| Basic Information | |
|---|---|
| Family ID | F032836 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 179 |
| Average Sequence Length | 40 residues |
| Representative Sequence | PTTIISPSLLFDELEVKRADTSKDKLPEYPAPPLKK |
| Number of Associated Samples | 149 |
| Number of Associated Scaffolds | 179 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 5.17 % |
| % of genes near scaffold ends (potentially truncated) | 89.39 % |
| % of genes from short scaffolds (< 2000 bps) | 83.80 % |
| Associated GOLD sequencing projects | 136 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.19 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.089 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (23.464 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.933 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.721 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 10.94% β-sheet: 0.00% Coil/Unstructured: 89.06% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.19 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 179 Family Scaffolds |
|---|---|---|
| PF03793 | PASTA | 51.40 |
| PF01523 | PmbA_TldD | 1.68 |
| PF03330 | DPBB_1 | 1.68 |
| PF14714 | KH_dom-like | 1.12 |
| PF04389 | Peptidase_M28 | 1.12 |
| PF01609 | DDE_Tnp_1 | 1.12 |
| PF13525 | YfiO | 1.12 |
| PF01975 | SurE | 1.12 |
| PF13847 | Methyltransf_31 | 1.12 |
| PF00092 | VWA | 1.12 |
| PF08245 | Mur_ligase_M | 0.56 |
| PF04760 | IF2_N | 0.56 |
| PF12867 | DinB_2 | 0.56 |
| PF00884 | Sulfatase | 0.56 |
| PF08240 | ADH_N | 0.56 |
| PF07883 | Cupin_2 | 0.56 |
| PF00990 | GGDEF | 0.56 |
| PF01612 | DNA_pol_A_exo1 | 0.56 |
| PF00005 | ABC_tran | 0.56 |
| PF00486 | Trans_reg_C | 0.56 |
| PF00578 | AhpC-TSA | 0.56 |
| PF13472 | Lipase_GDSL_2 | 0.56 |
| PF04055 | Radical_SAM | 0.56 |
| PF08281 | Sigma70_r4_2 | 0.56 |
| PF00583 | Acetyltransf_1 | 0.56 |
| PF16757 | Fucosidase_C | 0.56 |
| PF05016 | ParE_toxin | 0.56 |
| PF03693 | ParD_antitoxin | 0.56 |
| COG ID | Name | Functional Category | % Frequency in 179 Family Scaffolds |
|---|---|---|---|
| COG0312 | Zn-dependent protease PmbA/TldA or its inactivated homolog | General function prediction only [R] | 1.68 |
| COG0496 | Broad specificity polyphosphatase and 5'/3'-nucleotidase SurE | Replication, recombination and repair [L] | 1.12 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 1.12 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 1.12 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 1.12 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 1.12 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 1.12 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 1.12 |
| COG3609 | Transcriptional regulator, contains Arc/MetJ-type RHH (ribbon-helix-helix) DNA-binding domain | Transcription [K] | 0.56 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.09 % |
| Unclassified | root | N/A | 3.91 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_101966365 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300000567|JGI12270J11330_10230622 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 609 | Open in IMG/M |
| 3300002558|JGI25385J37094_10193729 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 544 | Open in IMG/M |
| 3300002907|JGI25613J43889_10154243 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 597 | Open in IMG/M |
| 3300002917|JGI25616J43925_10196070 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 783 | Open in IMG/M |
| 3300004091|Ga0062387_101192047 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 596 | Open in IMG/M |
| 3300004091|Ga0062387_101284603 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 577 | Open in IMG/M |
| 3300004631|Ga0058899_12151176 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella tundricola | 599 | Open in IMG/M |
| 3300004633|Ga0066395_10938246 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300005295|Ga0065707_10011685 | All Organisms → cellular organisms → Bacteria | 1933 | Open in IMG/M |
| 3300005332|Ga0066388_100200064 | All Organisms → cellular organisms → Bacteria | 2618 | Open in IMG/M |
| 3300005332|Ga0066388_102633761 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 916 | Open in IMG/M |
| 3300005440|Ga0070705_101364370 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 590 | Open in IMG/M |
| 3300005538|Ga0070731_10717777 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 664 | Open in IMG/M |
| 3300005559|Ga0066700_10393320 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 977 | Open in IMG/M |
| 3300005598|Ga0066706_10617446 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 860 | Open in IMG/M |
| 3300005921|Ga0070766_10060908 | All Organisms → cellular organisms → Bacteria | 2147 | Open in IMG/M |
| 3300006031|Ga0066651_10287206 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 876 | Open in IMG/M |
| 3300006034|Ga0066656_10949871 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 551 | Open in IMG/M |
| 3300006050|Ga0075028_100156079 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1208 | Open in IMG/M |
| 3300006050|Ga0075028_100619382 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 644 | Open in IMG/M |
| 3300006163|Ga0070715_10696836 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 606 | Open in IMG/M |
| 3300006176|Ga0070765_100936757 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 819 | Open in IMG/M |
| 3300006354|Ga0075021_10499767 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 770 | Open in IMG/M |
| 3300006881|Ga0068865_100533453 | All Organisms → cellular organisms → Bacteria | 983 | Open in IMG/M |
| 3300006903|Ga0075426_11132437 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300006904|Ga0075424_100829257 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
| 3300007076|Ga0075435_100467802 | All Organisms → cellular organisms → Bacteria | 1088 | Open in IMG/M |
| 3300007076|Ga0075435_100836192 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
| 3300007258|Ga0099793_10012873 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3287 | Open in IMG/M |
| 3300007258|Ga0099793_10108699 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1288 | Open in IMG/M |
| 3300007265|Ga0099794_10060091 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1845 | Open in IMG/M |
| 3300007265|Ga0099794_10443450 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 680 | Open in IMG/M |
| 3300009012|Ga0066710_100204266 | All Organisms → cellular organisms → Bacteria | 2816 | Open in IMG/M |
| 3300009038|Ga0099829_10489944 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1020 | Open in IMG/M |
| 3300009038|Ga0099829_10591564 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 922 | Open in IMG/M |
| 3300009088|Ga0099830_10954630 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 709 | Open in IMG/M |
| 3300009088|Ga0099830_11396877 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 582 | Open in IMG/M |
| 3300009101|Ga0105247_11424711 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 562 | Open in IMG/M |
| 3300009148|Ga0105243_10083028 | All Organisms → cellular organisms → Bacteria | 2620 | Open in IMG/M |
| 3300009525|Ga0116220_10207362 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
| 3300009545|Ga0105237_10954287 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 864 | Open in IMG/M |
| 3300009645|Ga0116106_1230774 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 589 | Open in IMG/M |
| 3300009698|Ga0116216_10509900 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 727 | Open in IMG/M |
| 3300010046|Ga0126384_10161461 | All Organisms → cellular organisms → Bacteria | 1736 | Open in IMG/M |
| 3300010048|Ga0126373_11667219 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 702 | Open in IMG/M |
| 3300010329|Ga0134111_10464051 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 551 | Open in IMG/M |
| 3300010343|Ga0074044_10807067 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 613 | Open in IMG/M |
| 3300010358|Ga0126370_12389904 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
| 3300010361|Ga0126378_13163709 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
| 3300010362|Ga0126377_13502839 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 507 | Open in IMG/M |
| 3300010366|Ga0126379_11884842 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 701 | Open in IMG/M |
| 3300010376|Ga0126381_101829483 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 876 | Open in IMG/M |
| 3300010379|Ga0136449_101227004 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1178 | Open in IMG/M |
| 3300010876|Ga0126361_10433553 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1314 | Open in IMG/M |
| 3300011271|Ga0137393_11342857 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 604 | Open in IMG/M |
| 3300012096|Ga0137389_10495738 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1047 | Open in IMG/M |
| 3300012189|Ga0137388_10076206 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2811 | Open in IMG/M |
| 3300012198|Ga0137364_10841670 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 693 | Open in IMG/M |
| 3300012202|Ga0137363_10243058 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1461 | Open in IMG/M |
| 3300012203|Ga0137399_10451480 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1075 | Open in IMG/M |
| 3300012203|Ga0137399_10512134 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1007 | Open in IMG/M |
| 3300012203|Ga0137399_10569724 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 951 | Open in IMG/M |
| 3300012205|Ga0137362_10103816 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2396 | Open in IMG/M |
| 3300012357|Ga0137384_10946071 | Not Available | 693 | Open in IMG/M |
| 3300012361|Ga0137360_10550314 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 985 | Open in IMG/M |
| 3300012361|Ga0137360_11047925 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300012362|Ga0137361_10057785 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3230 | Open in IMG/M |
| 3300012362|Ga0137361_11605221 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 571 | Open in IMG/M |
| 3300012363|Ga0137390_10314775 | All Organisms → cellular organisms → Bacteria | 1547 | Open in IMG/M |
| 3300012363|Ga0137390_11715616 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 562 | Open in IMG/M |
| 3300012582|Ga0137358_11099390 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 507 | Open in IMG/M |
| 3300012925|Ga0137419_10585960 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 894 | Open in IMG/M |
| 3300012925|Ga0137419_10965119 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 705 | Open in IMG/M |
| 3300012964|Ga0153916_11276621 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 812 | Open in IMG/M |
| 3300012971|Ga0126369_12327270 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 622 | Open in IMG/M |
| 3300014657|Ga0181522_10201238 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1172 | Open in IMG/M |
| 3300015052|Ga0137411_1053208 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3116 | Open in IMG/M |
| 3300015053|Ga0137405_1327303 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 5208 | Open in IMG/M |
| 3300015053|Ga0137405_1397947 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4494 | Open in IMG/M |
| 3300015242|Ga0137412_10150881 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1874 | Open in IMG/M |
| 3300015245|Ga0137409_11212485 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 595 | Open in IMG/M |
| 3300015264|Ga0137403_10033829 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5383 | Open in IMG/M |
| 3300015264|Ga0137403_10037290 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5099 | Open in IMG/M |
| 3300016357|Ga0182032_10818850 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 788 | Open in IMG/M |
| 3300016371|Ga0182034_10477875 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1036 | Open in IMG/M |
| 3300016404|Ga0182037_10581310 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 949 | Open in IMG/M |
| 3300016404|Ga0182037_11526795 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 593 | Open in IMG/M |
| 3300017823|Ga0187818_10408958 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 603 | Open in IMG/M |
| 3300017929|Ga0187849_1268468 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 645 | Open in IMG/M |
| 3300017933|Ga0187801_10392625 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 576 | Open in IMG/M |
| 3300017973|Ga0187780_10662765 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 751 | Open in IMG/M |
| 3300017974|Ga0187777_10895188 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 638 | Open in IMG/M |
| 3300017993|Ga0187823_10047416 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1173 | Open in IMG/M |
| 3300017994|Ga0187822_10068805 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1030 | Open in IMG/M |
| 3300018004|Ga0187865_1125921 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 917 | Open in IMG/M |
| 3300018064|Ga0187773_10047793 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1958 | Open in IMG/M |
| 3300018088|Ga0187771_10002624 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 12431 | Open in IMG/M |
| 3300018090|Ga0187770_10151736 | All Organisms → cellular organisms → Bacteria | 1766 | Open in IMG/M |
| 3300018090|Ga0187770_11519410 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300020170|Ga0179594_10026033 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1825 | Open in IMG/M |
| 3300020199|Ga0179592_10441612 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 563 | Open in IMG/M |
| 3300020580|Ga0210403_10453174 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1045 | Open in IMG/M |
| 3300020581|Ga0210399_10019434 | All Organisms → cellular organisms → Bacteria | 5379 | Open in IMG/M |
| 3300020581|Ga0210399_10241716 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1504 | Open in IMG/M |
| 3300020581|Ga0210399_10287920 | All Organisms → cellular organisms → Bacteria | 1371 | Open in IMG/M |
| 3300020581|Ga0210399_11399124 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 547 | Open in IMG/M |
| 3300020583|Ga0210401_10972804 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 707 | Open in IMG/M |
| 3300021168|Ga0210406_10250338 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1454 | Open in IMG/M |
| 3300021178|Ga0210408_10100138 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2277 | Open in IMG/M |
| 3300021178|Ga0210408_11397579 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
| 3300021404|Ga0210389_10048221 | All Organisms → cellular organisms → Bacteria | 3268 | Open in IMG/M |
| 3300021407|Ga0210383_10763366 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 829 | Open in IMG/M |
| 3300021433|Ga0210391_11220284 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 582 | Open in IMG/M |
| 3300021474|Ga0210390_10067288 | All Organisms → cellular organisms → Bacteria | 2958 | Open in IMG/M |
| 3300021474|Ga0210390_11461947 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 542 | Open in IMG/M |
| 3300021477|Ga0210398_10396228 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1126 | Open in IMG/M |
| 3300021560|Ga0126371_11218115 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 889 | Open in IMG/M |
| 3300022840|Ga0224549_1001707 | All Organisms → cellular organisms → Bacteria | 3442 | Open in IMG/M |
| 3300024347|Ga0179591_1162333 | All Organisms → cellular organisms → Bacteria | 1648 | Open in IMG/M |
| 3300025905|Ga0207685_10621448 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300025916|Ga0207663_10702775 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 801 | Open in IMG/M |
| 3300025918|Ga0207662_11363834 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
| 3300025939|Ga0207665_11509153 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 534 | Open in IMG/M |
| 3300026281|Ga0209863_10214803 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
| 3300026298|Ga0209236_1020709 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3679 | Open in IMG/M |
| 3300026312|Ga0209153_1000304 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 25635 | Open in IMG/M |
| 3300026320|Ga0209131_1032861 | All Organisms → cellular organisms → Bacteria | 3029 | Open in IMG/M |
| 3300026334|Ga0209377_1078259 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1409 | Open in IMG/M |
| 3300026481|Ga0257155_1068493 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 569 | Open in IMG/M |
| 3300026515|Ga0257158_1036962 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 874 | Open in IMG/M |
| 3300026527|Ga0209059_1180956 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 730 | Open in IMG/M |
| 3300026557|Ga0179587_10984137 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
| 3300026557|Ga0179587_11072614 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 530 | Open in IMG/M |
| 3300026895|Ga0207758_1021814 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 613 | Open in IMG/M |
| 3300027039|Ga0207855_1012397 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1198 | Open in IMG/M |
| 3300027070|Ga0208365_1043369 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 601 | Open in IMG/M |
| 3300027080|Ga0208237_1068876 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
| 3300027645|Ga0209117_1155561 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 595 | Open in IMG/M |
| 3300027748|Ga0209689_1030740 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3200 | Open in IMG/M |
| 3300027767|Ga0209655_10002122 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7125 | Open in IMG/M |
| 3300027812|Ga0209656_10341794 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 683 | Open in IMG/M |
| 3300027821|Ga0209811_10182907 | Not Available | 787 | Open in IMG/M |
| 3300027846|Ga0209180_10268056 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 981 | Open in IMG/M |
| 3300027846|Ga0209180_10627685 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 591 | Open in IMG/M |
| 3300027854|Ga0209517_10413141 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 755 | Open in IMG/M |
| 3300027884|Ga0209275_10883567 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
| 3300027889|Ga0209380_10422104 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 781 | Open in IMG/M |
| 3300027895|Ga0209624_10629422 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 711 | Open in IMG/M |
| 3300027903|Ga0209488_11203972 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
| 3300027908|Ga0209006_10701935 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 828 | Open in IMG/M |
| 3300028146|Ga0247682_1008426 | All Organisms → cellular organisms → Bacteria | 1777 | Open in IMG/M |
| 3300028800|Ga0265338_10819223 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 637 | Open in IMG/M |
| 3300029993|Ga0302304_10091236 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1173 | Open in IMG/M |
| 3300030878|Ga0265770_1005352 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1765 | Open in IMG/M |
| 3300031128|Ga0170823_11897506 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 597 | Open in IMG/M |
| 3300031546|Ga0318538_10279508 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 898 | Open in IMG/M |
| 3300031720|Ga0307469_10165844 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1677 | Open in IMG/M |
| 3300031720|Ga0307469_12215016 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
| 3300031819|Ga0318568_10566543 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 708 | Open in IMG/M |
| 3300031941|Ga0310912_10316549 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1209 | Open in IMG/M |
| 3300031962|Ga0307479_10895394 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 860 | Open in IMG/M |
| 3300031962|Ga0307479_11511114 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 628 | Open in IMG/M |
| 3300031962|Ga0307479_11736809 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 577 | Open in IMG/M |
| 3300031962|Ga0307479_12184097 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 500 | Open in IMG/M |
| 3300032001|Ga0306922_11273070 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 745 | Open in IMG/M |
| 3300032008|Ga0318562_10230769 | All Organisms → cellular organisms → Bacteria | 1074 | Open in IMG/M |
| 3300032063|Ga0318504_10406872 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 649 | Open in IMG/M |
| 3300032091|Ga0318577_10595774 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
| 3300032160|Ga0311301_12016926 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 673 | Open in IMG/M |
| 3300032174|Ga0307470_11156841 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 626 | Open in IMG/M |
| 3300032180|Ga0307471_101106078 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 958 | Open in IMG/M |
| 3300032205|Ga0307472_100508435 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1041 | Open in IMG/M |
| 3300032782|Ga0335082_10187698 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1973 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 23.46% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.41% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.03% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.03% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.03% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.47% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.91% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.35% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.35% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.79% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.79% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.79% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.23% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.23% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.23% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.12% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.12% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.12% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.68% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.56% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.56% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.56% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.56% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.56% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.56% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.56% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.56% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.56% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.56% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.56% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.56% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.56% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.56% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.56% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.56% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.56% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002907 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004631 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009637 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 | Environmental | Open in IMG/M |
| 3300009645 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017929 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300018004 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_100 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022840 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 1-5 | Environmental | Open in IMG/M |
| 3300024347 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026281 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026481 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-A | Environmental | Open in IMG/M |
| 3300026515 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-A | Environmental | Open in IMG/M |
| 3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026895 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 12 (SPAdes) | Environmental | Open in IMG/M |
| 3300027039 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 14 (SPAdes) | Environmental | Open in IMG/M |
| 3300027070 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF004 (SPAdes) | Environmental | Open in IMG/M |
| 3300027080 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF009 (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027767 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028146 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK23 | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300029993 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_2 | Environmental | Open in IMG/M |
| 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1019663652 | 3300000364 | Soil | LVSNRTGGLPATVISPSLLFDQLQVKRADTSKDKLPEYPAPPLKQ* |
| JGI12270J11330_102306222 | 3300000567 | Peatlands Soil | TIICPSLLFDELEVKRADTSKEKLPEYPAPELSK* |
| JGI25385J37094_101937292 | 3300002558 | Grasslands Soil | LTGSPATGISPSPLFDELEVKRADTSKDKLPEYPAPPMKK* |
| JGI25613J43889_101542432 | 3300002907 | Grasslands Soil | PNSIINPSLLFDELQVKRVEASKDKLPEYAAPALAAATP* |
| JGI25616J43925_101960702 | 3300002917 | Grasslands Soil | LVSNRAGGAPTTIISPSLLXGXXEVKRADTSKDKLPDYPAPPLKK* |
| Ga0062387_1011920471 | 3300004091 | Bog Forest Soil | RAGGIATTVISPSLLFDELEVKRADTSKDKLPDYPPPPQKK* |
| Ga0062387_1012846032 | 3300004091 | Bog Forest Soil | DPLVSNRVGGIAQTIIQTLLFDELEVKRADTSKEKLPEYPAPGMIK* |
| Ga0058899_121511761 | 3300004631 | Forest Soil | SNRAGGTPTTIISPSLLFGELEVKRADTSKDKLPDYAAPPLKE* |
| Ga0066395_109382461 | 3300004633 | Tropical Forest Soil | GGVATTVISPSLLFDELQVKRADTSKEKLPDYPAPPLAQK* |
| Ga0065707_100116851 | 3300005295 | Switchgrass Rhizosphere | RTGGLPATVISPSLLFDELQVKRADTSKDKLPEYPAPVLK* |
| Ga0066388_1002000645 | 3300005332 | Tropical Forest Soil | SGVPQTIIAPSLLFDELEVKRADTSKEKLPEYPAPELKKQ* |
| Ga0066388_1026337611 | 3300005332 | Tropical Forest Soil | GGVATTVICPSLLFDELEVKRADTSKDKLPDYPAPSLDKK* |
| Ga0070705_1013643702 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | SNRTGGIPSTVIAPSLLFDELQVKRADTSKDKLPEYPAPPIN* |
| Ga0070731_107177772 | 3300005538 | Surface Soil | GGIATTVISPSLLFDELEVKRADTSKDKLPDYPSPPLEKK* |
| Ga0066700_103933203 | 3300005559 | Soil | GAPTTIISPSLLFDELEVKRADTSKDKLPDYPAPPLNK* |
| Ga0066706_106174462 | 3300005598 | Soil | APTTIISPSLLFDELEVKRADTSKDKLPDYPAPPLKK* |
| Ga0070766_100609082 | 3300005921 | Soil | VNPSILFDELEVKRVTTNKDKLPDYPPPPLVAGK* |
| Ga0066651_102872061 | 3300006031 | Soil | PTTVISPSLLFDELEVKRADTSKDKLPEYPPPPLKK* |
| Ga0066656_109498712 | 3300006034 | Soil | VSNRTGGISSTVIAPSLLFDELQVKRADTSKDKLPEYPAPPIN* |
| Ga0075028_1001560791 | 3300006050 | Watersheds | LVSNRAAGAPTTIISPSLLFDELEVKRADTSKDKLPDYPAPPLKK* |
| Ga0075028_1006193821 | 3300006050 | Watersheds | DLEVSNRAEAVPQSIVNPSLLFDELQVKRVDASKDKLPEYPAPALQGGTQ* |
| Ga0070715_106968362 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | STVIAPSLLFDELQVKRADTSKDKLPEYPMPPLQK* |
| Ga0070765_1009367571 | 3300006176 | Soil | NRSGGVPTTIICPSLLFDELEVKRADTSKDKLPEYPAPPLKK* |
| Ga0075021_104997672 | 3300006354 | Watersheds | TGLPQTIISPALLFDELEVKRADTSKEKLPEYPPPAITK* |
| Ga0068865_1005334531 | 3300006881 | Miscanthus Rhizosphere | TGGLPATVISPSLLFDELQVKRADTSKDKLPEYPAPPLK* |
| Ga0075426_111324371 | 3300006903 | Populus Rhizosphere | PATVISPSLLFNELQVKRADTSKDKLPEYPAPPLN* |
| Ga0075424_1008292573 | 3300006904 | Populus Rhizosphere | ATVISPSLLFDELQVKRADTSKDKLPEYPAPPLK* |
| Ga0075435_1004678023 | 3300007076 | Populus Rhizosphere | GGLPATVISPSLLFDQLQVKRADTSKDKLPEYPAPPLKQ* |
| Ga0075435_1008361921 | 3300007076 | Populus Rhizosphere | GGLPATVISPSLLFDELQVKRADTSKDKLPEYPAPPLK* |
| Ga0099793_100128736 | 3300007258 | Vadose Zone Soil | GNDPLVSNRAGGTPTTIISPSLLFSELEVKRADTSKDKLPDYPAPPLKK* |
| Ga0099793_101086991 | 3300007258 | Vadose Zone Soil | TTIISPSLLFGELEVKRADTSKDKLPDYPAPPLKK* |
| Ga0099794_100600912 | 3300007265 | Vadose Zone Soil | PTTIISPSLLFGELEVKRADTSKDKLPDYPAPPLKK* |
| Ga0099794_104434503 | 3300007265 | Vadose Zone Soil | GAPTTIISPSLLFGELEVKRADTSKDKLPDYPAPPLKK* |
| Ga0066710_1002042661 | 3300009012 | Grasslands Soil | TTVISPSLLFDELEVKRADTSKDKLPDYPPPPIHK |
| Ga0099829_104899443 | 3300009038 | Vadose Zone Soil | SNRAGGAPTTIISPSLLFDELEVKRADTSKDKLPEYPAPPLKK* |
| Ga0099829_105915641 | 3300009038 | Vadose Zone Soil | SNRTGGIATTVISPSLLFDELEVKRADTSKDKLPDYPAPPLEKK* |
| Ga0099830_109546301 | 3300009088 | Vadose Zone Soil | APTTIISPSLLFGELEVKRADTSKDKLPDYPAPPLKK* |
| Ga0099830_113968771 | 3300009088 | Vadose Zone Soil | GLPSSVISPSILFDELEVKRADTSKDKLPEYPPPLTNPR* |
| Ga0105247_114247112 | 3300009101 | Switchgrass Rhizosphere | RTGGLPATVISPSLLFDELQVKRADTSKDKLPEYPAPPLK* |
| Ga0105243_100830285 | 3300009148 | Miscanthus Rhizosphere | ALGDDPLVSNRTGGLPATVISPSLLFEELQVKRADTSKDKLPEYPAPVLK* |
| Ga0116220_102073621 | 3300009525 | Peatlands Soil | PHSIVAPSILFDELEVKRANVNKDKLPEYPAPEMSK* |
| Ga0105237_109542871 | 3300009545 | Corn Rhizosphere | SNRAGGIATWVIAPSLLFGALAVKRADTSKDKLPDYPPPPPSASTKK* |
| Ga0116118_12860951 | 3300009637 | Peatland | HSIVNPSILFDELEVKRADRNKSTLPEYPPPPLTPAE* |
| Ga0116106_12307741 | 3300009645 | Peatland | GQTIICPSLLFDELEVKRADTSKEKLPEYPAPEMK* |
| Ga0116216_105099001 | 3300009698 | Peatlands Soil | MSGLSGLPQTIICPSLLFDELEVKRADTTKEKLPEYPAPDLKK* |
| Ga0126384_101614611 | 3300010046 | Tropical Forest Soil | VSNRVIGVPQTIIAPSLLFDELEVKRADTSKEKLPEYPAP |
| Ga0126373_116672193 | 3300010048 | Tropical Forest Soil | IPTTVISPSLLFDELEVKRADTSKDKLPEYPAPPLSK* |
| Ga0134111_104640512 | 3300010329 | Grasslands Soil | GGVPTSVISPSLLFDELEVKRADTSKDKLPEYPAPPLAKK* |
| Ga0074044_108070672 | 3300010343 | Bog Forest Soil | LVSNRAGGLPQTIICPSLLFDELEVKRADTSKEKLPEYPAPAIKN* |
| Ga0126370_123899042 | 3300010358 | Tropical Forest Soil | QTIIAPSLLFDELEVKRADTSKEKLPEYPAPELKKQ* |
| Ga0126378_131637091 | 3300010361 | Tropical Forest Soil | TTVISPSLLFSELEVKRADTSKDKLPDYPPPPPTKK* |
| Ga0126377_135028392 | 3300010362 | Tropical Forest Soil | LPATVISPSLLFDELQVKRGDLSKEKLPEYPPPPFAKP* |
| Ga0126379_118848422 | 3300010366 | Tropical Forest Soil | SNRTGGVATTVISPSLLFDEMLVKRGDASKDKLPEYPAPPLTK* |
| Ga0126381_1018294832 | 3300010376 | Tropical Forest Soil | SNRATGLPQTIIAPSLLFDELEVKRADTSKEKLPEYPAPELKK* |
| Ga0136449_1012270041 | 3300010379 | Peatlands Soil | MGNDPLVSNRIGGIAQTIIAPTLLFDELEVKRADTSKEKLPEYPAPNVKK* |
| Ga0126361_104335533 | 3300010876 | Boreal Forest Soil | VDNRPGGVSMTVIAPSLLFDELEVKRADTSKDKLPEYPAPPLKK* |
| Ga0137393_113428571 | 3300011271 | Vadose Zone Soil | APTTIISPSLLFDELEVKRADTSKDKLPEYPAPPLKK* |
| Ga0137389_104957381 | 3300012096 | Vadose Zone Soil | PTTIISPSLLFDELEVKRADTSKDKLPEYPAPPLKK* |
| Ga0137388_100762061 | 3300012189 | Vadose Zone Soil | TTIISPSLLFDEPEVKRADTSKDKLPESPAPPLEKK* |
| Ga0137364_108416702 | 3300012198 | Vadose Zone Soil | GAPTTIISPSLLFDELEVKRADTSKDKLPDYPAPPLKK* |
| Ga0137363_102430582 | 3300012202 | Vadose Zone Soil | LAGSPATGISPSLLFDELEVKRADTSKDKPPEYPAPPMKK* |
| Ga0137399_104514801 | 3300012203 | Vadose Zone Soil | IICPSLLFGELQVKRADTSKDKLPDYPPPPVAKK* |
| Ga0137399_105121341 | 3300012203 | Vadose Zone Soil | TTIISPSLLFDELEVKRADTSKDKLPDYPAPPLKK* |
| Ga0137399_105697241 | 3300012203 | Vadose Zone Soil | ISTTVISPSLLFDELEVKRADTSKDKLPEYPAPPLEKK* |
| Ga0137362_101038162 | 3300012205 | Vadose Zone Soil | LAGSPATGISPSLLFDELEVKRADTSKDKLPEYPAPPMKK* |
| Ga0137384_109460712 | 3300012357 | Vadose Zone Soil | PHTIINPSILFDELEVKRQNVSKGKLPEYPPPPLVLGK* |
| Ga0137360_105503142 | 3300012361 | Vadose Zone Soil | LTGSPATGISPSLLFDELEVKRADTSKDKLPEYPAPPMKK* |
| Ga0137360_110479251 | 3300012361 | Vadose Zone Soil | SIINPSLLFDELQVKRVEASKEKLPEYPAPALTGTAP* |
| Ga0137361_100577857 | 3300012362 | Vadose Zone Soil | RAGGTPTTIISPSLLFSELEVKRADTSKDKLPDYPAPPLKK* |
| Ga0137361_116052211 | 3300012362 | Vadose Zone Soil | SNRSSGIATTVISPSLLFDELEVKRADTSKDKLPDYPAPPLEKK* |
| Ga0137390_103147753 | 3300012363 | Vadose Zone Soil | STVIAPSLLFDELQVKRADTSKDKLPEYPAPPLK* |
| Ga0137390_117156161 | 3300012363 | Vadose Zone Soil | TIISPSLLFGELEVKRADTSKDKLPDYPAPPLKK* |
| Ga0137358_110993901 | 3300012582 | Vadose Zone Soil | TVISPSLLFAELEVKRADTSKDKLPEYAAPPLEKK* |
| Ga0137419_105859601 | 3300012925 | Vadose Zone Soil | GNDPLVSNRTGGISSSVIAQSLLFDELQVKRGDASKDKLPEYPAPPLQK* |
| Ga0137419_109651191 | 3300012925 | Vadose Zone Soil | SAPTTIISPSLLFDELEVKRADTSKDKLPDYPPPPLK* |
| Ga0153916_112766212 | 3300012964 | Freshwater Wetlands | LVSNRTGGAATTIISPSLLFGELEVKRADTSKDKLPEYPAPPLKK* |
| Ga0126369_123272701 | 3300012971 | Tropical Forest Soil | VNNRTGGVATTVIAPSLLFDEMLVKRGDASKDKLPEYSAPPLSTPPSSK* |
| Ga0181522_102012381 | 3300014657 | Bog | NRQGGVATTVITPSLLFDELEVKRADTSKDKLPDYPAPPLQAQSSPKK* |
| Ga0137411_10532081 | 3300015052 | Vadose Zone Soil | SPATGISPSPLFDELEVKRADTSKDKLPEYPAPPMKK* |
| Ga0137405_13273035 | 3300015053 | Vadose Zone Soil | VSNRTGGAPLTIISPSLLFGELEVKRADTSKDKLPDLSAPAAEEVTGD* |
| Ga0137405_13979474 | 3300015053 | Vadose Zone Soil | VTNRLGGWGTTVICPSLLFDELEVKRADTSKDKLPDYPAPPLVKK* |
| Ga0137412_101508811 | 3300015242 | Vadose Zone Soil | NPSLLFDELQVKRVEASKEKLPEYPAPPLMGTAP* |
| Ga0137409_112124852 | 3300015245 | Vadose Zone Soil | TTIISPSLLFDELEVKRADTSKDKLPDYPPPPLK* |
| Ga0137403_100338296 | 3300015264 | Vadose Zone Soil | GGIPSTVIAPSLLFDELQVKRADTSKDKLPEYPAPPIN* |
| Ga0137403_100372908 | 3300015264 | Vadose Zone Soil | GGIPSTVIAPSLLFDELQVKRADTSKDKLPEYPAPPIK* |
| Ga0182032_108188501 | 3300016357 | Soil | LVSNRMSGLPQTIICPSLLFDELEVKRADTTKEKLPEYPAPALQQ |
| Ga0182034_104778753 | 3300016371 | Soil | VPHTIICASLLFDDLEVKRADTTKEKLPEYPAPALEQ |
| Ga0182037_105813102 | 3300016404 | Soil | AQTIICPSLLFDELEVKRADTSKEKLPEYPAPAVKK |
| Ga0182037_115267952 | 3300016404 | Soil | GNDPLVSNRIGGIAQTIIAPTLLFDELEVKRADTSKEKLPEYPAPDVKK |
| Ga0187818_104089582 | 3300017823 | Freshwater Sediment | LVSNRAGRTPTTVISPSLLFDELEVKRADTSKDKLPDYPAPPLKN |
| Ga0187849_12684681 | 3300017929 | Peatland | MGGVPETIICPSLLFDELEVKRADTSKEKLPEYPAPPLR |
| Ga0187801_103926252 | 3300017933 | Freshwater Sediment | RVSGTPQTIICPSLLFDELEVKRADTTKEKLPEYPAPALKN |
| Ga0187781_101075553 | 3300017972 | Tropical Peatland | ICPSLLFDELEVKRADTTKEKLPEYPAPDIKPEAKK |
| Ga0187780_106627651 | 3300017973 | Tropical Peatland | REGNVTTTVVAPALFFDELEVKRADTQKDKLPDFPAPPILGH |
| Ga0187777_108951881 | 3300017974 | Tropical Peatland | PLISNRFGGVPSSVVSPSILFDELEVKRADTSKDKLPEYPPPPIAESPRH |
| Ga0187823_100474161 | 3300017993 | Freshwater Sediment | LPETVICPSMLFDELEVKRADTTKEKLPEYPAPELKK |
| Ga0187822_100688052 | 3300017994 | Freshwater Sediment | PTTIISPSLLFDELEVKRADTSKDKLPDYPPPPLKD |
| Ga0187865_11259211 | 3300018004 | Peatland | PETIICPSLLFDELEVKRADTSKEKLPEYPAPPLR |
| Ga0187784_116029901 | 3300018062 | Tropical Peatland | KAEVRNREGNIAASVVAPAFLFDDLEVKRADTTKDKLPEYPPPPIAGRAK |
| Ga0187773_100477933 | 3300018064 | Tropical Peatland | SNRVSGLPQTVISPSLLFDELEVKRADTTKEKLPEYPAPELKK |
| Ga0187771_100026245 | 3300018088 | Tropical Peatland | VTSPSLLFDELEVKRTETGKEKLPEYPAPALAVPSK |
| Ga0187770_101517361 | 3300018090 | Tropical Peatland | VTSPSLLFDELEVKRTETDKEKLPEYPAPALAVPSK |
| Ga0187770_115194101 | 3300018090 | Tropical Peatland | AVNPSILFDELEVKRSDRNKSTLPDYPPPPLSSAE |
| Ga0179594_100260331 | 3300020170 | Vadose Zone Soil | LAGSPATGISPSLLFDELEVKRADTSKDKPPEYPAPPMKK |
| Ga0179592_104416122 | 3300020199 | Vadose Zone Soil | SGGVPTTIICPSLLFDELEVKRADTSKDKLPEYPAPPLKK |
| Ga0210403_104531741 | 3300020580 | Soil | GVPTTIICPSLLFDELEVKRADTSKDKLPDYPAPPLKK |
| Ga0210399_100194341 | 3300020581 | Soil | RAGGVPQTIIAPSLLFDELEVKRADTSKEKLPEYGAPELKK |
| Ga0210399_102417164 | 3300020581 | Soil | SGGVPTTIICPSLLFDELEVKRADTSKDKLPDYAAPPLKK |
| Ga0210399_102879201 | 3300020581 | Soil | TIISPSLLFDELEVKRADTSKDKLPDYPAPPLTIK |
| Ga0210399_113991241 | 3300020581 | Soil | PSLLFDELEVKRADTSKDKLPDYPAPPLVASKTAKQ |
| Ga0210401_109728042 | 3300020583 | Soil | VGGVPQTIIAPSLLFDELEVKRADTSKEKLPEYPAPELRK |
| Ga0210406_102503384 | 3300021168 | Soil | VPTTIICPSLLFDELEVKRADTSKDKLPDYSAPPLKK |
| Ga0210408_101001383 | 3300021178 | Soil | NRSGGIATTVISPSLLFDELEVKRADTSKDKLPDYPPPPLEKK |
| Ga0210408_113975791 | 3300021178 | Soil | QTIIAPSLLFDELEVKRADTSKEKLPEYPAPELKK |
| Ga0210389_100482215 | 3300021404 | Soil | GGIATTVISPSLLFDELEVKRADTSKDKLPDYPPPPQKK |
| Ga0210383_107633662 | 3300021407 | Soil | PTTIICPSLLFDELEVKRADTSKDKLPDYAAPPLKK |
| Ga0210391_112202841 | 3300021433 | Soil | GVPTTVICPSLLFDELEVKRADTSKDKLPDYAAPPLKK |
| Ga0210390_100672885 | 3300021474 | Soil | LISNRAGGIATTVISPSLLFDELEVKRADTSKDKLPDYPPPPQKK |
| Ga0210390_114619471 | 3300021474 | Soil | TTVISPSLLFDELEVKRADTSKDKLPDYPPPPQKK |
| Ga0210398_103962282 | 3300021477 | Soil | VPQTIIAPSLLFDELEVKRADTSKEKLPEYPAPELKK |
| Ga0126371_112181151 | 3300021560 | Tropical Forest Soil | GALPQTIIAPSILFDELEVKRADTTKEKLPEYPAPPLKK |
| Ga0224549_10017071 | 3300022840 | Soil | VAASVIAPALLFDDLEVKRADTTKDKLPEYAPPPLSALSR |
| Ga0179591_11623331 | 3300024347 | Vadose Zone Soil | RAESIPNSIINPSMLFDELQVKRVEASKEKLPEYPAPPLSGTAP |
| Ga0207685_106214482 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | VIAPSLLFGELEVKRADTSKDKLPDYPPPPPSASTKK |
| Ga0207663_107027751 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | RPGGIATTVISPSLLFDELEVKRADTSKEKLPEYPPPPQTTLKK |
| Ga0207662_113638342 | 3300025918 | Switchgrass Rhizosphere | IAPSLLFGELEVKRADTSKDKLPDYPPPPPSASTKK |
| Ga0207665_115091532 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | LVTNRLGGLGTTVICPSLLFDELEVKRADTSKDKLPDYPAPPLVKK |
| Ga0209863_102148032 | 3300026281 | Prmafrost Soil | GVATTIISPSLLFDELEVKRADTSKDKLPDYPPPLQNR |
| Ga0209236_10207094 | 3300026298 | Grasslands Soil | LTGSPATGISPSPLFDELEVKRADTSKDKLPEYPAPPMKK |
| Ga0209153_10003041 | 3300026312 | Soil | SNRPGGIPTTVISPSLLFHELEVKRADTSKDKLPEYPPPPLTRK |
| Ga0209131_10328611 | 3300026320 | Grasslands Soil | SNRAGGAPTKIISPSLLFDELEVKRADTSKDKLPEYPAPPLKK |
| Ga0209377_10782592 | 3300026334 | Soil | LTGSPATGISPFDELEVKRADTSKDKLPEYPAPPMKK |
| Ga0257155_10684932 | 3300026481 | Soil | ISTTVISPSLLFDELEVKRADTSKDKLPEYPAPPLEKK |
| Ga0257158_10369621 | 3300026515 | Soil | RIGSAPTTIISPSLLFDELEVKRADTSKDKLPDYPPPPLK |
| Ga0209059_11809561 | 3300026527 | Soil | GIPTTVISPSLLFDELEVKRADTSKDKLPEYPPPSLAKK |
| Ga0179587_109841372 | 3300026557 | Vadose Zone Soil | PQTIIAPSLLFDELEVKRADTSKEKLPEYPAPELKK |
| Ga0179587_110726141 | 3300026557 | Vadose Zone Soil | LITVISPSLLFDELEVKRADTSKDKLPEYPAPPLGSKGK |
| Ga0207758_10218142 | 3300026895 | Tropical Forest Soil | PQTIIAPSILFDELEVKRADTTKEKLPEYPAPPLKK |
| Ga0207855_10123973 | 3300027039 | Tropical Forest Soil | PLVSNRMGALPQTIIAPSILFDELEVKRADTTKEKLPEYPAPPLKK |
| Ga0208365_10433691 | 3300027070 | Forest Soil | GGVPTTVISPSLLFDELEVKRADTSKDKLPDYPAPPLTKN |
| Ga0208237_10688761 | 3300027080 | Forest Soil | PTTIICPSLLFDELEVKRADTSKDKLPDYPAPPLKK |
| Ga0209117_11555611 | 3300027645 | Forest Soil | GIATTVISPSLLFDELEVKRADTSKDKLPDYPPPPLEKK |
| Ga0209689_10307406 | 3300027748 | Soil | TTIISPSLLFDELEVKRADTSKDKLPDYPAPPLKK |
| Ga0209655_1000212210 | 3300027767 | Bog Forest Soil | PTTVIAPAMLFDELEVKRADTTKDTLPDYPAPPITGAR |
| Ga0209656_103417942 | 3300027812 | Bog Forest Soil | PQTIISPTLLFDELEVKRADTSKEKLPEYPAPGMME |
| Ga0209811_101829071 | 3300027821 | Surface Soil | NRAGGIATTVISPSLLFDELEVKRADTSKDKLPEYSAPPLEKK |
| Ga0209773_102955482 | 3300027829 | Bog Forest Soil | PLVRNREGNIPTTVIAPAMLFDELEVKRADTTKDTLPDYPAPPIAGAR |
| Ga0209180_102680561 | 3300027846 | Vadose Zone Soil | NRAGGAPTTIISPSLLFDELEVKRADTSKDKLPEYPAPPLKK |
| Ga0209180_106276851 | 3300027846 | Vadose Zone Soil | GVPTTVISPSLLFDELEVKRADTSKDKLPDYPPPPFHK |
| Ga0209517_104131412 | 3300027854 | Peatlands Soil | MGGVPQTIICPSLLFDELEVKRADTSKEKLPEYPAPELR |
| Ga0209275_108835672 | 3300027884 | Soil | NRQGGVATTVITPSLLFDELEVKRADTSKDKLPDYPAPPLQSQPSPKK |
| Ga0209380_104221041 | 3300027889 | Soil | GVPTTIICPSLLFDELEVKRADTSKDKLPEYPAPPLKK |
| Ga0209624_106294222 | 3300027895 | Forest Soil | SNRAGGIATTVISPSLLFDELEVKRADTSKDKLPDYPPPPQKK |
| Ga0209488_112039723 | 3300027903 | Vadose Zone Soil | NRAGGIAITVISPSLLFAELEVKRADTSKDKLPEYAAPPLEKK |
| Ga0209006_106104271 | 3300027908 | Forest Soil | TGDKPLVRNREGNIASTVVTPAWLFGELEVKRADTTKDKLPEYPPPPITTQ |
| Ga0209006_107019352 | 3300027908 | Forest Soil | GAPTTIVSPSLLFGELEVKRADTSKDKLPEYPAPPLKK |
| Ga0247682_10084264 | 3300028146 | Soil | TTVICPSLLFDELEVKRADTSKDKLPDYPAPPLVKK |
| Ga0265338_108192231 | 3300028800 | Rhizosphere | RTNGIGQTVIAPSLLFDELEVKRADTTKEKLPEYPAPELKR |
| Ga0302304_100912361 | 3300029993 | Palsa | RTGGVAITVITPSLLFDELEVKRADTSKDKLPEYPAPPLGSK |
| Ga0265770_10053521 | 3300030878 | Soil | TTIICPSLLFDELEVKRADTSKDKLPDYAAPPLKK |
| Ga0170823_118975061 | 3300031128 | Forest Soil | RSGGIATTVISPSLLFDELEVKRAATSKDKLPDYPPPPLEKK |
| Ga0318538_102795081 | 3300031546 | Soil | NRATGMPQTIICPSLLFDELEVKRADTTKEKLPEYRAPEIKK |
| Ga0307469_101658441 | 3300031720 | Hardwood Forest Soil | ATTVISPSLLFDELEVKRADTSKDKLPDYPPPPQMK |
| Ga0307469_122150161 | 3300031720 | Hardwood Forest Soil | ISTTVISPSLLFDELEVKRADTSKDKLPDYPPPPLEKK |
| Ga0318568_105665432 | 3300031819 | Soil | VSNRMSGLPQTLICPAMLFDELEVKRADTTKEKLPEYPAPAIAK |
| Ga0310912_103165493 | 3300031941 | Soil | PQTMIAPSILFDELEVKRADTTKEKLPEYPPPPLKQ |
| Ga0307479_108953941 | 3300031962 | Hardwood Forest Soil | QTIIAPSLLFDELEVKRADTSKEKLPEYAAPELKK |
| Ga0307479_115111142 | 3300031962 | Hardwood Forest Soil | TTVISPSLLFDELEVKRADTSKDKLPDYPAPPLEKK |
| Ga0307479_117368091 | 3300031962 | Hardwood Forest Soil | AGGIATTVISPSLLFDELEVKRADTSKDKLPDYPAPPLEKK |
| Ga0307479_121840972 | 3300031962 | Hardwood Forest Soil | GGIATTVISPSLLFDELEVKRADTSKDKLPDYPPPPLEKK |
| Ga0306922_112730702 | 3300032001 | Soil | ATTIICPSLLFDELEVKRADTSKDKLPDYPPPPLDKR |
| Ga0318562_102307691 | 3300032008 | Soil | GLPATVISPSLLFDELQVKRADTSKDKLPEYPAPPLK |
| Ga0318504_104068722 | 3300032063 | Soil | LPQTIIAPSILFDELEVKRADTTKEKLPEYPAPPLKK |
| Ga0318577_105957741 | 3300032091 | Soil | MTALPQTIIAPSILFDELEVKRADTTKEKLPEYPAPPLKK |
| Ga0311301_120169262 | 3300032160 | Peatlands Soil | RTGGAPTTIISPSLLFDELEVKRADTSKDKLPDYPAPPLKK |
| Ga0307470_111568411 | 3300032174 | Hardwood Forest Soil | GIPATIISPSLLFDELEVKRADTSKDKLPEYPAPPLAKK |
| Ga0307471_1011060782 | 3300032180 | Hardwood Forest Soil | NRLGGWGTTVICPSLLFDELEVKRADTSKDKLPDYPAPPLVKK |
| Ga0307472_1005084351 | 3300032205 | Hardwood Forest Soil | GIATTVISPSLLFDELEVKRADTSKDKLPDYPPPQTK |
| Ga0335082_101876981 | 3300032782 | Soil | GLPQTVICPSLLFDELEVKRADTAKEKLPEYPAPPITK |
| ⦗Top⦘ |