| Basic Information | |
|---|---|
| Family ID | F032873 |
| Family Type | Metagenome |
| Number of Sequences | 179 |
| Average Sequence Length | 38 residues |
| Representative Sequence | LRAKIGDDAKDGAGHIANMAKPADKVSADFGRNPGAGI |
| Number of Associated Samples | 110 |
| Number of Associated Scaffolds | 179 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 27.93 % |
| % of genes from short scaffolds (< 2000 bps) | 76.54 % |
| Associated GOLD sequencing projects | 106 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.14 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (75.419 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil (45.810 % of family members) |
| Environment Ontology (ENVO) | Unclassified (54.190 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) (66.480 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.14 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 179 Family Scaffolds |
|---|---|---|
| PF03401 | TctC | 3.35 |
| PF01066 | CDP-OH_P_transf | 2.79 |
| PF02668 | TauD | 1.68 |
| PF00005 | ABC_tran | 1.68 |
| PF13242 | Hydrolase_like | 1.68 |
| PF00892 | EamA | 1.68 |
| PF00475 | IGPD | 1.12 |
| PF00380 | Ribosomal_S9 | 1.12 |
| PF03480 | DctP | 1.12 |
| PF08750 | CNP1 | 1.12 |
| PF00497 | SBP_bac_3 | 1.12 |
| PF03446 | NAD_binding_2 | 1.12 |
| PF13531 | SBP_bac_11 | 1.12 |
| PF02515 | CoA_transf_3 | 1.12 |
| PF07992 | Pyr_redox_2 | 1.12 |
| PF04972 | BON | 1.12 |
| PF01977 | UbiD | 1.12 |
| PF13442 | Cytochrome_CBB3 | 1.12 |
| PF06835 | LptC | 1.12 |
| PF00795 | CN_hydrolase | 1.12 |
| PF03328 | HpcH_HpaI | 1.12 |
| PF00069 | Pkinase | 1.12 |
| PF01925 | TauE | 0.56 |
| PF03724 | META | 0.56 |
| PF00873 | ACR_tran | 0.56 |
| PF13561 | adh_short_C2 | 0.56 |
| PF14698 | ASL_C2 | 0.56 |
| PF05683 | Fumerase_C | 0.56 |
| PF02775 | TPP_enzyme_C | 0.56 |
| PF00578 | AhpC-TSA | 0.56 |
| PF02348 | CTP_transf_3 | 0.56 |
| PF02540 | NAD_synthase | 0.56 |
| PF05173 | DapB_C | 0.56 |
| PF01494 | FAD_binding_3 | 0.56 |
| PF02628 | COX15-CtaA | 0.56 |
| PF06808 | DctM | 0.56 |
| PF03477 | ATP-cone | 0.56 |
| PF09242 | FCSD-flav_bind | 0.56 |
| PF12826 | HHH_2 | 0.56 |
| PF13563 | 2_5_RNA_ligase2 | 0.56 |
| PF13416 | SBP_bac_8 | 0.56 |
| PF04909 | Amidohydro_2 | 0.56 |
| PF01654 | Cyt_bd_oxida_I | 0.56 |
| PF00572 | Ribosomal_L13 | 0.56 |
| PF02574 | S-methyl_trans | 0.56 |
| PF03972 | MmgE_PrpD | 0.56 |
| PF09339 | HTH_IclR | 0.56 |
| PF13202 | EF-hand_5 | 0.56 |
| PF02894 | GFO_IDH_MocA_C | 0.56 |
| PF04143 | Sulf_transp | 0.56 |
| PF04397 | LytTR | 0.56 |
| PF00561 | Abhydrolase_1 | 0.56 |
| PF00756 | Esterase | 0.56 |
| PF10861 | DUF2784 | 0.56 |
| PF08007 | JmjC_2 | 0.56 |
| PF13847 | Methyltransf_31 | 0.56 |
| PF01869 | BcrAD_BadFG | 0.56 |
| PF01121 | CoaE | 0.56 |
| PF02910 | Succ_DH_flav_C | 0.56 |
| PF02470 | MlaD | 0.56 |
| PF00535 | Glycos_transf_2 | 0.56 |
| PF00596 | Aldolase_II | 0.56 |
| PF13714 | PEP_mutase | 0.56 |
| PF00378 | ECH_1 | 0.56 |
| PF00313 | CSD | 0.56 |
| PF00044 | Gp_dh_N | 0.56 |
| PF04354 | ZipA_C | 0.56 |
| PF04339 | FemAB_like | 0.56 |
| PF04355 | SmpA_OmlA | 0.56 |
| PF02254 | TrkA_N | 0.56 |
| PF02653 | BPD_transp_2 | 0.56 |
| PF02685 | Glucokinase | 0.56 |
| PF00515 | TPR_1 | 0.56 |
| PF00300 | His_Phos_1 | 0.56 |
| PF00072 | Response_reg | 0.56 |
| PF01882 | DUF58 | 0.56 |
| PF02391 | MoaE | 0.56 |
| PF00730 | HhH-GPD | 0.56 |
| PF16320 | Ribosomal_L12_N | 0.56 |
| PF13432 | TPR_16 | 0.56 |
| PF05977 | MFS_3 | 0.56 |
| PF00903 | Glyoxalase | 0.56 |
| PF16576 | HlyD_D23 | 0.56 |
| PF04107 | GCS2 | 0.56 |
| PF01963 | TraB_PrgY_gumN | 0.56 |
| PF02880 | PGM_PMM_III | 0.56 |
| PF08309 | LVIVD | 0.56 |
| PF04290 | DctQ | 0.56 |
| PF03992 | ABM | 0.56 |
| PF02777 | Sod_Fe_C | 0.56 |
| PF00342 | PGI | 0.56 |
| PF05673 | DUF815 | 0.56 |
| PF00768 | Peptidase_S11 | 0.56 |
| PF07883 | Cupin_2 | 0.56 |
| PF00977 | His_biosynth | 0.56 |
| PF03033 | Glyco_transf_28 | 0.56 |
| PF02844 | GARS_N | 0.56 |
| PF00106 | adh_short | 0.56 |
| PF01144 | CoA_trans | 0.56 |
| PF01597 | GCV_H | 0.56 |
| PF01475 | FUR | 0.56 |
| PF02601 | Exonuc_VII_L | 0.56 |
| PF10609 | ParA | 0.56 |
| PF03781 | FGE-sulfatase | 0.56 |
| PF01226 | Form_Nir_trans | 0.56 |
| PF08308 | PEGA | 0.56 |
| PF01300 | Sua5_yciO_yrdC | 0.56 |
| PF00821 | PEPCK_GTP | 0.56 |
| PF07475 | Hpr_kinase_C | 0.56 |
| PF02881 | SRP54_N | 0.56 |
| PF13098 | Thioredoxin_2 | 0.56 |
| PF02684 | LpxB | 0.56 |
| PF01023 | S_100 | 0.56 |
| PF04613 | LpxD | 0.56 |
| PF01783 | Ribosomal_L32p | 0.56 |
| COG ID | Name | Functional Category | % Frequency in 179 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 4.47 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 3.35 |
| COG0558 | Phosphatidylglycerophosphate synthase | Lipid transport and metabolism [I] | 2.79 |
| COG1183 | Phosphatidylserine synthase | Lipid transport and metabolism [I] | 2.79 |
| COG5050 | sn-1,2-diacylglycerol ethanolamine- and cholinephosphotranferases | Lipid transport and metabolism [I] | 2.79 |
| COG2175 | Taurine dioxygenase, alpha-ketoglutarate-dependent | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.68 |
| COG0103 | Ribosomal protein S9 | Translation, ribosomal structure and biogenesis [J] | 1.12 |
| COG0131 | Imidazoleglycerol phosphate dehydratase HisB | Amino acid transport and metabolism [E] | 1.12 |
| COG3836 | 2-keto-3-deoxy-L-rhamnonate aldolase RhmA | Carbohydrate transport and metabolism [G] | 1.12 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.12 |
| COG2301 | Citrate lyase beta subunit | Carbohydrate transport and metabolism [G] | 1.12 |
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 1.12 |
| COG0469 | Pyruvate kinase | Carbohydrate transport and metabolism [G] | 1.12 |
| COG0043 | 3-polyprenyl-4-hydroxybenzoate decarboxylase | Coenzyme transport and metabolism [H] | 1.12 |
| COG2040 | Homocysteine/selenocysteine methylase (S-methylmethionine-dependent) | Amino acid transport and metabolism [E] | 0.56 |
| COG1493 | Serine kinase of the HPr protein, regulates carbohydrate metabolism | Signal transduction mechanisms [T] | 0.56 |
| COG1916 | Pheromone shutdown protein TraB, contains GTxH motif (function unknown) | Function unknown [S] | 0.56 |
| COG1861 | Spore coat polysaccharide biosynthesis protein SpsF, cytidylyltransferase family | Cell wall/membrane/envelope biogenesis [M] | 0.56 |
| COG2057 | Acyl-CoA:acetate/3-ketoacid CoA transferase, beta subunit | Lipid transport and metabolism [I] | 0.56 |
| COG1838 | Tartrate dehydratase beta subunit/Fumarate hydratase class I, C-terminal domain | Energy production and conversion [C] | 0.56 |
| COG1788 | Acyl CoA:acetate/3-ketoacid CoA transferase, alpha subunit | Lipid transport and metabolism [I] | 0.56 |
| COG1721 | Uncharacterized conserved protein, DUF58 family, contains vWF domain | Function unknown [S] | 0.56 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.56 |
| COG1612 | Heme A synthase | Coenzyme transport and metabolism [H] | 0.56 |
| COG1570 | Exonuclease VII, large subunit | Replication, recombination and repair [L] | 0.56 |
| COG5276 | Uncharacterized secreted protein, contains LVIVD repeats, choice-of-anchor domain | Function unknown [S] | 0.56 |
| COG2079 | 2-methylcitrate dehydratase PrpD | Carbohydrate transport and metabolism [G] | 0.56 |
| COG2116 | Formate/nitrite transporter FocA, FNT family | Inorganic ion transport and metabolism [P] | 0.56 |
| COG2231 | 3-Methyladenine DNA glycosylase, HhH-GPD/Endo3 superfamily | Replication, recombination and repair [L] | 0.56 |
| COG2391 | Uncharacterized membrane protein YedE/YeeE, contains two sulfur transport domains | General function prediction only [R] | 0.56 |
| COG2607 | Predicted ATPase, AAA+ superfamily | General function prediction only [R] | 0.56 |
| COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 0.56 |
| COG2850 | Ribosomal protein L16 Arg81 hydroxylase, contains JmjC domain | Translation, ribosomal structure and biogenesis [J] | 0.56 |
| COG2913 | Outer membrane protein assembly factor BamE, lipoprotein component of the BamABCDE complex | Cell wall/membrane/envelope biogenesis [M] | 0.56 |
| COG3115 | Cell division protein ZipA, interacts with FtsZ | Cell cycle control, cell division, chromosome partitioning [D] | 0.56 |
| COG3146 | Predicted N-acyltransferase | General function prediction only [R] | 0.56 |
| COG3187 | Heat shock protein HslJ | Posttranslational modification, protein turnover, chaperones [O] | 0.56 |
| COG4670 | Acyl CoA:acetate/3-ketoacid CoA transferase | Lipid transport and metabolism [I] | 0.56 |
| COG0033 | Phosphoglucomutase/phosphomannomutase | Carbohydrate transport and metabolism [G] | 0.56 |
| COG0646 | Methionine synthase I (cobalamin-dependent), methyltransferase domain | Amino acid transport and metabolism [E] | 0.56 |
| COG0057 | Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase | Carbohydrate transport and metabolism [G] | 0.56 |
| COG0102 | Ribosomal protein L13 | Translation, ribosomal structure and biogenesis [J] | 0.56 |
| COG0122 | 3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 0.56 |
| COG0151 | Phosphoribosylamine-glycine ligase | Nucleotide transport and metabolism [F] | 0.56 |
| COG0166 | Glucose-6-phosphate isomerase | Carbohydrate transport and metabolism [G] | 0.56 |
| COG0171 | NH3-dependent NAD+ synthetase | Coenzyme transport and metabolism [H] | 0.56 |
| COG0177 | Endonuclease III | Replication, recombination and repair [L] | 0.56 |
| COG0237 | Dephospho-CoA kinase | Coenzyme transport and metabolism [H] | 0.56 |
| COG0289 | 4-hydroxy-tetrahydrodipicolinate reductase | Amino acid transport and metabolism [E] | 0.56 |
| COG0314 | Molybdopterin synthase catalytic subunit MoaE | Coenzyme transport and metabolism [H] | 0.56 |
| COG0333 | Ribosomal protein L32 | Translation, ribosomal structure and biogenesis [J] | 0.56 |
| COG0509 | Glycine cleavage system protein H (lipoate-binding) | Amino acid transport and metabolism [E] | 0.56 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.56 |
| COG0605 | Superoxide dismutase | Inorganic ion transport and metabolism [P] | 0.56 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.56 |
| COG1274 | Phosphoenolpyruvate carboxykinase, GTP-dependent | Energy production and conversion [C] | 0.56 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.56 |
| COG0673 | Predicted dehydrogenase | General function prediction only [R] | 0.56 |
| COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 0.56 |
| COG0735 | Fe2+ or Zn2+ uptake regulation protein Fur/Zur | Inorganic ion transport and metabolism [P] | 0.56 |
| COG0763 | Lipid A disaccharide synthetase | Cell wall/membrane/envelope biogenesis [M] | 0.56 |
| COG0837 | Glucokinase | Carbohydrate transport and metabolism [G] | 0.56 |
| COG1044 | UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase | Cell wall/membrane/envelope biogenesis [M] | 0.56 |
| COG1059 | Thermostable 8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 0.56 |
| COG1083 | CMP-N-acetylneuraminic acid synthetase, NeuA/PseF family | Cell wall/membrane/envelope biogenesis [M] | 0.56 |
| COG1109 | Phosphomannomutase | Carbohydrate transport and metabolism [G] | 0.56 |
| COG1194 | Adenine-specific DNA glycosylase, acts on AG and A-oxoG pairs | Replication, recombination and repair [L] | 0.56 |
| COG1212 | CMP-2-keto-3-deoxyoctulosonic acid synthetase | Cell wall/membrane/envelope biogenesis [M] | 0.56 |
| COG1262 | Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domain | Posttranslational modification, protein turnover, chaperones [O] | 0.56 |
| COG1271 | Cytochrome bd-type quinol oxidase, subunit 1 | Energy production and conversion [C] | 0.56 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 75.42 % |
| Unclassified | root | N/A | 24.58 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001372|YBBDRAFT_1132864 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuricella → Sulfuricella denitrificans | 8958 | Open in IMG/M |
| 3300002121|C687J26615_10003813 | Not Available | 3276 | Open in IMG/M |
| 3300002121|C687J26615_10051603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1023 | Open in IMG/M |
| 3300002121|C687J26615_10087733 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 777 | Open in IMG/M |
| 3300004009|Ga0055437_10320839 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300005545|Ga0070695_100155071 | Not Available | 1602 | Open in IMG/M |
| 3300005829|Ga0074479_10186172 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 29265 | Open in IMG/M |
| 3300005829|Ga0074479_10926358 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 9850 | Open in IMG/M |
| 3300005836|Ga0074470_11590447 | Not Available | 1426 | Open in IMG/M |
| 3300006847|Ga0075431_100673221 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1014 | Open in IMG/M |
| 3300006853|Ga0075420_100231687 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1608 | Open in IMG/M |
| 3300006969|Ga0075419_11426822 | Not Available | 517 | Open in IMG/M |
| 3300007004|Ga0079218_10543864 | Not Available | 1042 | Open in IMG/M |
| 3300007004|Ga0079218_11155553 | Not Available | 797 | Open in IMG/M |
| 3300009430|Ga0114938_1088388 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1132 | Open in IMG/M |
| 3300009527|Ga0114942_1229539 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 684 | Open in IMG/M |
| 3300009597|Ga0105259_1006210 | Not Available | 2251 | Open in IMG/M |
| 3300009597|Ga0105259_1026364 | Not Available | 1234 | Open in IMG/M |
| 3300009597|Ga0105259_1172985 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13 | 526 | Open in IMG/M |
| 3300009609|Ga0105347_1000680 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 15720 | Open in IMG/M |
| 3300009609|Ga0105347_1517964 | Not Available | 519 | Open in IMG/M |
| 3300009610|Ga0105340_1000039 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 61301 | Open in IMG/M |
| 3300009610|Ga0105340_1094081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1198 | Open in IMG/M |
| 3300009678|Ga0105252_10046776 | All Organisms → cellular organisms → Bacteria | 1629 | Open in IMG/M |
| 3300009805|Ga0105079_1046670 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 508 | Open in IMG/M |
| 3300009814|Ga0105082_1036820 | Not Available | 794 | Open in IMG/M |
| 3300010391|Ga0136847_10367134 | All Organisms → cellular organisms → Bacteria | 3140 | Open in IMG/M |
| 3300010391|Ga0136847_10480156 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 655 | Open in IMG/M |
| 3300010391|Ga0136847_12524045 | All Organisms → cellular organisms → Bacteria | 1827 | Open in IMG/M |
| 3300010400|Ga0134122_10433031 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1171 | Open in IMG/M |
| 3300011395|Ga0137315_1005336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1378 | Open in IMG/M |
| 3300011398|Ga0137348_1004006 | All Organisms → cellular organisms → Bacteria | 2271 | Open in IMG/M |
| 3300011398|Ga0137348_1014073 | Not Available | 1218 | Open in IMG/M |
| 3300011398|Ga0137348_1023040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 985 | Open in IMG/M |
| 3300011402|Ga0137356_1002603 | All Organisms → cellular organisms → Bacteria | 3044 | Open in IMG/M |
| 3300011403|Ga0137313_1002248 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4268 | Open in IMG/M |
| 3300011405|Ga0137340_1006068 | Not Available | 2180 | Open in IMG/M |
| 3300011409|Ga0137323_1062415 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
| 3300011413|Ga0137333_1086852 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_02_FULL_67_26 | 722 | Open in IMG/M |
| 3300011415|Ga0137325_1033146 | Not Available | 1059 | Open in IMG/M |
| 3300011415|Ga0137325_1067948 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300011415|Ga0137325_1069345 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300011416|Ga0137422_1080137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 784 | Open in IMG/M |
| 3300011417|Ga0137326_1005584 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3003 | Open in IMG/M |
| 3300011419|Ga0137446_1060610 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 860 | Open in IMG/M |
| 3300011420|Ga0137314_1043653 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1087 | Open in IMG/M |
| 3300011420|Ga0137314_1052858 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 982 | Open in IMG/M |
| 3300011420|Ga0137314_1057816 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 939 | Open in IMG/M |
| 3300011420|Ga0137314_1162357 | Not Available | 543 | Open in IMG/M |
| 3300011421|Ga0137462_1047978 | Not Available | 923 | Open in IMG/M |
| 3300011430|Ga0137423_1122075 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 780 | Open in IMG/M |
| 3300011433|Ga0137443_1191703 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 610 | Open in IMG/M |
| 3300011435|Ga0137426_1074919 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 923 | Open in IMG/M |
| 3300011437|Ga0137429_1114595 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 825 | Open in IMG/M |
| 3300011438|Ga0137451_1179520 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300011440|Ga0137433_1007902 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3264 | Open in IMG/M |
| 3300011440|Ga0137433_1045720 | Not Available | 1295 | Open in IMG/M |
| 3300011445|Ga0137427_10011451 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae | 3521 | Open in IMG/M |
| 3300011445|Ga0137427_10039114 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1868 | Open in IMG/M |
| 3300011445|Ga0137427_10454979 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 528 | Open in IMG/M |
| 3300012034|Ga0137453_1097584 | Not Available | 577 | Open in IMG/M |
| 3300012038|Ga0137431_1184871 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Gallionellaceae → Gallionella → unclassified Gallionella → Gallionella sp. | 592 | Open in IMG/M |
| 3300012039|Ga0137421_1005580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2542 | Open in IMG/M |
| 3300012039|Ga0137421_1067920 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 993 | Open in IMG/M |
| 3300012039|Ga0137421_1166162 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 652 | Open in IMG/M |
| 3300012041|Ga0137430_1009552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2439 | Open in IMG/M |
| 3300012041|Ga0137430_1061225 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1031 | Open in IMG/M |
| 3300012041|Ga0137430_1141930 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300012133|Ga0137329_1004537 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1359 | Open in IMG/M |
| 3300012157|Ga0137353_1004186 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2081 | Open in IMG/M |
| 3300012159|Ga0137344_1078150 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 608 | Open in IMG/M |
| 3300012161|Ga0137336_1037015 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 883 | Open in IMG/M |
| 3300012164|Ga0137352_1077658 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 661 | Open in IMG/M |
| 3300012167|Ga0137319_1002388 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4319 | Open in IMG/M |
| 3300012172|Ga0137320_1012209 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1668 | Open in IMG/M |
| 3300012172|Ga0137320_1019206 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1352 | Open in IMG/M |
| 3300012172|Ga0137320_1047203 | Not Available | 889 | Open in IMG/M |
| 3300012172|Ga0137320_1051042 | Not Available | 857 | Open in IMG/M |
| 3300012172|Ga0137320_1117992 | Not Available | 565 | Open in IMG/M |
| 3300012174|Ga0137338_1002654 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3010 | Open in IMG/M |
| 3300012175|Ga0137321_1079315 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300012225|Ga0137434_1006515 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1223 | Open in IMG/M |
| 3300012670|Ga0137335_1026526 | Not Available | 560 | Open in IMG/M |
| 3300012671|Ga0137318_1020168 | Not Available | 661 | Open in IMG/M |
| 3300012676|Ga0137341_1016282 | All Organisms → cellular organisms → Bacteria | 1178 | Open in IMG/M |
| 3300012676|Ga0137341_1079671 | Not Available | 543 | Open in IMG/M |
| 3300014318|Ga0075351_1038516 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 840 | Open in IMG/M |
| 3300014321|Ga0075353_1043426 | Not Available | 911 | Open in IMG/M |
| 3300014324|Ga0075352_1002585 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3050 | Open in IMG/M |
| 3300014324|Ga0075352_1063338 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 900 | Open in IMG/M |
| 3300014324|Ga0075352_1118120 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 715 | Open in IMG/M |
| 3300014866|Ga0180090_1009225 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1433 | Open in IMG/M |
| 3300014868|Ga0180088_1075124 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 605 | Open in IMG/M |
| 3300014872|Ga0180087_1058212 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 731 | Open in IMG/M |
| 3300014873|Ga0180066_1085992 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 646 | Open in IMG/M |
| 3300014873|Ga0180066_1091952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 624 | Open in IMG/M |
| 3300014873|Ga0180066_1092591 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 622 | Open in IMG/M |
| 3300014873|Ga0180066_1097202 | Not Available | 607 | Open in IMG/M |
| 3300014873|Ga0180066_1135132 | Not Available | 508 | Open in IMG/M |
| 3300014875|Ga0180083_1119601 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300014876|Ga0180064_1027725 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1098 | Open in IMG/M |
| 3300014878|Ga0180065_1007623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2082 | Open in IMG/M |
| 3300014878|Ga0180065_1081936 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 723 | Open in IMG/M |
| 3300014879|Ga0180062_1088955 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Comamonas → Comamonas thiooxydans | 695 | Open in IMG/M |
| 3300014884|Ga0180104_1017946 | All Organisms → cellular organisms → Bacteria | 1725 | Open in IMG/M |
| 3300015252|Ga0180075_1052858 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SG8_41 | 677 | Open in IMG/M |
| 3300018031|Ga0184634_10148527 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1051 | Open in IMG/M |
| 3300018031|Ga0184634_10333994 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_58 | 695 | Open in IMG/M |
| 3300018031|Ga0184634_10569543 | Not Available | 500 | Open in IMG/M |
| 3300018059|Ga0184615_10481279 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 671 | Open in IMG/M |
| 3300018063|Ga0184637_10043558 | All Organisms → cellular organisms → Bacteria | 2730 | Open in IMG/M |
| 3300018063|Ga0184637_10077681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_02_FULL_67_26 | 2035 | Open in IMG/M |
| 3300018063|Ga0184637_10106795 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1723 | Open in IMG/M |
| 3300018063|Ga0184637_10317446 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 941 | Open in IMG/M |
| 3300018063|Ga0184637_10418198 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 795 | Open in IMG/M |
| 3300018063|Ga0184637_10469990 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas syringae group → Pseudomonas syringae group genomosp. 1 → Pseudomonas syringae | 736 | Open in IMG/M |
| 3300018063|Ga0184637_10537284 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 674 | Open in IMG/M |
| 3300018063|Ga0184637_10644665 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300018063|Ga0184637_10754691 | Not Available | 524 | Open in IMG/M |
| 3300018077|Ga0184633_10024522 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2997 | Open in IMG/M |
| 3300018077|Ga0184633_10173596 | All Organisms → cellular organisms → Bacteria | 1116 | Open in IMG/M |
| 3300018077|Ga0184633_10274199 | Not Available | 864 | Open in IMG/M |
| 3300018077|Ga0184633_10344524 | Not Available | 753 | Open in IMG/M |
| 3300018077|Ga0184633_10587722 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300018079|Ga0184627_10687556 | Not Available | 502 | Open in IMG/M |
| 3300018082|Ga0184639_10026971 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2907 | Open in IMG/M |
| 3300018082|Ga0184639_10028050 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2854 | Open in IMG/M |
| 3300018082|Ga0184639_10372921 | Not Available | 741 | Open in IMG/M |
| 3300018082|Ga0184639_10595972 | Not Available | 542 | Open in IMG/M |
| 3300018083|Ga0184628_10459575 | Not Available | 662 | Open in IMG/M |
| 3300018469|Ga0190270_11077984 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 835 | Open in IMG/M |
| 3300019458|Ga0187892_10001603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 50542 | Open in IMG/M |
| 3300020060|Ga0193717_1130686 | Not Available | 760 | Open in IMG/M |
| 3300024241|Ga0233392_1025492 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 622 | Open in IMG/M |
| 3300025106|Ga0209398_1117245 | Not Available | 632 | Open in IMG/M |
| 3300025159|Ga0209619_10428084 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 673 | Open in IMG/M |
| 3300025160|Ga0209109_10078331 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1723 | Open in IMG/M |
| 3300025324|Ga0209640_10886011 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 696 | Open in IMG/M |
| 3300025325|Ga0209341_11036780 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_64_32 | 598 | Open in IMG/M |
| 3300025955|Ga0210071_1001076 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2819 | Open in IMG/M |
| 3300025957|Ga0210089_1017086 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| 3300025957|Ga0210089_1042601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13 | 575 | Open in IMG/M |
| 3300025962|Ga0210070_1001268 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2367 | Open in IMG/M |
| 3300025962|Ga0210070_1035874 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter | 595 | Open in IMG/M |
| 3300025973|Ga0210145_1006937 | Not Available | 1162 | Open in IMG/M |
| 3300025979|Ga0210078_1001008 | All Organisms → cellular organisms → Bacteria | 2700 | Open in IMG/M |
| 3300025985|Ga0210117_1004882 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1600 | Open in IMG/M |
| 3300027384|Ga0209854_1096651 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter | 528 | Open in IMG/M |
| 3300027513|Ga0208685_1000125 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 30132 | Open in IMG/M |
| 3300027513|Ga0208685_1000135 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 29037 | Open in IMG/M |
| 3300027533|Ga0208185_1000411 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 20296 | Open in IMG/M |
| 3300027657|Ga0256865_1007986 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2831 | Open in IMG/M |
| 3300028812|Ga0247825_10149887 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1599 | Open in IMG/M |
| 3300031226|Ga0307497_10035101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1665 | Open in IMG/M |
| 3300031949|Ga0214473_10038902 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 5583 | Open in IMG/M |
| 3300031949|Ga0214473_10212142 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium GR16-43 | 2237 | Open in IMG/M |
| 3300031965|Ga0326597_10163143 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2648 | Open in IMG/M |
| 3300031965|Ga0326597_10211691 | All Organisms → cellular organisms → Bacteria | 2264 | Open in IMG/M |
| 3300031965|Ga0326597_10650007 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1118 | Open in IMG/M |
| 3300031965|Ga0326597_11215002 | Not Available | 743 | Open in IMG/M |
| 3300031965|Ga0326597_11849013 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13 | 564 | Open in IMG/M |
| 3300031965|Ga0326597_11970118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 541 | Open in IMG/M |
| 3300033004|Ga0335084_12046261 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 557 | Open in IMG/M |
| 3300033233|Ga0334722_10139171 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1823 | Open in IMG/M |
| 3300033233|Ga0334722_11119839 | Not Available | 552 | Open in IMG/M |
| 3300033407|Ga0214472_10131795 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2460 | Open in IMG/M |
| 3300033814|Ga0364930_0014363 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2640 | Open in IMG/M |
| 3300033814|Ga0364930_0033931 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria | 1728 | Open in IMG/M |
| 3300033814|Ga0364930_0320997 | Not Available | 520 | Open in IMG/M |
| 3300034113|Ga0364937_016037 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1199 | Open in IMG/M |
| 3300034113|Ga0364937_096654 | Not Available | 600 | Open in IMG/M |
| 3300034114|Ga0364938_012034 | Not Available | 1222 | Open in IMG/M |
| 3300034114|Ga0364938_030687 | Not Available | 869 | Open in IMG/M |
| 3300034114|Ga0364938_073142 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 630 | Open in IMG/M |
| 3300034147|Ga0364925_0059130 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1314 | Open in IMG/M |
| 3300034177|Ga0364932_0110615 | Not Available | 1043 | Open in IMG/M |
| 3300034177|Ga0364932_0276189 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300034178|Ga0364934_0025570 | All Organisms → cellular organisms → Bacteria | 2150 | Open in IMG/M |
| 3300034690|Ga0364923_0023174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1402 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 45.81% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 13.41% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 7.26% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.59% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 5.03% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 2.79% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 2.79% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.12% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.12% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.12% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 1.68% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 1.68% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 1.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 1.68% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.68% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.68% |
| Marine Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine Estuarine | 0.56% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.56% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.56% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.56% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.56% |
| Bio-Ooze | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze | 0.56% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001372 | YB-Back-sed | Environmental | Open in IMG/M |
| 3300002121 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 | Environmental | Open in IMG/M |
| 3300004009 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D2 | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005829 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBC | Environmental | Open in IMG/M |
| 3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009430 | Groundwater microbial communities from Big Spring, Nevada to study Microbial Dark Matter (Phase II) - Ash Meadows Big Spring | Environmental | Open in IMG/M |
| 3300009527 | Groundwater microbial communities from Cold Creek, Nevada to study Microbial Dark Matter (Phase II) - Lower Cold Creek | Environmental | Open in IMG/M |
| 3300009597 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT299 | Environmental | Open in IMG/M |
| 3300009609 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 | Environmental | Open in IMG/M |
| 3300009610 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 | Environmental | Open in IMG/M |
| 3300009678 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 | Environmental | Open in IMG/M |
| 3300009805 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_0_10 | Environmental | Open in IMG/M |
| 3300009814 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60 | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011395 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT200_2 | Environmental | Open in IMG/M |
| 3300011398 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT600_2 | Environmental | Open in IMG/M |
| 3300011402 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT830_2 | Environmental | Open in IMG/M |
| 3300011403 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT166_2 | Environmental | Open in IMG/M |
| 3300011405 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT400_2 | Environmental | Open in IMG/M |
| 3300011409 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT423_2 | Environmental | Open in IMG/M |
| 3300011413 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT231_2 | Environmental | Open in IMG/M |
| 3300011415 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT469_2 | Environmental | Open in IMG/M |
| 3300011416 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT551_2 | Environmental | Open in IMG/M |
| 3300011417 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT500_2 | Environmental | Open in IMG/M |
| 3300011419 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT357_2 | Environmental | Open in IMG/M |
| 3300011420 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT199_2 | Environmental | Open in IMG/M |
| 3300011421 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT769_2 | Environmental | Open in IMG/M |
| 3300011430 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT600_2 | Environmental | Open in IMG/M |
| 3300011433 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT300_2 | Environmental | Open in IMG/M |
| 3300011435 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT660_2 | Environmental | Open in IMG/M |
| 3300011437 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT736_2 | Environmental | Open in IMG/M |
| 3300011438 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT500_2 | Environmental | Open in IMG/M |
| 3300011440 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT840_2 | Environmental | Open in IMG/M |
| 3300011445 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT700_2 | Environmental | Open in IMG/M |
| 3300012034 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT526_2 | Environmental | Open in IMG/M |
| 3300012038 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT800_2 | Environmental | Open in IMG/M |
| 3300012039 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT534_2 | Environmental | Open in IMG/M |
| 3300012041 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT754_2 | Environmental | Open in IMG/M |
| 3300012133 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT121_2 | Environmental | Open in IMG/M |
| 3300012157 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT760_2 | Environmental | Open in IMG/M |
| 3300012159 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT500_2 | Environmental | Open in IMG/M |
| 3300012161 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT300_2 | Environmental | Open in IMG/M |
| 3300012164 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT730_2 | Environmental | Open in IMG/M |
| 3300012167 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT333_2 | Environmental | Open in IMG/M |
| 3300012172 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT366_2 | Environmental | Open in IMG/M |
| 3300012174 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT366_2 | Environmental | Open in IMG/M |
| 3300012175 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT399_2 | Environmental | Open in IMG/M |
| 3300012225 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT860_2 | Environmental | Open in IMG/M |
| 3300012670 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT293_2 | Environmental | Open in IMG/M |
| 3300012671 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT300_2 | Environmental | Open in IMG/M |
| 3300012676 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT433_2 | Environmental | Open in IMG/M |
| 3300014318 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D1_rd | Environmental | Open in IMG/M |
| 3300014321 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D1 | Environmental | Open in IMG/M |
| 3300014324 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D1 | Environmental | Open in IMG/M |
| 3300014866 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT890_16_10D | Environmental | Open in IMG/M |
| 3300014868 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT830_16_10D | Environmental | Open in IMG/M |
| 3300014872 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT790_16_10D | Environmental | Open in IMG/M |
| 3300014873 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200B_16_10D | Environmental | Open in IMG/M |
| 3300014875 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_1_16_10D | Environmental | Open in IMG/M |
| 3300014876 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200_16_10D | Environmental | Open in IMG/M |
| 3300014878 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200A_16_10D | Environmental | Open in IMG/M |
| 3300014879 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT45_16_10D | Environmental | Open in IMG/M |
| 3300014884 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_1Da | Environmental | Open in IMG/M |
| 3300015252 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT399_16_10D | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018059 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coex | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
| 3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300019458 | Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaG | Environmental | Open in IMG/M |
| 3300020060 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c2 | Environmental | Open in IMG/M |
| 3300024241 | Subsurface microbial communities from Mancos shale, Colorado, United States - Mancos A_50_July_PB | Environmental | Open in IMG/M |
| 3300025106 | Groundwater microbial communities from Big Spring, Nevada to study Microbial Dark Matter (Phase II) - Ash Meadows Big Spring (SPAdes) | Environmental | Open in IMG/M |
| 3300025159 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 3 | Environmental | Open in IMG/M |
| 3300025160 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2 | Environmental | Open in IMG/M |
| 3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025325 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025955 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025957 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025962 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025973 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025979 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025985 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027384 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_30_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300027513 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 (SPAdes) | Environmental | Open in IMG/M |
| 3300027533 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 (SPAdes) | Environmental | Open in IMG/M |
| 3300027657 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125 HiSeq | Environmental | Open in IMG/M |
| 3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
| 3300033407 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175 | Environmental | Open in IMG/M |
| 3300033814 | Sediment microbial communities from East River floodplain, Colorado, United States - 55_j17 | Environmental | Open in IMG/M |
| 3300034113 | Sediment microbial communities from East River floodplain, Colorado, United States - 7_s17 | Environmental | Open in IMG/M |
| 3300034114 | Sediment microbial communities from East River floodplain, Colorado, United States - 9_s17 | Environmental | Open in IMG/M |
| 3300034147 | Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17 | Environmental | Open in IMG/M |
| 3300034177 | Sediment microbial communities from East River floodplain, Colorado, United States - 17_j17 | Environmental | Open in IMG/M |
| 3300034178 | Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17 | Environmental | Open in IMG/M |
| 3300034690 | Sediment microbial communities from East River floodplain, Colorado, United States - 60_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| YBBDRAFT_11328643 | 3300001372 | Marine Estuarine | LRARIDDDAKDGAGQYLTTAKPADKVSVDSGRNPGTGI* |
| C687J26615_100038131 | 3300002121 | Soil | LRAKIGDDAKDGAGHIENMAKPADKVSADFGRNPDAGI* |
| C687J26615_100516032 | 3300002121 | Soil | LRAKIGDDAKDGAGHIVNMAKLADKVSADFGRNPGTDI* |
| C687J26615_100877331 | 3300002121 | Soil | AKIGDDAKDGAGHIVNMAKPADKVSADFGRNPGTGI* |
| Ga0055437_103208393 | 3300004009 | Natural And Restored Wetlands | RALRAKMGDDAKDGAGHIRHMAKPADKVSDDFGRNPGASF* |
| Ga0070695_1001550711 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MNTRALRARIDDDAKDGAGQYPDTAKPADKVSVDSGRNPSSSI* |
| Ga0074479_101861721 | 3300005829 | Sediment (Intertidal) | LRAKIGYDAKDGAGHIANMAKPADKASADFGRNPGAGIRIPNVNP |
| Ga0074479_109263587 | 3300005829 | Sediment (Intertidal) | LRAKIGDDAKDGAGHIANMAKPTDKVSADFGRNPGAGI* |
| Ga0074470_115904471 | 3300005836 | Sediment (Intertidal) | LRVKNGDDAKGGAEHIANMLKPADNVSADFGRNPS |
| Ga0075431_1006732213 | 3300006847 | Populus Rhizosphere | LRAKIGDDAKDGAGHIANMAKPADKVSADFGRNPGTSI* |
| Ga0075420_1002316874 | 3300006853 | Populus Rhizosphere | LRAKIGDDAKDGAGHIANMVKPADNVSADFGRNPGARI* |
| Ga0075419_114268221 | 3300006969 | Populus Rhizosphere | LRAKIGDDAKDGAGHIANMAKPADKVSADFGRNPRKGI* |
| Ga0079218_105438643 | 3300007004 | Agricultural Soil | LRAKIGDDEKGGADSMVNTAKPSDKVSADFGRNPGTDL* |
| Ga0079218_111555532 | 3300007004 | Agricultural Soil | LRAKIGDDAKAGEDSMDNTAKPADKVSADFSRNPGAGI* |
| Ga0114938_10883882 | 3300009430 | Groundwater | LRAKIGGDAKDGAGHMSYMAKPADKVSADFGRNPGAGI* |
| Ga0114942_12295392 | 3300009527 | Groundwater | LRAKIVDNAKDGAGHIRYMAKPADKVSGDFGRNPGAGV* |
| Ga0105259_10062103 | 3300009597 | Soil | LRAKIGDDAKDGAGHIVNIAKPADKVSADFGRNPGAGI* |
| Ga0105259_10263642 | 3300009597 | Soil | LRARIGDDAKDGAGHILYMAKPADKVSADFGRNPGAGI* |
| Ga0105259_11729852 | 3300009597 | Soil | LRAKIGDDAKDGAGHIPNMAKPADKVSADFGRNPGTGI* |
| Ga0105347_10006802 | 3300009609 | Soil | LRARIGDDAKDGAGHIEHMAKPADKVSADFGRNPGAGI* |
| Ga0105347_15179642 | 3300009609 | Soil | LRAKIGDDAKDGAGHIKHMAKPFDKVSADFGRNPDAGF* |
| Ga0105340_10000391 | 3300009610 | Soil | LRAKIGDDAKDGAGHIEHMAKPADKVSADFGRNPGAGI* |
| Ga0105340_10940811 | 3300009610 | Soil | IGDDAKDGAGHMSYMAKPADKVSADFGRNPGAGI* |
| Ga0105252_100467763 | 3300009678 | Soil | LRAKIGDDAKDGAGHIANMAKPADKVSDDFGRNPGASI* |
| Ga0105079_10466701 | 3300009805 | Groundwater Sand | LRAKIGDDAKDGAGHIWNMAKPADKVSADFGRNPGTSI* |
| Ga0105082_10368202 | 3300009814 | Groundwater Sand | LRAKIGDDAKDGAGHIVNMAKPADKVSADFGRNPGAGI* |
| Ga0136847_103671342 | 3300010391 | Freshwater Sediment | LRAKIGDDAKGGAGHIANMAKPADKVSADFGRNPGAGV* |
| Ga0136847_104801561 | 3300010391 | Freshwater Sediment | MGDDAKDGAGHIVYMAKPADKVSADLGRNPGADI* |
| Ga0136847_125240452 | 3300010391 | Freshwater Sediment | LRAKIGDDAKDGAGHIANMPKPADKVSADFGRNPGTGI* |
| Ga0134122_104330311 | 3300010400 | Terrestrial Soil | TRALRAKIVDDAKDGAGHIRYMAKPSDKVSGDFGRNPGAGV* |
| Ga0137315_10053362 | 3300011395 | Soil | LRAKIGDDAKDGAGHIVYMAKPADKVSDDFGRNPGAGN* |
| Ga0137348_10040066 | 3300011398 | Soil | LRAKIGDDAKDGAGHMSYMAKPADKVSADFGRNPGAGI* |
| Ga0137348_10140732 | 3300011398 | Soil | LRAKIGDDAKDGAGHMAYMAKPADKVSADFGRNPGAGI* |
| Ga0137348_10230401 | 3300011398 | Soil | LRAKIGDDAKDGAGHIPNMAKPADKVSADFGRNPGAGI* |
| Ga0137356_10026031 | 3300011402 | Soil | TRALRAKIGDDAKDGAGHMSYMAKPADKVSADFGRNPGAGI* |
| Ga0137313_10022483 | 3300011403 | Soil | LRAKIGDDAKDGAGHKSYMAKSADKVSGDFGRNPGAGI* |
| Ga0137340_10060681 | 3300011405 | Soil | IGDDAKDGAGHIEHMAKPADKVSADFGRNPGAGI* |
| Ga0137323_10624152 | 3300011409 | Soil | LRAKIGDDAKDGAGHIVYMAKPADKVSADFGRNPGAGI* |
| Ga0137333_10868521 | 3300011413 | Soil | LRAKNGDDAKDGAGHMSYMAKPADKVSADFGRNPGATN* |
| Ga0137325_10331462 | 3300011415 | Soil | LRAKIGDDAKDGAGHIPNMAKSADKVSADFGRNPGTGI* |
| Ga0137325_10679482 | 3300011415 | Soil | LRAKIGDDAKDGAGHIANMAKPADKVSDDFGRNPGADG* |
| Ga0137325_10693452 | 3300011415 | Soil | LRARIGDDAKDGAGHIEHMAKPADKGSADFGRNPGAGI* |
| Ga0137422_10801371 | 3300011416 | Soil | LRAKIGDDAKDGAGHMSYMAKPADKVSANFGRNPGAGI* |
| Ga0137326_10055841 | 3300011417 | Soil | NTRALRAKIGDDAKDGAGHMSYMAKPPDKVSADSGRDPGAGI* |
| Ga0137446_10606102 | 3300011419 | Soil | LRAKIGDDAKDGAGHIRYMAKPADKVSADFGRNPGACV* |
| Ga0137314_10436533 | 3300011420 | Soil | LRAKIDDDAKDGAGHIANMAKPADKVSVDFGRNPGTGI* |
| Ga0137314_10528582 | 3300011420 | Soil | LRAKIGDHAKDGAGHIANMAKPADKVSADFGRNPGATI* |
| Ga0137314_10578161 | 3300011420 | Soil | LRAKIVDGAKDGAGHIANMAKPADKVSNDFGRNPGADI* |
| Ga0137314_11623571 | 3300011420 | Soil | LRAKIGDDAKDGAGHIVYMAKPADKVSADSGRNPGAGI* |
| Ga0137462_10479782 | 3300011421 | Soil | LRAKIGDDAKDGAGHIANMAKPADKVSADFVRNPGADG* |
| Ga0137423_11220751 | 3300011430 | Soil | LRAKIGDDAKDGAGHKSYMAKSADKVSGDFGRNPG |
| Ga0137443_11917032 | 3300011433 | Soil | LRAKIGDDAKDGAGHIRNMAKPADKVSADFGRNPGAGI* |
| Ga0137426_10749191 | 3300011435 | Soil | LRAKIGDDAKDGAGHIRNMAKPADKVSADFGRNPGASI* |
| Ga0137429_11145952 | 3300011437 | Soil | LRAKIGDDAKDGAGHIANMPKPADKVSADFGRNPGA |
| Ga0137451_11795201 | 3300011438 | Soil | LRAKIGDDAKDGAGHIANMAKPADKVSADFGRNPGADG* |
| Ga0137433_10079025 | 3300011440 | Soil | RAKIGDDAKDGAGHKSYMAKSADKVSGDFGRNPGSGI* |
| Ga0137433_10457203 | 3300011440 | Soil | LRAKIGDDAKDGAGHIGHMAKPADKVSADFGRNPGAGM* |
| Ga0137427_100114515 | 3300011445 | Soil | LRAKIGDDAKDGAGHIENMAKPADKVSADFGRNPGAAI* |
| Ga0137427_100391141 | 3300011445 | Soil | CALRASIDDDAKDGTGQYSYTAKPAYKVSVDSGRNPGTSI* |
| Ga0137427_104549791 | 3300011445 | Soil | LRAKIDDDAKDGAGHIANMAKPADKVSVDFGRNPGADG* |
| Ga0137453_10975843 | 3300012034 | Soil | LRAKIGDDAKDGAGHIANMAKPADKVSADFGRNPG |
| Ga0137431_11848711 | 3300012038 | Soil | LRAKIGDDAKDGAGHMVNMAKPADKVSADFGRNPGAGI* |
| Ga0137421_10055801 | 3300012039 | Soil | LRAKIGDDAKDGAGHIPNMAKPADKVSTDFGRNPGTNI* |
| Ga0137421_10679201 | 3300012039 | Soil | LRAKIGDDAKDGAGHIVNMAKPADKVSADFGRNPGTGI* |
| Ga0137421_11661621 | 3300012039 | Soil | LRAKIGDDAKDGAGHIENMAKPADKVSADFGRNPGADG* |
| Ga0137430_10095521 | 3300012041 | Soil | IGDDAKDGAGHIANMAKPADKVSDDFGRNPGASI* |
| Ga0137430_10612252 | 3300012041 | Soil | LRAKIGDDAKDGAGHIANMAKPTDKVSGDFGRNPGADG* |
| Ga0137430_11419302 | 3300012041 | Soil | LRVKIGDDAKDGAGHIVYMAKPADKVSADFGRNPGAGI* |
| Ga0137329_10045372 | 3300012133 | Soil | LRAKIGDDAKDGAGHIVNMAKTADKVSADFGRNPGTGI* |
| Ga0137353_10041861 | 3300012157 | Soil | NTRALRAKIGDDAKDGAGHIGHMAKPADKVSADSGRNPGAGV* |
| Ga0137344_10781501 | 3300012159 | Soil | LRAKIGDDAKDGAGHIEHMAKPADKVSADFGRNPGAGIRTSNDIS |
| Ga0137336_10370152 | 3300012161 | Soil | LRARIGDDAKDGAGHIPNMAKPADKVSADFGRNPGTGI* |
| Ga0137352_10776581 | 3300012164 | Soil | NTRALRAKIGDDAKDGAGHMSYMAKPADKVSADFGRNPGAGV* |
| Ga0137319_10023883 | 3300012167 | Soil | LRAKIGDDAKDGAGHIPNMAKPADKVSADFGRNPGT |
| Ga0137320_10122091 | 3300012172 | Soil | LRAKIGDDAKDGAGHLSYMAKPADKVSADFGRNPGAGV* |
| Ga0137320_10192063 | 3300012172 | Soil | LRAKIGDDAKDGAGHIANMAKPADKVSADFGRNPGA |
| Ga0137320_10472031 | 3300012172 | Soil | LRAKIGDDAKDGAGHMSYMAKPADKVSADFGRNPG |
| Ga0137320_10510421 | 3300012172 | Soil | LRAKIGDDAKDGAGHIANMAKPADKVSADFGRNPGADG |
| Ga0137320_11179921 | 3300012172 | Soil | LRAKIGDDAKDGAGHMSYMAKPADKVSADSGRNPGAGI* |
| Ga0137338_10026544 | 3300012174 | Soil | LRAKIGDDAKDGAGHIEHMAKPADKVSADSGRNPGAGI* |
| Ga0137321_10793152 | 3300012175 | Soil | ALRAKTGDDAKDGAGHIANMAKPADKVSDDFGRNPSKGI* |
| Ga0137434_10065152 | 3300012225 | Soil | RARIGDDAKDGAVHMAYTAKPADNVSADSGRNPGSGV* |
| Ga0137335_10265262 | 3300012670 | Soil | RARIGDDAKDGAGHMSYIAKPADKVSADSGRNPGAGI* |
| Ga0137318_10201681 | 3300012671 | Soil | LRAKIGDDAKDGAGHIPNMAKPADKVSADFGRNPGAGV* |
| Ga0137341_10162822 | 3300012676 | Soil | ARIGDDAKDGAGHIGHMAKPADKVNADSGRNPGAGI* |
| Ga0137341_10796712 | 3300012676 | Soil | LRAKIGDDAKGGAGHIPNMAKPADKVSADFGRNPGARI* |
| Ga0075351_10385161 | 3300014318 | Natural And Restored Wetlands | LRAKIGDDAKDGAGHIANMAKPADKVSADFGRNPRTGI* |
| Ga0075353_10434262 | 3300014321 | Natural And Restored Wetlands | LRAKIGDDAKDGAGHIANMAKPADKVSNDCGRNPGAGI* |
| Ga0075352_10025851 | 3300014324 | Natural And Restored Wetlands | LRAKIGDDAKDGAGHIANMAKPADKVSNDFGRNPGAGI* |
| Ga0075352_10633382 | 3300014324 | Natural And Restored Wetlands | ALRAKIGDDAKDGAGHIANMAKPADKVSADFGRNPGTGI* |
| Ga0075352_11181202 | 3300014324 | Natural And Restored Wetlands | LRAKIGDDAKDGAGHIANMAKPADKVSADFGRNPGTGI* |
| Ga0180090_10092251 | 3300014866 | Soil | TRALRAKIGDDAKDGAGHKSYMAKSADKVSGDFGRNPGSGI* |
| Ga0180088_10751241 | 3300014868 | Soil | LRAKIGDDAKDGAGHIANMAKPADKVSDDFGRNPGAGNGISNDHS |
| Ga0180087_10582121 | 3300014872 | Soil | IGDDAKDGAGHIVNMAKPADKVSADFGRNPGTGI* |
| Ga0180066_10859922 | 3300014873 | Soil | LRAKIGDDAKDGAGRIVNMAKPADKVSADFGRNPGAGI* |
| Ga0180066_10919522 | 3300014873 | Soil | LRAKIGDDAKDGAGHIVNMAKPADKVSAGFGRNPGTGF* |
| Ga0180066_10925912 | 3300014873 | Soil | LRAKIGDDAKDGAGHIVNMAKPADKVSADFSRNP* |
| Ga0180066_10972021 | 3300014873 | Soil | LRAKIGDDAKDGAGHIGNMAKPADKVSADFGRNPGTGM* |
| Ga0180066_11351321 | 3300014873 | Soil | LRAKIGDDAKDGAGHIVNMAKPADKVSAGFGRNPGAGF* |
| Ga0180083_11196012 | 3300014875 | Soil | LRARIGDDAKDGAGHIEHMAKPADKVSADFGRNPGA |
| Ga0180064_10277251 | 3300014876 | Soil | TRALRAKIGDDAKDGAGHMSYMAKPADKVSADSGRNPGAGI* |
| Ga0180065_10076231 | 3300014878 | Soil | IGDDAKDGAGHMSYMAKPADKVSADSGRNPGAGI* |
| Ga0180065_10819361 | 3300014878 | Soil | LRAKIGDDAKDGAGHMSYMAKSADKGSADFGRNPGAGI* |
| Ga0180062_10889551 | 3300014879 | Soil | LRAKIGDDAKDGAGHIPNMAKPADKVSADFGRNPG |
| Ga0180104_10179463 | 3300014884 | Soil | LRAKIGDDAKDGAGHIEHMAKPADKVSADSGRNPGAGIRIS |
| Ga0180075_10528581 | 3300015252 | Soil | LRAKIGDDAKDGAGHIGNMAKPADKVSADFGRNPGAGI* |
| Ga0184634_101485272 | 3300018031 | Groundwater Sediment | LRAKIGDDAKDGAGHIANMAKPADKVSADFGRNPGEGI |
| Ga0184634_103339942 | 3300018031 | Groundwater Sediment | LRAKIGDDAKDGAGHIVNMAKPADKVSAGFGRNPGTGF |
| Ga0184634_105695432 | 3300018031 | Groundwater Sediment | LRAKIGDDAKDGAGHMSYMAKLADKVSADFGRNPGAGI |
| Ga0184615_104812792 | 3300018059 | Groundwater Sediment | LRAKIGDDAKDGAGHIVNMAKPADKVSADFGRNPGTGI |
| Ga0184637_100435583 | 3300018063 | Groundwater Sediment | LRAKIGDDAKDGAGHIANLAKPADKVSADFGRNPGIGI |
| Ga0184637_100776812 | 3300018063 | Groundwater Sediment | LRAKIGDDAKDGAGHIAYMAKPADKVSADFGRNPGTGV |
| Ga0184637_101067952 | 3300018063 | Groundwater Sediment | LRAKIGDDAKGGAGHIAYMAKPADKVSADFGRNPGTGI |
| Ga0184637_103174462 | 3300018063 | Groundwater Sediment | LRAKIGDDAKDGAGHIVYMAKPADKVSADFGRNPGAGI |
| Ga0184637_104181982 | 3300018063 | Groundwater Sediment | LRAKIGDDAKDGAGHIAYMAKPADKVSADFGRNPGTGI |
| Ga0184637_104699901 | 3300018063 | Groundwater Sediment | LRAKIGDDAKGGAGHIAYMAKLADKVSADFGRNPGAGI |
| Ga0184637_105372842 | 3300018063 | Groundwater Sediment | LRAKIGDDAKDGAGHIAYMAKPADKVSADFGRNPSTGI |
| Ga0184637_106446651 | 3300018063 | Groundwater Sediment | RAKIGDDAKDGAGHIAYMAKPADKVSADFGRNPGTGI |
| Ga0184637_107546911 | 3300018063 | Groundwater Sediment | TCALRAKIGDDAKDGAGHIAHMAKPADKVSADFGRNPGAGI |
| Ga0184633_100245226 | 3300018077 | Groundwater Sediment | LRAKIGDDAKDGAGHIVNMAKPADKVSAGFGRNPGTGI |
| Ga0184633_101735961 | 3300018077 | Groundwater Sediment | LRAKIGDDAKGGAGHIAYMAKPADKVSADFGRNPGT |
| Ga0184633_102741992 | 3300018077 | Groundwater Sediment | LRAKIGDDAKDGAGHIVYMAKPADKVSAGFGRNPGTGV |
| Ga0184633_103445241 | 3300018077 | Groundwater Sediment | LRAKIGDDAKAGAGHIVNMAKPADKVSADFGRNPGAGI |
| Ga0184633_105877222 | 3300018077 | Groundwater Sediment | LRAKIGDDAKDGAGHIPNMAKPADKVSAGFGRNPGAGI |
| Ga0184627_106875562 | 3300018079 | Groundwater Sediment | LRAKIGDDAKDGAGHIAHMAKPADKVSADFGRNPGAGI |
| Ga0184639_100269711 | 3300018082 | Groundwater Sediment | LRAKIGDDAKDGAGHIVNMAKPADKVSAGFGRNPGA |
| Ga0184639_100280501 | 3300018082 | Groundwater Sediment | LRAKIGDDAKDGAGHIVNMAKPADKVSAGFGRNPGTG |
| Ga0184639_103729212 | 3300018082 | Groundwater Sediment | LRAKIGDDAKDGAGHIVNMAKPADKVSADFGRNPG |
| Ga0184639_105959722 | 3300018082 | Groundwater Sediment | LRAKIGDDAKDGAGHIVNMAKPADKVSTDFGRNPGTGF |
| Ga0184628_104595751 | 3300018083 | Groundwater Sediment | LRAKIGDDAKDGAGHIVNIAKPADKVSADFGRNPGAGI |
| Ga0190270_110779843 | 3300018469 | Soil | LRAKIVDDAKDGAGHIRHMAKPADKVSDDFGRNPGA |
| Ga0187892_1000160336 | 3300019458 | Bio-Ooze | LRAKIGDDAKDGAGHIQHMAKPADKVSADFGRNPGAGI |
| Ga0193717_11306861 | 3300020060 | Soil | LRAKIGDDAKDGAGHIENMAKPADKVSADFGRNPGAGI |
| Ga0233392_10254922 | 3300024241 | Deep Subsurface Sediment | LRAKIGDDAKDGAGHIVYMAKPADKVSADFGRNPGTGI |
| Ga0209398_11172451 | 3300025106 | Groundwater | LRAKIGGDAKDGAGHMSYMAKPADKVSADFGRNPGAGI |
| Ga0209619_104280842 | 3300025159 | Soil | LRAKIGDDAKDGAGHIVNMAKLADKVSADFGRNPGTDI |
| Ga0209109_100783313 | 3300025160 | Soil | LRAKIGDDAKDGAGHIANMAKPADKVSTDFGRNPGAGI |
| Ga0209640_108860111 | 3300025324 | Soil | LRAKIGDDAKDGAGHIVNMAKPADKVSADFGRNPGAGIGLSNGI |
| Ga0209341_110367802 | 3300025325 | Soil | LRAKIGDDAKDGAGHIANMAKPADKVSTDFGRNPGA |
| Ga0210071_10010764 | 3300025955 | Natural And Restored Wetlands | LRAKIGDDAKDGAGHIANMAKPADKVSNDFGRNPGAGI |
| Ga0210089_10170861 | 3300025957 | Natural And Restored Wetlands | LRAKIGDDAKDGAGHIEHMAKPADKVSADFGRNPGAGI |
| Ga0210089_10426011 | 3300025957 | Natural And Restored Wetlands | LRAKIGDDAKDGAGHIANMAKPADKVSADFGRNPGAGI |
| Ga0210070_10012684 | 3300025962 | Natural And Restored Wetlands | LRAKIGDDAKDGAGHIANMAKPADKVSADFGRNPGAGF |
| Ga0210070_10358742 | 3300025962 | Natural And Restored Wetlands | LRAKIGDDAKDGAGHMPYMAKPADKVNTDFGRNPGAGN |
| Ga0210145_10069372 | 3300025973 | Natural And Restored Wetlands | NTRALRAKIGDDAKDGAGHIEHMAKPADKVSADFGRNPGAGI |
| Ga0210078_10010083 | 3300025979 | Natural And Restored Wetlands | LRAKIGDDAKDGAGHIANMAKPADKVSNDFGRNPGEGI |
| Ga0210117_10048823 | 3300025985 | Natural And Restored Wetlands | LRAKIGDDAKDGAGHIANMAKPADKVSNDFGRNPGTGI |
| Ga0209854_10966512 | 3300027384 | Groundwater Sand | LRAKIGDDAKDGAGHIAYMAKPADKVSADFGRNPGAGI |
| Ga0208685_100012525 | 3300027513 | Soil | LRAKIGDDAKDGAGHKSYMAKSADKVSGDFGRNPGAGI |
| Ga0208685_10001351 | 3300027513 | Soil | LRARIGDDAKDGAGHIEHMAKPADKVSADFGRNPGAGI |
| Ga0208185_100041117 | 3300027533 | Soil | LRAKIGDDAKDGAGHIPNMAKPADKVSADFGRNPGTGI |
| Ga0256865_10079864 | 3300027657 | Soil | LRAKIGDDAKDGAGHIVNMAKPADKVSADFGRNPGAGILNI |
| Ga0247825_101498873 | 3300028812 | Soil | LRAKIGDDAKDGAGHIANMAKPADKVSDDFGRNPGASI |
| Ga0307497_100351012 | 3300031226 | Soil | LRAKIVDDAKDGAGHIRHMAKPADKVSDDFGRNPGAGI |
| Ga0214473_100389025 | 3300031949 | Soil | LRAKIGDDAKDGTGHIPNMAKPADKVSAGFGRNPGAGI |
| Ga0214473_102121422 | 3300031949 | Soil | LRAKIGDDAKDGAGHIPNMAKPAAKVSADFGRNPGAGI |
| Ga0326597_101631432 | 3300031965 | Soil | LRAKIGDDAKDGAGHIVNMAKPADKVSADFGRNPGAGI |
| Ga0326597_102116912 | 3300031965 | Soil | LRAKIGDDAKDGAGHIANMAKPADKVSAGFGRNPGTGF |
| Ga0326597_106500071 | 3300031965 | Soil | ARIGDDAKGGAAHIANMSKPTDKVSRNCGRNPIPHP |
| Ga0326597_112150022 | 3300031965 | Soil | LRAKIGDDAKDGAGHIVNMAKPADKVSADFGRNPGA |
| Ga0326597_118490132 | 3300031965 | Soil | LRAKIGDDAKDGAGHIVNMAKPADKVSTGFGRNPGTGF |
| Ga0326597_119701182 | 3300031965 | Soil | LRAKIGDDAKDGAGHIENMAKPADKVSADFGRNPGADI |
| Ga0335084_120462611 | 3300033004 | Soil | AKIGDNAKDGAGHICYMAKPADNVSADFGRNPGAGA |
| Ga0334722_101391713 | 3300033233 | Sediment | LRAKIGDDAKDGAGHIANMAKLADKVSADFGRNPCTGI |
| Ga0334722_111198393 | 3300033233 | Sediment | LRAKIGDDAKDGAGHIANMAKPADKVSADFGRNPSTDI |
| Ga0214472_101317954 | 3300033407 | Soil | LRAKIGDDAKDGAGHIVNMAKPADKVSADFGRNPGTGF |
| Ga0364930_0014363_228_344 | 3300033814 | Sediment | LRAKIGDDAKDGAGHIVYMAKPADKVSAGFGRNPGTGF |
| Ga0364930_0033931_617_733 | 3300033814 | Sediment | LRAKIGDDAKDGAGHIGNMAKPADKVSADFGRNPGTGM |
| Ga0364930_0320997_22_138 | 3300033814 | Sediment | LRAKIGDDAKDGAGHIVYMAKPADKVSADFGRNPSTVI |
| Ga0364937_016037_99_215 | 3300034113 | Sediment | LRAKIGDDAKDGAGHMSYMAKPADKVSADFGRNPGAGV |
| Ga0364937_096654_316_432 | 3300034113 | Sediment | LRAKIGDDAKDGAGHIGNMAKPADKVSAGFGRNPGAGI |
| Ga0364938_012034_153_269 | 3300034114 | Sediment | LRAKIGDDAKDGAGHIANMAKPADKVSAGFGRNPGTGI |
| Ga0364938_030687_698_814 | 3300034114 | Sediment | LRAKIGDDAKDGAGHIVNMAKPADKVSADFGRNPGEGI |
| Ga0364938_073142_357_473 | 3300034114 | Sediment | LRAKIGDDAKDGAGHMSYMAKPADKVNADFGRNPGAGT |
| Ga0364925_0059130_113_229 | 3300034147 | Sediment | LRARIGDDAKDGAGHIPNMAKPADKVSADFGRNPGTGI |
| Ga0364932_0110615_144_260 | 3300034177 | Sediment | LRAKIGDDAKDGAGHIVYMAKPADKVSADFGRNPGADI |
| Ga0364932_0276189_95_211 | 3300034177 | Sediment | LRAKIGDDAKDGAGHIANMAKPADKVSAGFGRNPGTGV |
| Ga0364934_0025570_25_141 | 3300034178 | Sediment | LRAKIGDDAKDGAGHIVNMAKPADKVSAGFGRNPGAGF |
| Ga0364923_0023174_1266_1382 | 3300034690 | Sediment | LRAKIGDDAKDGAGHIANMAKPADKVSADFGRNPGATI |
| ⦗Top⦘ |