Basic Information | |
---|---|
Family ID | F032833 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 179 |
Average Sequence Length | 45 residues |
Representative Sequence | ETREGDDPVRLGEEVGETLLRRGGDVILEEVYGEGFALPQQP |
Number of Associated Samples | 151 |
Number of Associated Scaffolds | 179 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.56 % |
% of genes near scaffold ends (potentially truncated) | 98.32 % |
% of genes from short scaffolds (< 2000 bps) | 89.94 % |
Associated GOLD sequencing projects | 142 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.47 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (96.089 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (10.614 % of family members) |
Environment Ontology (ENVO) | Unclassified (19.553 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.927 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 35.71% β-sheet: 0.00% Coil/Unstructured: 64.29% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 179 Family Scaffolds |
---|---|---|
PF02602 | HEM4 | 67.60 |
PF04299 | FMN_bind_2 | 12.29 |
PF00326 | Peptidase_S9 | 5.03 |
PF07238 | PilZ | 2.23 |
PF14539 | DUF4442 | 1.68 |
PF08238 | Sel1 | 1.12 |
PF00730 | HhH-GPD | 0.56 |
PF02225 | PA | 0.56 |
PF02371 | Transposase_20 | 0.56 |
PF14534 | DUF4440 | 0.56 |
PF03007 | WES_acyltransf | 0.56 |
PF00903 | Glyoxalase | 0.56 |
PF00515 | TPR_1 | 0.56 |
COG ID | Name | Functional Category | % Frequency in 179 Family Scaffolds |
---|---|---|---|
COG1587 | Uroporphyrinogen-III synthase | Coenzyme transport and metabolism [H] | 67.60 |
COG0122 | 3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 0.56 |
COG0177 | Endonuclease III | Replication, recombination and repair [L] | 0.56 |
COG1059 | Thermostable 8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 0.56 |
COG1194 | Adenine-specific DNA glycosylase, acts on AG and A-oxoG pairs | Replication, recombination and repair [L] | 0.56 |
COG2231 | 3-Methyladenine DNA glycosylase, HhH-GPD/Endo3 superfamily | Replication, recombination and repair [L] | 0.56 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.56 |
COG4908 | Uncharacterized conserved protein, contains a NRPS condensation (elongation) domain | General function prediction only [R] | 0.56 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 96.09 % |
Unclassified | root | N/A | 3.91 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2124908043|A2_c1_ConsensusfromContig25920 | All Organisms → cellular organisms → Bacteria | 1933 | Open in IMG/M |
3300004080|Ga0062385_11064648 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 546 | Open in IMG/M |
3300004092|Ga0062389_102827740 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 648 | Open in IMG/M |
3300004152|Ga0062386_100353239 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1178 | Open in IMG/M |
3300004633|Ga0066395_10800716 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 565 | Open in IMG/M |
3300005171|Ga0066677_10202491 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1111 | Open in IMG/M |
3300005180|Ga0066685_10340843 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1040 | Open in IMG/M |
3300005180|Ga0066685_10988673 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 557 | Open in IMG/M |
3300005187|Ga0066675_11019413 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 621 | Open in IMG/M |
3300005289|Ga0065704_10242859 | All Organisms → cellular organisms → Bacteria | 1010 | Open in IMG/M |
3300005445|Ga0070708_101295069 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 681 | Open in IMG/M |
3300005455|Ga0070663_100147173 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1803 | Open in IMG/M |
3300005467|Ga0070706_100111636 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2544 | Open in IMG/M |
3300005471|Ga0070698_100686472 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 966 | Open in IMG/M |
3300005534|Ga0070735_10941173 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
3300005536|Ga0070697_101979602 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 521 | Open in IMG/M |
3300005547|Ga0070693_100233593 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1211 | Open in IMG/M |
3300005558|Ga0066698_10893516 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 569 | Open in IMG/M |
3300005591|Ga0070761_10806986 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 591 | Open in IMG/M |
3300005610|Ga0070763_10042519 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2131 | Open in IMG/M |
3300005610|Ga0070763_10701158 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 593 | Open in IMG/M |
3300006102|Ga0075015_100249268 | All Organisms → cellular organisms → Bacteria | 962 | Open in IMG/M |
3300006102|Ga0075015_100972724 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
3300006163|Ga0070715_10848326 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
3300006172|Ga0075018_10393583 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
3300006175|Ga0070712_101175418 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
3300006237|Ga0097621_100178611 | All Organisms → cellular organisms → Bacteria | 1833 | Open in IMG/M |
3300006354|Ga0075021_10053325 | All Organisms → cellular organisms → Bacteria | 2340 | Open in IMG/M |
3300007265|Ga0099794_10496449 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
3300009094|Ga0111539_10556429 | All Organisms → cellular organisms → Bacteria | 1336 | Open in IMG/M |
3300009137|Ga0066709_101243419 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1095 | Open in IMG/M |
3300009518|Ga0116128_1178510 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 600 | Open in IMG/M |
3300009523|Ga0116221_1024920 | All Organisms → cellular organisms → Bacteria | 3055 | Open in IMG/M |
3300009644|Ga0116121_1249213 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 568 | Open in IMG/M |
3300009665|Ga0116135_1098001 | All Organisms → cellular organisms → Bacteria | 1059 | Open in IMG/M |
3300009824|Ga0116219_10143456 | All Organisms → cellular organisms → Bacteria | 1384 | Open in IMG/M |
3300009824|Ga0116219_10697974 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
3300010048|Ga0126373_10610746 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1144 | Open in IMG/M |
3300010341|Ga0074045_10301194 | All Organisms → cellular organisms → Bacteria | 1052 | Open in IMG/M |
3300010362|Ga0126377_11911054 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 669 | Open in IMG/M |
3300010376|Ga0126381_101959318 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 844 | Open in IMG/M |
3300010379|Ga0136449_102862586 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
3300010379|Ga0136449_103115290 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 643 | Open in IMG/M |
3300012199|Ga0137383_10670829 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 758 | Open in IMG/M |
3300012201|Ga0137365_10863084 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
3300012202|Ga0137363_10987496 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
3300012202|Ga0137363_11751808 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
3300012202|Ga0137363_11817264 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
3300012203|Ga0137399_10208300 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1590 | Open in IMG/M |
3300012205|Ga0137362_10405926 | All Organisms → cellular organisms → Bacteria | 1180 | Open in IMG/M |
3300012205|Ga0137362_11184024 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
3300012353|Ga0137367_10556683 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
3300012359|Ga0137385_10240021 | All Organisms → cellular organisms → Bacteria | 1572 | Open in IMG/M |
3300012361|Ga0137360_11294779 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 629 | Open in IMG/M |
3300012363|Ga0137390_10178969 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2106 | Open in IMG/M |
3300012582|Ga0137358_10434331 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 887 | Open in IMG/M |
3300012930|Ga0137407_11657557 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 609 | Open in IMG/M |
3300012958|Ga0164299_11690055 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
3300014155|Ga0181524_10274048 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
3300014160|Ga0181517_10509457 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 608 | Open in IMG/M |
3300014495|Ga0182015_10718795 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 629 | Open in IMG/M |
3300015371|Ga0132258_10521819 | All Organisms → cellular organisms → Bacteria | 2973 | Open in IMG/M |
3300016387|Ga0182040_10013169 | All Organisms → cellular organisms → Bacteria | 4339 | Open in IMG/M |
3300016702|Ga0181511_1124379 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
3300017822|Ga0187802_10262905 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 669 | Open in IMG/M |
3300017934|Ga0187803_10474364 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
3300017939|Ga0187775_10161791 | Not Available | 805 | Open in IMG/M |
3300017942|Ga0187808_10255755 | Not Available | 784 | Open in IMG/M |
3300017943|Ga0187819_10361270 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
3300017943|Ga0187819_10401803 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
3300017943|Ga0187819_10513058 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
3300017948|Ga0187847_10004519 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 10217 | Open in IMG/M |
3300017948|Ga0187847_10220826 | Not Available | 1032 | Open in IMG/M |
3300017955|Ga0187817_10115115 | All Organisms → cellular organisms → Bacteria | 1699 | Open in IMG/M |
3300017972|Ga0187781_10316465 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1108 | Open in IMG/M |
3300017972|Ga0187781_11156371 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
3300017973|Ga0187780_10943359 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 627 | Open in IMG/M |
3300017988|Ga0181520_10757088 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
3300017995|Ga0187816_10300526 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
3300018008|Ga0187888_1281035 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
3300018019|Ga0187874_10403054 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 552 | Open in IMG/M |
3300018025|Ga0187885_10126381 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1224 | Open in IMG/M |
3300018038|Ga0187855_10213846 | All Organisms → cellular organisms → Bacteria | 1136 | Open in IMG/M |
3300018040|Ga0187862_10236951 | All Organisms → cellular organisms → Bacteria | 1179 | Open in IMG/M |
3300018042|Ga0187871_10446032 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 715 | Open in IMG/M |
3300018057|Ga0187858_10682050 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 614 | Open in IMG/M |
3300018062|Ga0187784_10434494 | All Organisms → cellular organisms → Bacteria | 1060 | Open in IMG/M |
3300018062|Ga0187784_11555577 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
3300018085|Ga0187772_10972731 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 619 | Open in IMG/M |
3300018090|Ga0187770_10156490 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1739 | Open in IMG/M |
3300018482|Ga0066669_10797235 | Not Available | 836 | Open in IMG/M |
3300018482|Ga0066669_11635615 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 589 | Open in IMG/M |
3300019877|Ga0193722_1068160 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 884 | Open in IMG/M |
3300019887|Ga0193729_1043508 | All Organisms → cellular organisms → Bacteria | 1848 | Open in IMG/M |
3300020015|Ga0193734_1078301 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 571 | Open in IMG/M |
3300020199|Ga0179592_10181214 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
3300020581|Ga0210399_10002360 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 14731 | Open in IMG/M |
3300020581|Ga0210399_10663776 | Not Available | 859 | Open in IMG/M |
3300020581|Ga0210399_10827713 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 755 | Open in IMG/M |
3300021168|Ga0210406_10675773 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
3300021170|Ga0210400_10030971 | All Organisms → cellular organisms → Bacteria | 4153 | Open in IMG/M |
3300021170|Ga0210400_11055981 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 659 | Open in IMG/M |
3300021170|Ga0210400_11600729 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
3300021401|Ga0210393_10028351 | All Organisms → cellular organisms → Bacteria | 4370 | Open in IMG/M |
3300021405|Ga0210387_10308441 | All Organisms → cellular organisms → Bacteria | 1393 | Open in IMG/M |
3300021432|Ga0210384_10759365 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 866 | Open in IMG/M |
3300021477|Ga0210398_11142414 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 617 | Open in IMG/M |
3300021479|Ga0210410_10214256 | All Organisms → cellular organisms → Bacteria | 1726 | Open in IMG/M |
3300021559|Ga0210409_11233569 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 623 | Open in IMG/M |
3300021560|Ga0126371_12293012 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 652 | Open in IMG/M |
3300022557|Ga0212123_10834264 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
3300023019|Ga0224560_113922 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
3300023056|Ga0233357_1033453 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
3300025321|Ga0207656_10111146 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1266 | Open in IMG/M |
3300025905|Ga0207685_10641757 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 573 | Open in IMG/M |
3300025906|Ga0207699_10122846 | All Organisms → cellular organisms → Bacteria | 1682 | Open in IMG/M |
3300025906|Ga0207699_11421863 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 513 | Open in IMG/M |
3300025915|Ga0207693_10926876 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 667 | Open in IMG/M |
3300025929|Ga0207664_11311915 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 643 | Open in IMG/M |
3300026277|Ga0209350_1047751 | All Organisms → cellular organisms → Bacteria | 1245 | Open in IMG/M |
3300026310|Ga0209239_1231824 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
3300026315|Ga0209686_1085329 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1113 | Open in IMG/M |
3300026335|Ga0209804_1257866 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 637 | Open in IMG/M |
3300026359|Ga0257163_1056342 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
3300026489|Ga0257160_1064706 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
3300026529|Ga0209806_1206481 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 680 | Open in IMG/M |
3300026542|Ga0209805_1175112 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 958 | Open in IMG/M |
3300026550|Ga0209474_10467206 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 640 | Open in IMG/M |
3300026557|Ga0179587_10283229 | All Organisms → cellular organisms → Bacteria | 1065 | Open in IMG/M |
3300027063|Ga0207762_1064819 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
3300027158|Ga0208725_1006587 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1964 | Open in IMG/M |
3300027497|Ga0208199_1100934 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 596 | Open in IMG/M |
3300027737|Ga0209038_10091671 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 916 | Open in IMG/M |
3300027824|Ga0209040_10495123 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 544 | Open in IMG/M |
3300027854|Ga0209517_10414388 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 754 | Open in IMG/M |
3300027867|Ga0209167_10022079 | All Organisms → cellular organisms → Bacteria | 3033 | Open in IMG/M |
3300027875|Ga0209283_10730703 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 616 | Open in IMG/M |
3300027894|Ga0209068_10029424 | All Organisms → cellular organisms → Bacteria | 2711 | Open in IMG/M |
3300027894|Ga0209068_10107853 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1475 | Open in IMG/M |
3300027895|Ga0209624_10751294 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 642 | Open in IMG/M |
3300027911|Ga0209698_10597451 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
3300027911|Ga0209698_11138459 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 577 | Open in IMG/M |
3300028015|Ga0265353_1018624 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 666 | Open in IMG/M |
3300028665|Ga0302160_10119028 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 594 | Open in IMG/M |
3300028779|Ga0302266_10115716 | All Organisms → cellular organisms → Bacteria | 1078 | Open in IMG/M |
3300028906|Ga0308309_10096562 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2275 | Open in IMG/M |
3300028906|Ga0308309_11894666 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300029883|Ga0311327_10218173 | All Organisms → cellular organisms → Bacteria | 1291 | Open in IMG/M |
3300029989|Ga0311365_11653259 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 549 | Open in IMG/M |
3300030524|Ga0311357_10762197 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
3300030688|Ga0311345_10205410 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1993 | Open in IMG/M |
3300030706|Ga0310039_10042534 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2045 | Open in IMG/M |
3300031040|Ga0265754_1034941 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 532 | Open in IMG/M |
3300031231|Ga0170824_105495347 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
3300031446|Ga0170820_13454470 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 765 | Open in IMG/M |
3300031718|Ga0307474_10304057 | All Organisms → cellular organisms → Bacteria | 1229 | Open in IMG/M |
3300031720|Ga0307469_10267459 | All Organisms → cellular organisms → Bacteria | 1388 | Open in IMG/M |
3300031720|Ga0307469_11335704 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 682 | Open in IMG/M |
3300031740|Ga0307468_101937503 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 562 | Open in IMG/M |
3300031754|Ga0307475_11220125 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 585 | Open in IMG/M |
3300031902|Ga0302322_101306532 | Not Available | 882 | Open in IMG/M |
3300031910|Ga0306923_11826467 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 623 | Open in IMG/M |
3300032044|Ga0318558_10498045 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 608 | Open in IMG/M |
3300032067|Ga0318524_10025928 | All Organisms → cellular organisms → Bacteria | 2671 | Open in IMG/M |
3300032160|Ga0311301_10837812 | All Organisms → cellular organisms → Bacteria | 1254 | Open in IMG/M |
3300032160|Ga0311301_12683096 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 549 | Open in IMG/M |
3300032783|Ga0335079_11357175 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 708 | Open in IMG/M |
3300032783|Ga0335079_11837302 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 588 | Open in IMG/M |
3300032892|Ga0335081_11137805 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
3300033004|Ga0335084_10825924 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 940 | Open in IMG/M |
3300033158|Ga0335077_10089425 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3636 | Open in IMG/M |
3300033158|Ga0335077_10320635 | All Organisms → cellular organisms → Bacteria | 1689 | Open in IMG/M |
3300033158|Ga0335077_10486310 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1308 | Open in IMG/M |
3300033405|Ga0326727_10480760 | All Organisms → cellular organisms → Bacteria | 1091 | Open in IMG/M |
3300033405|Ga0326727_10845080 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 696 | Open in IMG/M |
3300033803|Ga0314862_0112424 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 638 | Open in IMG/M |
3300033804|Ga0314863_131829 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
3300034090|Ga0326723_0150777 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1021 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.61% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.06% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.15% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 5.59% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 5.59% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.47% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 4.47% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.47% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.47% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.91% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.91% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.79% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.79% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.79% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.79% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.23% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.12% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.12% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.12% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 1.12% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.12% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.12% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.12% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.68% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.68% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.68% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.68% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.68% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.56% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.56% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.56% |
Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.56% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.56% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.56% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.56% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.56% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.56% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.56% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.56% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.56% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2124908043 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active Layer A2 | Environmental | Open in IMG/M |
3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009518 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 | Environmental | Open in IMG/M |
3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
3300009644 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 | Environmental | Open in IMG/M |
3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300014155 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaG | Environmental | Open in IMG/M |
3300014160 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaG | Environmental | Open in IMG/M |
3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300016702 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300017988 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaG | Environmental | Open in IMG/M |
3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
3300018008 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40 | Environmental | Open in IMG/M |
3300018019 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150 | Environmental | Open in IMG/M |
3300018025 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100 | Environmental | Open in IMG/M |
3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019877 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1 | Environmental | Open in IMG/M |
3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
3300020015 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m1 | Environmental | Open in IMG/M |
3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
3300023019 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU1 | Environmental | Open in IMG/M |
3300023056 | Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-SFM-MS2 | Environmental | Open in IMG/M |
3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
3300026359 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-A | Environmental | Open in IMG/M |
3300026489 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-A | Environmental | Open in IMG/M |
3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300027063 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 37 (SPAdes) | Environmental | Open in IMG/M |
3300027158 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF011 (SPAdes) | Environmental | Open in IMG/M |
3300027497 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes) | Environmental | Open in IMG/M |
3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300028015 | Soil microbial communities from Maridalen valley, Oslo, Norway - NSE6 | Environmental | Open in IMG/M |
3300028665 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E1_3 | Environmental | Open in IMG/M |
3300028779 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_2 | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300029883 | I_Bog_E2 coassembly | Environmental | Open in IMG/M |
3300029989 | III_Fen_N1 coassembly | Environmental | Open in IMG/M |
3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
3300030688 | II_Bog_N2 coassembly | Environmental | Open in IMG/M |
3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
3300031040 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
3300033803 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_10 | Environmental | Open in IMG/M |
3300033804 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_20 | Environmental | Open in IMG/M |
3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
A2_c1_01213550 | 2124908043 | Soil | LRESADGEDPLSLGAAVGERLLRRGGDAILEEVYGQGVVAQQKP |
Ga0062385_110646481 | 3300004080 | Bog Forest Soil | PDGTKVLRETRVGDDPVRLGEEVGETLLRRGGDVILEEVYGEGFALPQQP* |
Ga0062389_1028277401 | 3300004092 | Bog Forest Soil | TREGDDPVRLGEEVGETLLRRGGDVILEEVYGEGFALPQQP* |
Ga0062386_1003532391 | 3300004152 | Bog Forest Soil | QSGSDPVGLGEQVGDALLRRGATAILEHVYGAAAAAAQQP* |
Ga0066395_108007161 | 3300004633 | Tropical Forest Soil | TKLLRETREGDDPVRLGEETGQILLDRGGDAILEEVYGAGFALPGQP* |
Ga0066677_102024911 | 3300005171 | Soil | SRDGSDPIQLGEIVGDALLNQGGQAILDEVYGRGVAVPQQP* |
Ga0066685_103408431 | 3300005180 | Soil | PDGSKVLRESRDGEDPVKLGEEVGDALLRRGGDAILEEVYGKGVAVPQQP* |
Ga0066685_109886732 | 3300005180 | Soil | DGRKVLRETRESDDPVRLGNEVGETLLRRGGDAILEEVYGAGFALPQQP* |
Ga0066675_110194131 | 3300005187 | Soil | DGEDPVRLGESVGETLLQRGGDVILDEVYGKGVAVPQQP* |
Ga0065704_102428591 | 3300005289 | Switchgrass Rhizosphere | SIVLRESRDGDDAQRLGDEVGATLLSRGGDAILEAVYGQGFALPSQP* |
Ga0070708_1012950691 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | LDAIVAYPDGSKVLRESRTGDDPLKLGSEVGAALLCHGGDAILEEVYGRGVAVPQQP* |
Ga0070663_1001471731 | 3300005455 | Corn Rhizosphere | VLRESRDGNDPELLGNEVGGSLLSRGGDAILQEVYGQAVAAPQQP* |
Ga0070706_1001116361 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | LLRESREGNNPEKLGAEVGHTLLRRGGDAILEQVYGKGFALPSQP* |
Ga0070698_1006864722 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | HALVAHPDGTKVLRETRESDDPVRLGNEVGETLLRRGGDAILEEVYGAGFALPQQP* |
Ga0070735_109411731 | 3300005534 | Surface Soil | DPVQLGESVGQTLLERGGDAILEAVYGQGIAVPQQP* |
Ga0070697_1019796021 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | KVLRETRESDDPVRLGNEVGETLLRRGGDAILEEVYGAGFALPQQP* |
Ga0070693_1002335931 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | ESRDGDDPVKLGDAVGETLLKRGGDLILEEVYGKGFALPGQP* |
Ga0066698_108935162 | 3300005558 | Soil | RDGSDPIQLGEIVGDALLNQGGQAILDEVYGRGVAVPQQP* |
Ga0070761_108069861 | 3300005591 | Soil | TAIVAHPDGTRVLREMSEGDDPVGLGEEVGETLLRRGGDVILDEVYGEGFALPQQP* |
Ga0070763_100425194 | 3300005610 | Soil | DPVQLGESVGEVLLQRGGEAILEAVYGQGIAVPQQP* |
Ga0070763_107011582 | 3300005610 | Soil | DDPIRLGEEVGETLLGRGGDVILEEVYGEGFALPQQP* |
Ga0075015_1002492681 | 3300006102 | Watersheds | TKVLRETGEGTDPVRLGEEVGETLLRRGGDVILEEVYGEGFALPQQP* |
Ga0075015_1009727242 | 3300006102 | Watersheds | AHPEGSLVLRETRLGDDPVRLGNEVGETLLKRGGDVILEAVYGEGFALPQQP* |
Ga0070715_108483261 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | DPELLGNEVGESLLSRGGDAILEEVYGQAVAAPQQP* |
Ga0075018_103935831 | 3300006172 | Watersheds | DGSKVLRESRSGDNAVQLGEAVGRMLLERGGDAILEAVYGTGSIRT* |
Ga0070712_1011754181 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | GDDPEKLGTEVGDTLLSRGGDAILEQVYGQGLAVPQQP* |
Ga0097621_1001786111 | 3300006237 | Miscanthus Rhizosphere | DGHDPETLGNEVGEILLRRGGDAILEEVYGRGIAVPQQP* |
Ga0075021_100533253 | 3300006354 | Watersheds | VLRESASGTDPVALGESVGNTLLRRGGDAILEEVYGRRLAHP* |
Ga0099794_104964491 | 3300007265 | Vadose Zone Soil | IRDGRLHLQAVVADPDGTKVLRESRDGSDPIQLGEIVGDALLNQGGQAILDEVYGRGVAVPQQP* |
Ga0111539_105564291 | 3300009094 | Populus Rhizosphere | DGSQVLRESRDGDDPVQLGDAVGETLLNRGGDLILEEVYGKGLALPGQP* |
Ga0066709_1012434192 | 3300009137 | Grasslands Soil | DGSKVLRESRDGEDPVELGNEVGNTLLRRGGDAILEEVYGKGVAVPQQP* |
Ga0116128_11785101 | 3300009518 | Peatland | DPVRLGEEVGETLLRRGGDVILEEVYGEGFALPQQP* |
Ga0116221_10249201 | 3300009523 | Peatlands Soil | RESCDGTDPVQLGESVGDTLLQRGGDAILEAVYGQGIAVPQQP* |
Ga0116121_12492131 | 3300009644 | Peatland | ETREGDDPVRLGEEVGETLLRRGGDVILEEVYGEGFALPQQP* |
Ga0116135_10980011 | 3300009665 | Peatland | TREGDDPVRLGEEVGETLLSRGGDVILEEVYGEGFALPQQP* |
Ga0116219_101434561 | 3300009824 | Peatlands Soil | PVGLGESVGDVLLRRGGKAILEAVYRQEMALPQPP* |
Ga0116219_106979741 | 3300009824 | Peatlands Soil | GADPVQLGESVGDALLRRGGDAILEAVYGQGMAVPQQP* |
Ga0126373_106107462 | 3300010048 | Tropical Forest Soil | NPDGSRVLRESREGDDPEELGNQVGETLLRRGGDAILEEVYGRGLALPQQP* |
Ga0074045_103011941 | 3300010341 | Bog Forest Soil | DPVRLGEGVGETLLRRGGDVILEEVYGEGFALPQQP* |
Ga0126377_119110541 | 3300010362 | Tropical Forest Soil | ARPDGTKVLRESRLGDDPVKLGEEVGESLLQMGGAEILEEVYSQGVVTPQQP* |
Ga0126381_1019593181 | 3300010376 | Tropical Forest Soil | KILRESRDGEDPDKLGGDVGETLLRQGGDAILEEVYGRGIAVPQQP* |
Ga0136449_1028625861 | 3300010379 | Peatlands Soil | DDPVRLGEEVGETLLRRGGDVILEEVYGEGFALPQQP* |
Ga0136449_1031152901 | 3300010379 | Peatlands Soil | EGSDPVQLGESVGDTLIQRGGDAILEAVYGQGIAIPQQP* |
Ga0137383_106708291 | 3300012199 | Vadose Zone Soil | RDGEDPVGLGNEVGNTLLRRGGDAILEEVYGKGVAVPQQP* |
Ga0137365_108630841 | 3300012201 | Vadose Zone Soil | SKLLRESREGNDPEKLGAEVGHALLRRGGDAILEQVYGKGFALPSQP* |
Ga0137363_109874961 | 3300012202 | Vadose Zone Soil | QDPVTLGDEVGETLLRRGGDAILEEVYGAGFAVPQQP* |
Ga0137363_117518081 | 3300012202 | Vadose Zone Soil | RESRDGEDAEKLGNEVGEMLLRRGGAAILEEVYGNGIAVPQQP* |
Ga0137363_118172642 | 3300012202 | Vadose Zone Soil | ADPDGTTVLRESRDGSNPVQLGEIVGDALLQQGGQAILEQVYARGVAVPQQP* |
Ga0137399_102083001 | 3300012203 | Vadose Zone Soil | TREGQDPVTLGDEVGETLLRRGGDAILEEVYGVGVAVAQQP* |
Ga0137362_104059261 | 3300012205 | Vadose Zone Soil | PDGTRVLRETREGDDPVRLGEEVGETLLRRGGDVILEEVYGEGFAVPQQP* |
Ga0137362_111840242 | 3300012205 | Vadose Zone Soil | VAHPDGTKVLRETRESDDPVRLGNEVGETLLRRGGDAILEEAYGAGFAVPQQP* |
Ga0137367_105566831 | 3300012353 | Vadose Zone Soil | ERLGREVGETLLRRGGDAILEEVYGEGFALPQQP* |
Ga0137385_102400211 | 3300012359 | Vadose Zone Soil | EGNDPEKLGAEVGHALLRRGGDAILEQVYGKGFALPSQP* |
Ga0137360_112947791 | 3300012361 | Vadose Zone Soil | PDGTKVLRESRDGSDPIQLGEIVGDALLNQGGQAILDEVYGRGVAVPQQP* |
Ga0137390_101789694 | 3300012363 | Vadose Zone Soil | LRETGEGDDPVRLGEEVGETLLRRGGDVILEEVYGEGFALPQQP* |
Ga0137358_104343311 | 3300012582 | Vadose Zone Soil | DGSKILRESHDGNDPERLGSEVGETLLRRGGAAILEEVYGRGLAVPEQP* |
Ga0137407_116575571 | 3300012930 | Vadose Zone Soil | VAHPDGTKVLRETRESDDPVRLGNEVGETLLRRGGDAILEEVYGAGFALPQQP* |
Ga0164299_116900551 | 3300012958 | Soil | PDGSQVLRESRDGDDPVKLGDAVGETLLNRGGDLILEEVYGKGFALPGQP* |
Ga0181524_102740481 | 3300014155 | Bog | EGSDPVRLGEEVGETLLRRGGDVILEEVYGEGFALPQQP* |
Ga0181517_105094571 | 3300014160 | Bog | LVAHPDGTKVLRESRVGPEPVRLGEEVGETLLGRGGDAILEEVYGEGFALPQQP* |
Ga0182015_107187952 | 3300014495 | Palsa | ARPDGTKVLRETRDGDDPISLGEEVGETLLRRGGDVILEEVYGEGFALPQQP* |
Ga0132258_105218193 | 3300015371 | Arabidopsis Rhizosphere | DPETLGNEVGEILLRRGGDAILEEVYGRGIAVPQQP* |
Ga0182040_100131695 | 3300016387 | Soil | DDAEKLGSEVGETLLRRGGDTILEEVYGNGVAVPQQP |
Ga0181511_11243791 | 3300016702 | Peatland | TKVLRETREGDDPVRLGEEVGETLLRRGGDVILEEVYGEGFALPQQP |
Ga0187802_102629052 | 3300017822 | Freshwater Sediment | DPVQLGELVGDALLRRGGEEILETVYGQGTAVPRQP |
Ga0187803_104743641 | 3300017934 | Freshwater Sediment | SKILRESRDGADPVELGESVGDTLLQRGGDAILEAVYGQGIAVPQQP |
Ga0187775_101617911 | 3300017939 | Tropical Peatland | DGNDPVALGELVGETLLSRGGDAILEEVYGKGVAVPQQP |
Ga0187808_102557551 | 3300017942 | Freshwater Sediment | IRESRDGSDPVQLGELVAESLLRRGGEEILETVYGQGTAVPRQP |
Ga0187819_103612701 | 3300017943 | Freshwater Sediment | KILRVQRDGKDPVRLGEEVGETLLRRGGDAILEEVYGEGFALPQQP |
Ga0187819_104018032 | 3300017943 | Freshwater Sediment | LHLDAVVARADGTKVLRESGEGDDPVRLGEAVGGALLQHGADEILEEVYG |
Ga0187819_105130582 | 3300017943 | Freshwater Sediment | VAHPDGTKILRESRDGSDPVRLGEAVGETLLSRGGDAILEEVYGEGFALPQQP |
Ga0187847_100045191 | 3300017948 | Peatland | RVGTEPVRLGEEVGETLLGRGGDAILEKVYGEGFALPQQP |
Ga0187847_102208262 | 3300017948 | Peatland | ETRDGNDPTALGESVGETLLRRGGDAILEEVYGKGIAVPQQP |
Ga0187817_101151151 | 3300017955 | Freshwater Sediment | EGDDPVRLGEEVGETLLRRGGDVILEEVYGEGFALPQQP |
Ga0187781_103164651 | 3300017972 | Tropical Peatland | DGSDPVQLGEAVAEALLHRGGEEILETVYGQGTAVPQQP |
Ga0187781_111563711 | 3300017972 | Tropical Peatland | DPVRLGEEVGETLLRRGGDVILEEVYGEGFALPQQP |
Ga0187780_109433592 | 3300017973 | Tropical Peatland | DPVRLGESVGETLLLRGGEAILEAVYGQGTAMPQQP |
Ga0181520_107570881 | 3300017988 | Bog | DDPVRLGEEVGETLLRRGGDVILEEVYGEGFALPQQP |
Ga0187816_103005261 | 3300017995 | Freshwater Sediment | TRILRESREGGDPIQLGNEVGETLLRRGGEAILAEVYGEGFAVPQQP |
Ga0187888_12810351 | 3300018008 | Peatland | TRDGDDPVRLGEEVGETLLRRGGDVILEEVYGEGFALPQQP |
Ga0187874_104030542 | 3300018019 | Peatland | DPVRLGEEVGETLLRRGVDVILEEVYGEGFALPQQP |
Ga0187885_101263811 | 3300018025 | Peatland | DGTKVLRETREGDDPVRLGEEVGETLLRRGGDVILEEVYGEGFALPQQP |
Ga0187855_102138462 | 3300018038 | Peatland | AHPDGTKVLRETREGEDPVPLGEEVGEILLRRGGDVILEEVYGEGFALPQLP |
Ga0187862_102369513 | 3300018040 | Peatland | SKVLRESRDGGDPVELGESVGETLLRRGGDAILEEVYGQGIAVPQQP |
Ga0187871_104460321 | 3300018042 | Peatland | ETREGDDPMRLGEEVGETLLRRGGDVILEEVYGEGFALPQQP |
Ga0187858_106820502 | 3300018057 | Peatland | AHPDGTKVLRETREGDDPVRLGEEVGETLLSRGGDVFLEEVYGEGFALPQQP |
Ga0187784_104344942 | 3300018062 | Tropical Peatland | HPNGTKVLRETRDGDDPKRLGDEVGETLLRRGGDAILEEVYGAGFALPQQP |
Ga0187784_115555771 | 3300018062 | Tropical Peatland | DGSTVLRETGEDSDPAALGKAVGETLLRRGGAAILEEVYGKGIAVPQQP |
Ga0187772_109727312 | 3300018085 | Tropical Peatland | DGKLHLDAIVADPEGTQVLRESRDGTDPIQLGEAVGESLLHRGGDAILEAVYGRGIAVPQQP |
Ga0187770_101564901 | 3300018090 | Tropical Peatland | IVAHPDGSKILRETGEGTDPAAVGETVGETLLLRGGSAILEEVYGRGIPVPQQP |
Ga0066669_107972352 | 3300018482 | Grasslands Soil | KVLRESRHGSDPIQLGEIVGEALLQQGGQAILDEVYGRGVAVPQQP |
Ga0066669_116356152 | 3300018482 | Grasslands Soil | AHTDGSLVLRESRDGDDPERLGSEVGETLLQRGGDAILQEVYGHSVTVPQQP |
Ga0193722_10681602 | 3300019877 | Soil | KVLRESRDGNDPEKLGSEVGETLLRRGGDAILEEVYGSGIAVPQQP |
Ga0193729_10435081 | 3300019887 | Soil | GNDPERLGAEVGHILLRRGGDAILEEVYGKGFALPSQP |
Ga0193734_10783011 | 3300020015 | Soil | LRESRDGNDPEKLGSEVGETLLRRGGDAILEEVYGSGIAVPQQP |
Ga0179592_101812142 | 3300020199 | Vadose Zone Soil | NGTRVLRETGEGDDPVRLGEEVGDTLLRRGGDVILEEVYGEGFALPQQP |
Ga0210407_111302432 | 3300020579 | Soil | KSGEGDDPVRLGEMVGAALLGEGGDSILREVYGKTVATPQQP |
Ga0210399_100023601 | 3300020581 | Soil | KILRESRDGNDPETLGCEVGEILLRSGGDVILEEVYGRGLAVPQQP |
Ga0210399_106637762 | 3300020581 | Soil | EVLQESRDGDDPVQLGRAVGATLLQRGGDAILDEVYGKRIAVPQQP |
Ga0210399_108277132 | 3300020581 | Soil | PDGSKILRESRDGSDPVQLGESVGEILLQRGGDAILEAVYGQGIAVPQQP |
Ga0210406_106757732 | 3300021168 | Soil | PDGTVVLRETREGDEINPVRLGEEVGETLLRRGGDVILEEVYGQGFAMPQQP |
Ga0210400_100309713 | 3300021170 | Soil | DGNDPIYLGESVGDTLLRRGGDAILDAVYEQGSVVPQQP |
Ga0210400_110559812 | 3300021170 | Soil | GSKVLRESRDGSDPVQLGESVGETLLQRGGDAILEAVYGQGIAVPQQP |
Ga0210400_116007292 | 3300021170 | Soil | AIVANPDGSKILRESRDGNDPETLGCEVGEILLRSGGDVILEEVYGRGLAVPQQP |
Ga0210393_100283511 | 3300021401 | Soil | GSEVLRESRDGSDPVQLGESVGETLLQRGGDAILEAVYGQGIPVPQQP |
Ga0210387_103084413 | 3300021405 | Soil | LDGTDPVPLGESVGEVLLQRGGEAILEAVYGQGIAVPQQP |
Ga0210384_107593652 | 3300021432 | Soil | GSKILRESRDGGDPVQLGESVGEILLQRGGDAILEAVYGQGIAVPQQP |
Ga0210398_111424141 | 3300021477 | Soil | VADPDGSKVLRESRDGSDPVQLGESVGETLLQRGGDAILEVVYGQGIAVPQQP |
Ga0210410_102142561 | 3300021479 | Soil | PDGSKILRESGDGSDPVQLGESVGDSLLRRGGDAILEAVYGQGIAQPQQP |
Ga0210409_112335691 | 3300021559 | Soil | ADPDGSKVLRESRDGSDPVQLGESVGETLLQRGGDAILEAVYGQGIAVPQQP |
Ga0126371_122930122 | 3300021560 | Tropical Forest Soil | LRESRDGDDPVRLGEEVGDRLLARGGDAILEEVYGQGVAAPQQP |
Ga0212123_108342642 | 3300022557 | Iron-Sulfur Acid Spring | PDGSKVLRESRDGTDPVQLGESVGHTLLQRGGDAILEAVYGQGIAVPQQP |
Ga0224560_1139222 | 3300023019 | Soil | ADPDGSKVLRESRDGTDPVQLGESVGESLLQRGGDAILEQVYGQGIAVPQQP |
Ga0233357_10334532 | 3300023056 | Soil | PVRLGEEVGEALLRRGGNVILDEVYGEGFALPQQP |
Ga0207656_101111461 | 3300025321 | Corn Rhizosphere | DGSLVLRESRDGNDPELLGNEVGESLLSRGGDAILQEVYGQAVAAPQQP |
Ga0207685_106417571 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | SRDGNDPELLGNEVGESLLSRGGDAILEEVYGQAVAAPQQP |
Ga0207699_101228461 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | DGEDAEKLGIEVGEALLRRGGDAILEEVYGNGIAVPQQP |
Ga0207699_114218631 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | GDDPIELGESVGDTLLRRGGAAILELVYGNGVALPQQP |
Ga0207693_109268761 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | LRESRDGHDPETLGNEVGEILLRRGGDAILEEVYGRGIAVPQQP |
Ga0207664_113119152 | 3300025929 | Agricultural Soil | PERLGSEVGETLLRRGGAAILEEVYGRGLAVPQQP |
Ga0209350_10477511 | 3300026277 | Grasslands Soil | SRDGSDPVQLGELVGDALLQQGGQAILDQIYGRGVEVPQQP |
Ga0209239_12318241 | 3300026310 | Grasslands Soil | EPREGDDPVRLGEEVGETLLRRGGNVILDEVYGEGFALPQQP |
Ga0209686_10853294 | 3300026315 | Soil | SRDGSDPIQLGEIVGDALLNQGGQAILDEVYGRGVAVPQQP |
Ga0209804_12578662 | 3300026335 | Soil | LRESRDGEDAEKLGSEVGETLLRRGGAAILEEVYGNGIAVPQQP |
Ga0257163_10563422 | 3300026359 | Soil | AAIVAHPDGSKLLRESREGNDPEKLGADVGHRLLRRGGDAILEQVYGKSFALPSQP |
Ga0257160_10647061 | 3300026489 | Soil | TRDGKDAVRLGEEVGEALLRRGGDVILEEVYGEGFALPQQP |
Ga0209806_12064812 | 3300026529 | Soil | DGSKVLRESRDGVDPVKLGNEVGAALLRRGGDAILEEVYGQGVAVPQQP |
Ga0209805_11751121 | 3300026542 | Soil | GDGSDPVKLGNDVGAALLRRGGDAILEEVYGQGVAVPQQP |
Ga0209474_104672062 | 3300026550 | Soil | RDGEDPVELGNEVGNTLLRRGGDAILEEVYGKGVAVPQQP |
Ga0179587_102832291 | 3300026557 | Vadose Zone Soil | EGDDPVRLGEEVGDTLLRRGGDVILEEVYGEGFALPQQP |
Ga0207762_10648191 | 3300027063 | Tropical Forest Soil | AIVAHPDGSKVLRESRDGDDPVKLGSEVGDILLRRGGDAILEAVYGSGIAVPQQP |
Ga0208725_10065871 | 3300027158 | Forest Soil | RIRLTAIVAHPDGTKVLRETREGDDAVGLGEEVGAFLLRSGGDVILDEVYGEGFALPQQP |
Ga0208199_11009342 | 3300027497 | Peatlands Soil | RQGADPVQLGESVGDALLRRGGDAILEAVYGQGMAVPQQP |
Ga0209038_100916712 | 3300027737 | Bog Forest Soil | ESRDGTDPVQLGESVGESLLQRGGDAILEQVYGQGIAVPQQP |
Ga0209040_104951232 | 3300027824 | Bog Forest Soil | DPVRLGQEVGETLLRRGGDVILEEVYGEGFALPQQP |
Ga0209517_104143881 | 3300027854 | Peatlands Soil | DPVQLGESVGDTLLQRGGDAILAAVYGQGIAVPQQP |
Ga0209167_100220793 | 3300027867 | Surface Soil | GDDPVALGELVGATLLRRGGDAILEAVYGQGIAVPQQP |
Ga0209283_107307032 | 3300027875 | Vadose Zone Soil | DPVELGEAVGETLLRRGADAILEEVYGRDVAVPQQP |
Ga0209068_100294244 | 3300027894 | Watersheds | GRDPVQLGESVGDTLLQRGGDAILEQVYGQGIAVPQQP |
Ga0209068_101078531 | 3300027894 | Watersheds | TLVLRESASGTDPVALGESVGNTLLRRGGDAILEEVYGRRLAHP |
Ga0209624_107512941 | 3300027895 | Forest Soil | HPDGTVVLRESRDGNDPVKLGEEVGDTLLARGGDAILEEVYGQGFAAPQQP |
Ga0209698_105974511 | 3300027911 | Watersheds | TKVLRETREGDDPIRLGEEVGDTLLSRGGDVILEEVYGEGFALPQQP |
Ga0209698_111384592 | 3300027911 | Watersheds | RDPVQLGESVGDTLLQRGGDAILEQVYGQGIAVPQQP |
Ga0265353_10186241 | 3300028015 | Soil | DGSKILRESRDGSDPVQLGESVGEILLQRGGDAILEAVYGQGIAVPQQP |
Ga0302160_101190281 | 3300028665 | Fen | GSEVLREQQVGNDPVALGELVGETLLRRGGDKILEAVYGENAVVPQQP |
Ga0302266_101157162 | 3300028779 | Bog | REGDDPIRLGEEVGETLLRRGGDVILEEVYGEGFALPQLP |
Ga0308309_100965621 | 3300028906 | Soil | PDGTKVLRETRDGAEPVQLGESVGDTLLQRGGDAILEAVYGQGIAVPQQP |
Ga0308309_118946661 | 3300028906 | Soil | DAGRIRLRAVVAHPEGKKVIRETGVGDDPIRLGREIGEMLLRNGADVILEQVYGEGFAIPQQP |
Ga0311327_102181731 | 3300029883 | Bog | AHPDGTKVLRETREGDDPIRLGEEVGEILLRRGGDVILEEVYGEGFALPQLP |
Ga0311365_116532591 | 3300029989 | Fen | DGKLHLTGVVDRPDGTEVLREQQVGNDTVALGELEGETLLRRGGDKILEAVYGENAVVPQQP |
Ga0311357_107621973 | 3300030524 | Palsa | EGTDPERLGEEVGETLLRRGGDVILEEVYGDGFALPQQP |
Ga0311345_102054101 | 3300030688 | Bog | VLRETREGDDPIRLGEEVGEILLRRGGDVILEEVYGEGFALPQLP |
Ga0310039_100425343 | 3300030706 | Peatlands Soil | DGHDPRQLGETVGETLLRRGGEAILEAVYGKALAVPQQP |
Ga0265754_10349412 | 3300031040 | Soil | KVLRESRDGADPVQLGESVGDTLLQRGGDVILEAVYGQGIAVPQQP |
Ga0170824_1054953471 | 3300031231 | Forest Soil | ESATGEDPIQLGEIVGDALLRKGGTEILEEVYGKGIAVPEEP |
Ga0170820_134544701 | 3300031446 | Forest Soil | LGCEPEELGAEVGETLLRRGGDEILRQIYGRDASLPQQP |
Ga0307474_103040571 | 3300031718 | Hardwood Forest Soil | RESGDPVHLGEEVGEILLRRGGNVILDEVYGEGFAVPQQP |
Ga0307469_102674591 | 3300031720 | Hardwood Forest Soil | IVANPDGSKILRESRDGDDPEKLGSEVGETLLRRGGDAILEVVYGRGLAVPQQP |
Ga0307469_113357041 | 3300031720 | Hardwood Forest Soil | RDGSDPIQLGEIVGDALLKRGGQAILDEVYGRGVEVPQQP |
Ga0307468_1019375031 | 3300031740 | Hardwood Forest Soil | ADPDGTTVLRESRDGSDPVQLGEIVGDALLQRGGQAILDQIHGRGAEVPQQP |
Ga0307475_112201251 | 3300031754 | Hardwood Forest Soil | VADPDGSRILRESRDGHDPIQLGKAVGDSLLQRGGDAILEAVYGQGIAVPQQP |
Ga0302322_1013065321 | 3300031902 | Fen | SKILRESRDGSDPVQLGEAVGETLLRRGGDAILEEVYGKGTSSP |
Ga0306923_118264671 | 3300031910 | Soil | SRLIRESRDGSDPVLLGEAVGAALLARGGEAILEAVYSRGAAVPQQP |
Ga0318558_104980451 | 3300032044 | Soil | SLVLRESRDGDDPVRLGGEVGETLLQRGGDAILEAVYGSGIAVPQQP |
Ga0318524_100259283 | 3300032067 | Soil | MILRESRDGDDAEKLGSEVGETLLRRGGDTILEEVYGNGVAVPQQP |
Ga0311301_108378121 | 3300032160 | Peatlands Soil | DGTKVLRETRDGDDPVRLGEEVGETLLRRGGDVILEEVYGEGFALPQQP |
Ga0311301_126830961 | 3300032160 | Peatlands Soil | PDGSRILRESGDGEDPVLLGETVGEALLAHGADEILEEVYG |
Ga0335079_113571752 | 3300032783 | Soil | ESREGTDPVKLGEAVGETLLQRGGDEILEAVYGQGMAVPQQP |
Ga0335079_118373021 | 3300032783 | Soil | LRESRDGDDPVHLGEMIGDALLRRGGQEILDEVYGQGIAVPQQP |
Ga0335081_111378051 | 3300032892 | Soil | LRERRQGGDPVRLGEEVGTALLQRGGDRILEEVYGEGFALPQQP |
Ga0335084_108259242 | 3300033004 | Soil | DDPVQLGELVGDLLLRRGGDAILEEVYGKGVAVPQQP |
Ga0335077_100894255 | 3300033158 | Soil | HPDGTKVLRETRDGDDPQRLGDEVGETLLGRGGDAILEEVYGAGFALPQP |
Ga0335077_103206351 | 3300033158 | Soil | PVRLGEAVGESLLRRGGEAILEAVYGQGIAVPQQP |
Ga0335077_104863103 | 3300033158 | Soil | RPDGTRILRESRVGNVPATLGEAVGESLLRRGGAEILAEVYGRGIDLPAQP |
Ga0326727_104807601 | 3300033405 | Peat Soil | ETRMGDDPVRLGEEVGENLLRRGGDVILEEVYGEGFALPQQP |
Ga0326727_108450802 | 3300033405 | Peat Soil | HPDGTKILREVRDGSDPVGLGEEVGETLLRRGGDAILEHVYGAGFALPNQP |
Ga0314862_0112424_487_636 | 3300033803 | Peatland | DGTKVLRESRAGRDPVELGDEVGETLLGRGGDAILEEVYGEGFALPQQP |
Ga0314863_131829_367_504 | 3300033804 | Peatland | LLRESRDGDDPEKLGNEVGETLLRRGGDAILQAVYGQTAATPQQP |
Ga0326723_0150777_83_256 | 3300034090 | Peat Soil | LDAIVAHPNGTKLLRESRAGDDAVRLGTEVGQILLRRGGDVILEEVYGKGVAVPQQP |
⦗Top⦘ |