|Ga0315268_10554490 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Epulopiscium → unclassified Epulopiscium → Epulopiscium sp. SCG-B10WGA-EpuloB | 1137 | Open in IMG/M |
| 3300032342|Ga0315286_10107673 | All Organisms → Viruses | 2987 | Open in IMG/M |
| 3300032397|Ga0315287_10735193 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 1164 | Open in IMG/M |
| 3300033233|Ga0334722_10719928 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 708 | Open in IMG/M |
| 3300033980|Ga0334981_0464063 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 533 | Open in IMG/M |
| 3300034019|Ga0334998_0200535 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Epulopiscium → unclassified Epulopiscium → Epulopiscium sp. SCG-B10WGA-EpuloB | 1240 | Open in IMG/M |
| 3300034061|Ga0334987_0633885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 625 | Open in IMG/M |
| 3300034062|Ga0334995_0284144 | Not Available | 1093 | Open in IMG/M |
| 3300034062|Ga0334995_0777427 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 527 | Open in IMG/M |
| 3300034066|Ga0335019_0055118 | All Organisms → Viruses → unclassified viruses | 2717 | Open in IMG/M |
| 3300034082|Ga0335020_0236091 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 907 | Open in IMG/M |
| 3300034106|Ga0335036_0749910 | All Organisms → Viruses → environmental samples → uncultured virus | 571 | Open in IMG/M |
| 3300034107|Ga0335037_0605053 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 579 | Open in IMG/M |
| 3300034110|Ga0335055_0066871 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Epulopiscium → unclassified Epulopiscium → Epulopiscium sp. SCG-B10WGA-EpuloB | 1655 | Open in IMG/M |
| 3300034112|Ga0335066_0290197 | All Organisms → Viruses | 929 | Open in IMG/M |
| 3300034112|Ga0335066_0382935 | All Organisms → Viruses → unclassified viruses | 772 | Open in IMG/M |
| 3300034112|Ga0335066_0690535 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 516 | Open in IMG/M |
| 3300034119|Ga0335054_0213366 | All Organisms → Viruses → unclassified viruses | 1160 | Open in IMG/M |
| 3300034120|Ga0335056_0138890 | Not Available | 1455 | Open in IMG/M |
| 3300034200|Ga0335065_0184551 | All Organisms → Viruses → unclassified viruses | 1371 | Open in IMG/M |
| 3300034283|Ga0335007_0732434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 548 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 24.72% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 17.42% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 13.48% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.93% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 3.93% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 3.93% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 3.37% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 2.25% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 2.81% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 2.81% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 2.81% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.81% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 2.81% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.69% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment | 1.12% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 1.12% |
| Surface Ice | Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice | 1.12% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 1.12% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 1.12% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.56% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.56% |
| Aquatic | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Aquatic | 0.56% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater | 0.56% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.56% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.56% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.56% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.56% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 0.56% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.56% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000176 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 epilimnion | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003411 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD | Environmental | Open in IMG/M |
| 3300003488 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DN | Environmental | Open in IMG/M |
| 3300004125 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (version 2) | Environmental | Open in IMG/M |
| 3300004460 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300004775 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA17M | Environmental | Open in IMG/M |
| 3300004836 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005583 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF | Environmental | Open in IMG/M |
| 3300005585 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
| 3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300009185 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG | Environmental | Open in IMG/M |
| 3300009433 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 | Environmental | Open in IMG/M |
| 3300010155 | Marine viral communities from the Subarctic Pacific Ocean - 12_ETSP_OMZ_AT15267 metaG | Environmental | Open in IMG/M |
| 3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
| 3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300011010 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice | Environmental | Open in IMG/M |
| 3300011011 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012013 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice | Environmental | Open in IMG/M |
| 3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012734 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES144 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013133 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment s1_kivu2a2 | Environmental | Open in IMG/M |
| 3300013138 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_12m | Environmental | Open in IMG/M |
| 3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
| 3300014811 | Aquatic viral communities from ballast water - Michigan State University - AB_ballast water | Environmental | Open in IMG/M |
| 3300015050 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017707 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N | Environmental | Open in IMG/M |
| 3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018421 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019783 | Freshwater viral communities from Lake Michigan, USA - Sp13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020084 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015032 Kigoma Deep Cast 1200m | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
| 3300020183 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface | Environmental | Open in IMG/M |
| 3300020220 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015018 Mahale Deep Cast 100m | Environmental | Open in IMG/M |
| 3300020221 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015036 Kigoma Deep Cast 100m | Environmental | Open in IMG/M |
| 3300020536 | Freshwater microbial communities from Lake Mendota, WI - 02JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020537 | Freshwater microbial communities from Lake Mendota, WI - 21SEP2011 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020551 | Freshwater microbial communities from Lake Mendota, WI - 27JUL2010 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
| 3300020553 | Freshwater microbial communities from Lake Mendota, WI - 17MAY2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020556 | Freshwater microbial communities from Lake Mendota, WI - 03AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020557 | Freshwater microbial communities from Lake Mendota, WI - 15JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021140 | Freshwater microbial communities from Lake Mendota, WI - Practice 29OCT2010 epilimnion | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300025137 | Marine viral communities from the Pacific Ocean - LP-32 (SPAdes) | Environmental | Open in IMG/M |
| 3300025635 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025655 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027144 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepA_0h | Environmental | Open in IMG/M |
| 3300027146 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepC_0h | Environmental | Open in IMG/M |
| 3300027581 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027595 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Colum_RepC_8h | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027621 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027679 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027688 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027689 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027707 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD (SPAdes) | Environmental | Open in IMG/M |
| 3300027708 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027720 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027743 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027772 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028083 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Miss_RepA_8h | Environmental | Open in IMG/M |
| 3300028392 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300028394 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300028559 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_1m | Environmental | Open in IMG/M |
| 3300028581 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_17m | Environmental | Open in IMG/M |
| 3300031673 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-3 | Environmental | Open in IMG/M |
| 3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032046 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40 | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
| 3300032342 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0 | Environmental | Open in IMG/M |
| 3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
| 3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
| 3300033980 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME09Aug2015-rr0007 | Environmental | Open in IMG/M |
| 3300034019 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
| 3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034107 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Apr2017-rr0133 | Environmental | Open in IMG/M |
| 3300034110 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Jun2009D10-rr0171 | Environmental | Open in IMG/M |
| 3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
| 3300034119 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Jul2015-rr0166 | Environmental | Open in IMG/M |
| 3300034120 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172 | Environmental | Open in IMG/M |
| 3300034200 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190 | Environmental | Open in IMG/M |
| 3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| TB03JUN2009E_0079054 | 3300000176 | Freshwater | MFGALAPIANILFSTIEKCVPDKDLQTKLKFEIQQQMLQSHAEEFK |
| B570J40625_1006740553 | 3300002835 | Freshwater | MLPMLNAIAPLAKILFSTIEKSVPDKDLQAKLKADLQTQLMQ |
| JGI25908J49247_101001073 | 3300003277 | Freshwater Lake | MIQMLGAVAPLAKILFNTIEKSVPDKDLQEKLKAQLQTQLLQS |
| JGI25911J50253_101853683 | 3300003411 | Freshwater Lake | INMLPMLGAIAPLAKILFSTIEKAVPDKDLQSKLKADLHSITTI* |
| JGI25919J51413_10032183 | 3300003488 | Freshwater Lake | MIQMLGAIAPLAKILFSTIEKAVPDKDLQEKLKAQLNQQL |
| Ga0066182_101399193 | 3300004125 | Freshwater Lake | MLGAIAPLAKILFNTIEKSVPDKDLQAKLKADLQTQLLQSN |
| Ga0066222_10423501 | 3300004460 | Marine | MLPMLGAIAPLAKILFSTIEKAVPDRDLQEKLKAQLNQQL |
| Ga0007798_101339801 | 3300004775 | Freshwater | MLPMLGAIAPLAKILFSTIEKAVPDKDLQAKLKAELQTQLL |
| Ga0007759_114661191 | 3300004836 | Freshwater Lake | MIQMLGAVAPLAKILFNTIEKAVPDKDLQEKLKAQLQTQLL |
| Ga0070374_106235492 | 3300005517 | Freshwater Lake | MLPILQAVAPLAKILFNTIDKAVPDKDLQAKLKAELQTQLL |
| Ga0068876_101458731 | 3300005527 | Freshwater Lake | MIQMLGAVAPLAKILFNTIEKSVPDKDLQEKLKAQ |
| Ga0049085_101361411 | 3300005583 | Freshwater Lentic | MLPMLGAIAPLAKILFSTIEKAVPDKDLQAKLKADLQTQL |
| Ga0049084_100545871 | 3300005585 | Freshwater Lentic | MIPMLSAIAPLAKILFSTIEKAVPDKDLQERLKTQLNE |
| Ga0079957_11187521 | 3300005805 | Lake | MLGAVAPLAKILFSTVEKAVPDKDLQEKLKAQLQTQLL |
| Ga0075464_103036324 | 3300006805 | Aqueous | MLPALGAFAPLLNTVFKTIEKSIPDKDLQEKLKAD |
| Ga0075464_110027932 | 3300006805 | Aqueous | MLPMLGAIAPLAKILFNTIEKSVPDKDLQEKLKAQLNE |
| Ga0070750_101373413 | 3300006916 | Aqueous | MLPALNIIAPLAKILFNTVDKAVLDKDQAEKIKAQLNT |
| Ga0070748_10896814 | 3300006920 | Aqueous | MIPALGAFAPLLNTVFKTIEKSIPDKDLQEKLKADLNMQ |
| Ga0105748_104241862 | 3300007992 | Estuary Water | MLPMLSAVAPLAKILFNTIEKSIPDKDLQEKLKAQLNQ |
| Ga0114364_10766304 | 3300008267 | Freshwater, Plankton | MLPMLSAIAPLAKILFTTIEKSIPDKDLQEKLKAQ |
| Ga0114364_11823022 | 3300008267 | Freshwater, Plankton | MIQMLGAIAPLAKILFSTIEKAVPDKDLQEKLKAQLNQQLLQSS |
| Ga0114880_10490501 | 3300008450 | Freshwater Lake | MIQMLGAVAPLAKILFNTIEKSVPDKDLQEKLKAQL |
| Ga0102829_10836073 | 3300009026 | Estuarine | MLPMLGAIAPLAKILFSTIEKAVPDKDLQEKLKAQLNQQLL |
| Ga0105098_107045003 | 3300009081 | Freshwater Sediment | MLPVLNAVAPLAKILFSTIEKSVPDKDLQEKLKAQL |
| Ga0105103_108309752 | 3300009085 | Freshwater Sediment | MLPVLNAVAPLAKILFSTIEKSVPDKDLQEKLKAQMQTQ |
| Ga0114962_103218004 | 3300009151 | Freshwater Lake | MLPMLGAIAPLAKILFSTIEKAVPDRDLQEKLKAQ |
| Ga0114980_103162201 | 3300009152 | Freshwater Lake | MLPMLGAIAPLAKILFSTIEKSVPDKDLQEKLKAQLNQQLLQ |
| Ga0114980_104053303 | 3300009152 | Freshwater Lake | MLPMLSAIAPLAKILFNTIEKSVPDKDLQAKLKADL |
| Ga0114963_106571942 | 3300009154 | Freshwater Lake | MFPMLGAIAPLAKILFSTIEKAVPDKDLQEKLKAQ |
| Ga0114968_101355444 | 3300009155 | Freshwater Lake | MLGALSAIAPLAKILFNTVDKAVADKDLAAKLKADLQTQM |
| Ga0114968_106675613 | 3300009155 | Freshwater Lake | MLGAIAPLAKILFSTIEKAVPDKDLQEKLKAQLNQ |
| Ga0114978_103688714 | 3300009159 | Freshwater Lake | MIQMLGAVAPLAKILFNTIEKSVPDKDLQAKLKADLQTQLL |
| Ga0114975_104856951 | 3300009164 | Freshwater Lake | MLPVLNAVAPLAKILFNTIEKAVPDKDLQAKLKADLQTQLLQS |
| Ga0105097_100935274 | 3300009169 | Freshwater Sediment | MLGAVAPLAKILFNTIEKSVPDKDLQEKLKAQLQTQLLQS |
| Ga0105097_100966913 | 3300009169 | Freshwater Sediment | MIQMLGAVAPLAKILFSTIEKSVPDKDLQEKLKSQ |
| Ga0114979_103133284 | 3300009180 | Freshwater Lake | MLPVLQAIAPLAKILFNTIDKAVPDKDLAAKLKADLQ |
| Ga0114959_100600013 | 3300009182 | Freshwater Lake | MLPMLGAIAPLAKILFNTIEKSVPDKDLQAKLKADLQTQLLQSS |
| Ga0114974_106973062 | 3300009183 | Freshwater Lake | MLPVLQAIAPLAKILFNTIDKAVPDKDLAAKLKADLQTQML |
| Ga0114974_107780103 | 3300009183 | Freshwater Lake | MLPMLGAIAPLAKILFSTIEKSVPDKDLQEKLKAQLNQ |
| Ga0114976_105991932 | 3300009184 | Freshwater Lake | MLPVLQAIAPLAKILFNTIDKAVPDKDLAAKLKADLQTQMLQSHT |
| Ga0114976_106693941 | 3300009184 | Freshwater Lake | MLPMLGAIAPLAKILFSTIEKSVPDKDLQEKLKAQLNQQL |
| Ga0114971_107501833 | 3300009185 | Freshwater Lake | MLGAIAPLAKILFSTIEKAVPDKDLQEKLKAQLNQQLLQSST |
| Ga0115545_12246173 | 3300009433 | Pelagic Marine | MLPMLNAVAPLAKILFSTIEKSVPDKDLQEKLKAQLQTQLMQ |
| Ga0098047_101060834 | 3300010155 | Marine | MLQLLGAVAPLAKTLLGTIDKAVPDKDLAQKIKAEFNNELL |
| Ga0114964_102453644 | 3300010157 | Freshwater Lake | MLPMLGAIAPLAKILFSTIEKAVPDRDLQEKLKAQLNQQLL |
| Ga0114967_102165481 | 3300010160 | Freshwater Lake | MLPMLGAIAPLAKILFSTIEKAVPDRDLQEKLKAQLNEQL |
| Ga0129333_114523493 | 3300010354 | Freshwater To Marine Saline Gradient | MMQMLGAVAPLAKILFSTVEKAVPDKDLQAKLKAELQTQLLQ |
| Ga0129336_102059234 | 3300010370 | Freshwater To Marine Saline Gradient | MLPMLNAVAPLAKILFSTIEKSVPDKDLQEKLKAQLQTQLLQSN |
| Ga0129336_104944293 | 3300010370 | Freshwater To Marine Saline Gradient | MLQMLGAVAPLAKILFSTVEKAVPDKDLQEKLKAQL |
| Ga0139557_10057783 | 3300011010 | Freshwater | MLPMLSAIAPLAKILFNTIEKSVPDKDLQAKLKAELQTQL |
| Ga0139556_10082451 | 3300011011 | Freshwater | MIQMLGAIAPLAKILFNTIEKSVPDKDLQAKLKADLQTQ |
| Ga0153805_10205433 | 3300012013 | Surface Ice | MLQMLGAVAPLAKILFNTIEKSVPDKDLQAKLKAELQTQL |
| Ga0153805_10229753 | 3300012013 | Surface Ice | MIQMLGAIAPLAKILFNTIEKSVPDKDLQAKLKADL |
| Ga0153801_10039521 | 3300012017 | Freshwater | MLQMLGAVAPLAKILFNTIEKSVPDKDLQEKLKSQLQTQL |
| Ga0157615_11482732 | 3300012734 | Freshwater | MLQMLGAVAPLAKILFSTIEKSVPDKDLQAKLKSDLQTQLLQ |
| Ga0164293_109567782 | 3300013004 | Freshwater | MLQAVAPLAKILFSTIEKSVPDKDLQEKLKAQLQTQLMQSH |
| (restricted) Ga0172362_104888234 | 3300013133 | Sediment | MLQMLGAVAPLAKILFNTIDKAVPDKDLQEKLKAQLQTQLLQSN |
| (restricted) Ga0172371_103616453 | 3300013138 | Freshwater | MIQMLGAVAPLAKILFSTIEKSVPDKELQAKLKADLQT |
| Ga0170791_106954135 | 3300013295 | Freshwater | MLPMLGAIAPLAKILFSTIEKAVPDRDLQDKLKAQLN |
| Ga0119960_11016982 | 3300014811 | Aquatic | MLPIIQAVAPLAKILFNTVDKAVADKDLAVKLKADRDRDWE |
| Ga0181338_10156901 | 3300015050 | Freshwater Lake | MLPMLGAIAPLAKILFSTIEKAVPDKDLQEKLKAQLNQQLLQS |
| Ga0181364_10704343 | 3300017701 | Freshwater Lake | MLPMLSAIAPLAKILFNTIEKSVPDKDLQAKLKAELQTQLLQS |
| Ga0181363_10624823 | 3300017707 | Freshwater Lake | MLPVLNAVAPLAKILFSTIEKSVPDKDLQEKLKAQMQTQLMQS |
| Ga0181350_10701853 | 3300017716 | Freshwater Lake | MLPMLGAIAPLAKILFSTIEKAVPDKDLQEKLKSQL |
| Ga0181350_11091863 | 3300017716 | Freshwater Lake | MLPMLGAIAPLAKILFNTIEKSVPDKDLQAKLKAELQTQLLQS |
| Ga0181350_11496463 | 3300017716 | Freshwater Lake | MLPILGAIAPLAKILFSTIEKAVPDKDLQEKLKAQLNQQL |
| Ga0181347_11986551 | 3300017722 | Freshwater Lake | MLPMLSAIAPLAKILFNTIEKSVPDKDLQAKLKAELQTQLLQSN |
| Ga0181362_10895162 | 3300017723 | Freshwater Lake | MLPMLSAIAPLAKILFNTIKKSVPDKDLQAKLKAELQTQLLQSNT |
| Ga0181365_10076681 | 3300017736 | Freshwater Lake | MIQMLGAVAPLAKILFSTIEKSVPDKDLQAKLKIGVDLAKQGMQSAKIITG |
| Ga0181356_11600544 | 3300017761 | Freshwater Lake | MFPMLGAIAPLAKILFSTIEKAVPDKDLQAKLKADLQTQLL |
| Ga0181356_11988331 | 3300017761 | Freshwater Lake | MLGAIAPLAKILFSTIEKAVPDKDLQEKLKAQLNQQL |
| Ga0181343_11383533 | 3300017766 | Freshwater Lake | MLQAVAPLAKILFSTIEKSVPDKDLQAKLKADLQT |
| Ga0181343_11912362 | 3300017766 | Freshwater Lake | MLSAVAPLAKILFNTIEKSIPDKDLQEKLKAQLNQQLLQS |
| Ga0181357_13037192 | 3300017777 | Freshwater Lake | MLPMLSAIAPLAKILFNTIEKSVPDKDLQAKLKAELQTQLLQ |
| Ga0181349_11467771 | 3300017778 | Freshwater Lake | MIQMLGAVAPLAKILFNTIEKAVPDKDLQEKLKAQLQTQL |
| Ga0181346_12446683 | 3300017780 | Freshwater Lake | MLPMLGAIAPLAKILFSTIEKAVPDKDLQAKLKADLQ |
| Ga0181346_13223763 | 3300017780 | Freshwater Lake | MLPILGAIAPLAKILFSTIEKAVPDKDLQEKLKAQLNQ |
| Ga0181355_13762963 | 3300017785 | Freshwater Lake | MLPILGAIAPLAKILFSTIEKAVPDKDLQEKLKAQLNQQ |
| Ga0181553_102648113 | 3300018416 | Salt Marsh | MLQMLGAVAPLAKILFNTIEKAVPDKDLQAKLKAE |
| Ga0181592_105948873 | 3300018421 | Salt Marsh | MLPALNIIAPLAKILFNTVDKAVLDKDQAEKLKAQLNTQLLQSGT |
| Ga0181361_1101743 | 3300019783 | Freshwater Lake | MIQMLGAIAPLAKILFSTIEKAVPDKDLQEKLKAQLNQQLLQS |
| Ga0181359_10650974 | 3300019784 | Freshwater Lake | MLPVLNAVAPLAKILFSTIEKSVPDKDLQEKLKAQLQTQLMQSH |
| Ga0181359_11534314 | 3300019784 | Freshwater Lake | MLPMLGAIAPLAKILFSTIEKAVPDKDLKAKLKADL |
| Ga0181359_11723813 | 3300019784 | Freshwater Lake | MLSAIAPLAKILFSTIEKAVPDKDLQEKLKSQLNQQLLQSST |
| Ga0181359_12424121 | 3300019784 | Freshwater Lake | MLPMLSAIAPLAKILFNTIEKSVPDKDLQAKLKAELQTQ |
| Ga0194110_107002641 | 3300020084 | Freshwater Lake | VIPALKLIAPIAQILFSTVDKAVTDKDLAAKLKAD |
| Ga0211736_102772291 | 3300020151 | Freshwater | MLNAVAPLAKILFSTIEKSVPDKDLQAKLKADLQTQLLQ |
| Ga0211726_102822961 | 3300020161 | Freshwater | MLSAIAPLAKILFSTIEKSVPDKDLQEKLKAQLNQQL |
| Ga0211726_109309501 | 3300020161 | Freshwater | MLGAVAPLAKILFSTIEKSVPDKDLQAKLKADLQTQL |
| Ga0211735_113566503 | 3300020162 | Freshwater | MIQMLGAVAPLAKILFNTIEKSVPDKDLQEKLKALLFKLSQEKLN |
| Ga0194115_104919111 | 3300020183 | Freshwater Lake | MLGAIAPLAKVLFSTIEKAVPDKDLQEKLKAQLQTQLLQS |
| Ga0194119_100708361 | 3300020220 | Freshwater Lake | MLQMLGAVAPLAKVLFSTIEKAVPDKDLQERLKAQ |
| Ga0194127_109482443 | 3300020221 | Freshwater Lake | MIPILQAVAPLAKILFNTVDKAVADKDLAAKLKADF |
| Ga0207939_10331463 | 3300020536 | Freshwater | MIQMLGAVAPLAKILFNTIEKSVPDKDLQEKLKAQLQ |
| Ga0208722_10342001 | 3300020537 | Freshwater | MLPMLNAVAPLAKILFNTIEKSVEDKDLQAKLKADLQTQLL |
| Ga0208360_10531603 | 3300020551 | Freshwater | MLNAIAPLAKILFSTIEKSVPDKDLQAKLKADLQT |
| Ga0208855_100020140 | 3300020553 | Freshwater | MIQMLGAVAPLAKILFNTIEKSVPDKDLQEKLKAQLQTQLLQ |
| Ga0208486_10393863 | 3300020556 | Freshwater | MIQMLGAVAPLAKILFSTIEKSVPDKDLQEKLKSQLQT |
| Ga0208231_10708573 | 3300020557 | Freshwater | MIQMLGAVAPLAKILFSTIEKSVPDKDLQEKLKSQL |
| Ga0214168_10050641 | 3300021140 | Freshwater | MLGAVAPLAKILFSTIEKSVPDKDLQEKLKSQLQTQLLQS |
| Ga0222713_107842893 | 3300021962 | Estuarine Water | MLPVLNAVAPLAKILFSTIEKSVPDKDLQEKLKAQLQTQLMQS |
| Ga0181353_10077223 | 3300022179 | Freshwater Lake | MLGAIAPLAKILFSTIEKAVPDKDLQERLKAQLNQQ |
| Ga0181353_10321651 | 3300022179 | Freshwater Lake | MLPMLNAIAPLAKILFNTIEKSVPDKDLQAKLKADLQIS |
| Ga0181354_10832501 | 3300022190 | Freshwater Lake | MLPALGAIAPLAKILFSTIEKSIPDKDLQEKLKAQLNQQLL |
| Ga0181351_11414573 | 3300022407 | Freshwater Lake | MIQAIAPLAKILFNTIEKSIPDKDLQAKLKADLQTQLMQS |
| Ga0214919_103514841 | 3300023184 | Freshwater | MLGAVAPLAKILFNTIEKAVPDKDLQEKLKAQLQT |
| Ga0209336_101172783 | 3300025137 | Marine | MLNLLGAVAPLAKTLLGTIDKAVPDKDLAQKIKAE |
| Ga0208147_10351533 | 3300025635 | Aqueous | MLPVLQAIAPLAKILFNTVDKAVADKDLAAKLKTELQTQMM |
| Ga0208795_10399761 | 3300025655 | Aqueous | MLPALNIIAPLAKILFNTVDKAVLDKDQAEKIKAQLNTQLLQ |
| Ga0208162_11890123 | 3300025674 | Aqueous | MLPALNIIAPLAKILFNTVDKAVLDKDQAEKLKAQLNTQLLH |
| Ga0255102_10154323 | 3300027144 | Freshwater | MIQMLGAVAPLAKILFNTIEKSVSDKDLQAKLKADLQ |
| Ga0255104_10228351 | 3300027146 | Freshwater | MIQMLGAVAPLAKILFSTIEKSVPDKDLQAKLKADLQTQL |
| Ga0209651_10604631 | 3300027581 | Freshwater Lake | MLPMLGAIAPLAKILFSTIEKAVPDKDLQAKLKADLQTQLL |
| Ga0255122_10046231 | 3300027595 | Freshwater | MIQMLGAVAPLAKILFNTIEKSVSDKDLQAKLKADLQTQLL |
| Ga0208974_11286223 | 3300027608 | Freshwater Lentic | MIPMLSAIAPLAKILFSTIEKAVPDKDLQERLKAQLNE |
| Ga0208951_11071491 | 3300027621 | Freshwater Lentic | MLGAVAPLAKILFNTIEKSVPDKDLQAKLKAELQTQ |
| Ga0208975_10176403 | 3300027659 | Freshwater Lentic | MIQMLGAVAPLAKILFSTIEKSVPDKDLQEKLKSQLQTQL |
| Ga0208975_10323273 | 3300027659 | Freshwater Lentic | MIQMLGAIAPLAKILFSTIEKAVPDKDLQEKLKAQLNQQ |
| Ga0209769_12624482 | 3300027679 | Freshwater Lake | MIQMLGAIAPLAKILFSTIEKAVPDKDLQEKLKAQLNQQLL |
| Ga0209553_10471951 | 3300027688 | Freshwater Lake | MLPILGAIAPLAKILFSTIEKAVPDKDLQEKLKAQLNQQLLQSS |
| Ga0209553_12554133 | 3300027688 | Freshwater Lake | MLSAIAPLAKILFNTIEKSVPDKDLQAKLKAELQTQLL |
| Ga0209551_10095325 | 3300027689 | Freshwater Lake | MIQMLGAVAPLAKILFNTIEKAVPDKDLQEKLKAQLQ |
| Ga0209551_12420133 | 3300027689 | Freshwater Lake | MLPMLGAIAPLAKILFSTIEKAVPDKDLQSKLKADLQTQLL |
| Ga0209443_13076082 | 3300027707 | Freshwater Lake | MLPILQAVAPLAKILFNTIDKAVPDKDLAAKLKND |
| Ga0209188_10436731 | 3300027708 | Freshwater Lake | MLPMLGAIAPLAKILFSTIEKAVPDRDLQEKLKAQLNQQLLQ |
| Ga0209188_10723951 | 3300027708 | Freshwater Lake | MLPMLGAIAPLAKILFNTIEKSVPDKDLQAKLKADLQTQL |
| Ga0209617_101139723 | 3300027720 | Freshwater And Sediment | MIQMLGAVAPLAKILFSTIEKSVPDKDLQAKLKADLQT |
| Ga0209617_102422013 | 3300027720 | Freshwater And Sediment | MIQMLGAVAPLAKILFSTIEKSVPDKDLQAKLKADLQTQLLQ |
| Ga0209297_13157453 | 3300027733 | Freshwater Lake | MIQMLGAVAPLAKILFSTIEKSVPDKDLQAKLKADLQTQ |
| Ga0209087_11760493 | 3300027734 | Freshwater Lake | MLGAVAPLAKILFNTIEKSVPDKDLQAKLKAELQTQL |
| Ga0209190_12849411 | 3300027736 | Freshwater Lake | MLNAIAPLAKILFNTIEKSVPDKDLQAKLKADLQTQLLQSN |
| Ga0209085_10075731 | 3300027741 | Freshwater Lake | MFPLLGAIAPLAKILFSTIEKAVPDKDLQEKLKAQLQTE |
| Ga0209085_10089021 | 3300027741 | Freshwater Lake | MLPMLGAIAPLAKILFSTIEKAVPDRDLQEKLKAQLNQQ |
| Ga0209593_101315051 | 3300027743 | Freshwater Sediment | MIQMLGAVAPLAKILFNTIEKSVPDKDLQEKLKAQLQTQ |
| Ga0209084_10052341 | 3300027749 | Freshwater Lake | MLGAIAPLAKILFSTIEKAVPDRDLQEKLKAQLNQQLLQ |
| Ga0209086_100064351 | 3300027770 | Freshwater Lake | MLPMLGAIAPLAKILFSTIEKSVPDKDLQEKLKAQ |
| Ga0209768_101210393 | 3300027772 | Freshwater Lake | MLSAIAPLAKILFSTIEKAVPDKDLQEKLKSQLNQQLLQS |
| Ga0209768_101864401 | 3300027772 | Freshwater Lake | MLGAVAPLAKILFNTIEKAVPDKDLQEKLKAQLQTQ |
| Ga0209500_102403443 | 3300027782 | Freshwater Lake | MLQMLGAVAPLAKILFNTIEKSVPDKDLQAKLKAELQ |
| Ga0209107_101332801 | 3300027797 | Freshwater And Sediment | MIQMLGAVAPLAKILFSTIEKSVPDKDLQAKLKADLQTQLLQS |
| Ga0209354_101524241 | 3300027808 | Freshwater Lake | MLPMLGAIAPLAKILFSTIEKAVPDKDLQAKLKADL |
| Ga0209191_10412821 | 3300027969 | Freshwater Lake | MLGAVAPLAKILFNTIEKAVPDKDLAEKLKADLQTQLLQ |
| Ga0255190_10074283 | 3300028083 | Freshwater | MIQMLGAVAPLAKILFNTIDKAVPDKDLQEKLKAQLQTQL |
| Ga0304729_11341881 | 3300028392 | Freshwater Lake | MLPMLGAIAPLAKILFSTIEKAVPDRDLQEKLKAQLNQ |
| Ga0304729_11445131 | 3300028392 | Freshwater Lake | MFPLLGAIAPLAKILFSTIEKAVPDKDLQEKLKAQL |
| Ga0304730_10193717 | 3300028394 | Freshwater Lake | MLGALSAIAPLAKILFNTVDKAVADKDLAAKLKADLQTQ |
| (restricted) Ga0247831_10367051 | 3300028559 | Freshwater | MIQMLGAVAPLAKILFSTIEKSVPDKDLQEKLKAQLQTQLL |
| (restricted) Ga0247831_12865071 | 3300028559 | Freshwater | MLGAVAPLAKILFNTIEKSVPDKDLQEKLKAQLQTQLL |
| (restricted) Ga0247840_101397431 | 3300028581 | Freshwater | MLNAIAPLAKILFSTIEKSVPDKDLQAKLKADLQTQLMQSH |
| Ga0307377_102775481 | 3300031673 | Soil | MLPMLGAIAPLAKILFSTIEKAVPDRDLQEKLKAQLNQQLLQSS |
| Ga0315293_103911221 | 3300031746 | Sediment | MLGAIAPLAKILFSTIEKAVPDKDLQEKLKAQLNQQLLQ |
| Ga0315900_106307093 | 3300031787 | Freshwater | MLPVLNAVAPLAKILFSTIEKSVPDKDLQEKLKAQLQTQLM |
| Ga0315901_108848261 | 3300031963 | Freshwater | MIQMLGAIAPLAKILFSTIEKAVPDKDLQEKLKAQLNQQLLQSST |
| Ga0315289_107043623 | 3300032046 | Sediment | MLPMLGAIAPLAKILFSTIEKSIPDKDLQEKLKAQLN |
| Ga0315905_112301701 | 3300032092 | Freshwater | MLGAVAPLAKILFSTIEKSVPDKDLQAKLKADLQTQLLQSN |
| Ga0315905_114640731 | 3300032092 | Freshwater | MLPMLGAIAPLAKILFSTIEKAVPDKDLQAKLKADLQTQLLQ |
| Ga0315902_110444332 | 3300032093 | Freshwater | MLPMLSAIAPLAKILFNTIEKSVPDKDLQAKLKAELQ |
| Ga0315268_105544901 | 3300032173 | Sediment | MLPMLGAIAPLAKILFSTIEKAVPDKDLQEKLKAQLNQ |
| Ga0315286_101076731 | 3300032342 | Sediment | MIPMLSAIAPLAKILFNTIEKAVPDKDLQERLKAQLNEQ |
| Ga0315287_107351931 | 3300032397 | Sediment | MLQMLGAVAPLAKILFSTIEKSVPDKDLQAKLKADLQ |
| Ga0334722_107199281 | 3300033233 | Sediment | MFPMLGAIAPLAKILFSTIEKAVPDKDLQEKLKAQLNQQLLQSS |
| Ga0334981_0464063_2_106 | 3300033980 | Freshwater | MIQMLGAVAPLAKILFNTIEKSVPDKDLQAKLKAD |
| Ga0334998_0200535_3_113 | 3300034019 | Freshwater | MIQMLGAVAPLAKILFSTIEKSVPDKDLQAKLKADLQ |
| Ga0334987_0633885_520_624 | 3300034061 | Freshwater | MLPVLNAVAPLAKILFSTIEKSVPDKDLQEKLKAQ |
| Ga0334995_0284144_1_123 | 3300034062 | Freshwater | MLQMLGAVAPLAKILFSTIEKSVPDKDLQAKLKADLQTQLL |
| Ga0334995_0777427_1_126 | 3300034062 | Freshwater | MIQMLGAVAPLAKILFSTIEKSVPDKDLQEKLKAQLQTQLLQ |
| Ga0335019_0055118_2596_2715 | 3300034066 | Freshwater | MIQMLGAVAPLAKILFSTIEKSVPDKYLQEKLKSQLQTQL |
| Ga0335020_0236091_1_108 | 3300034082 | Freshwater | MIQMLGAVAPLAKILFSTIEKSVPDKDLQEKLKAQL |
| Ga0335036_0749910_2_115 | 3300034106 | Freshwater | MLPMLGAVAPLAKILFNTIEKSIPDKDLQEKLKSQLQT |
| Ga0335037_0605053_1_126 | 3300034107 | Freshwater | MIQMLGAVAPLAKILFNTIEKSIPDKDLQEKLKSQLQTQLLQ |
| Ga0335055_0066871_1531_1653 | 3300034110 | Freshwater | MIQMLGAVAPLAKILFSTIEKSVPDKDLQAKLKADLQTQLL |
| Ga0335066_0290197_2_112 | 3300034112 | Freshwater | MLPMLNAIAPLAKILFNTVDKAVADKDLAAKLKADLQ |
| Ga0335066_0382935_1_111 | 3300034112 | Freshwater | MIQMLGAVAPLAKILFSTIEKSVPDKDLQEKLKSQLQ |
| Ga0335066_0690535_3_131 | 3300034112 | Freshwater | MIQMLGAVAPLAKILFNTIEKSIPDKDLQEKLKAQLQTQLLQS |
| Ga0335054_0213366_2_124 | 3300034119 | Freshwater | MIQMLGAVAPLAKILFNTIEKSVPDKDLQEKLKAQLQTQLL |
| Ga0335056_0138890_2_112 | 3300034120 | Freshwater | MLPVLNAIAPLAKILFNTVDKAVADKDLAAKLKADLQ |
| Ga0335065_0184551_1_126 | 3300034200 | Freshwater | MIQMLGAVAPLAKILFSTIEKSVPDKDLQEKLKSQLQTQLLQ |
| Ga0335007_0732434_1_108 | 3300034283 | Freshwater | MIQMLGAVAPLAKILFNTIEKSVPDKDLQEKLKSQL |
| ⦗Top⦘ |