Metagenome / Metatranscriptome Family F032796

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F032796
Family Type	Metagenome / Metatranscriptome
Number of Sequences	179
Average Sequence Length	38 residues
Representative Sequence	MTKGYIVADVAIKTAYFSLVAAAFIFVSMLLLAGVHP
Number of Associated Samples	134
Number of Associated Scaffolds	179

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	73.41 %
% of genes near scaffold ends (potentially truncated)	27.93 %
% of genes from short scaffolds (< 2000 bps)	84.36 %
Associated GOLD sequencing projects	127
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.55

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (64.246 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (19.553 % of family members)
Environment Ontology (ENVO)	Unclassified (24.022 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (48.045 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 50.77% β-sheet: 0.00% Coil/Unstructured: 49.23%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.55
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.55
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 179 Family Scaffolds
PF00166	Cpn10	10.06
PF00118	Cpn60_TCP1	3.91
PF08281	Sigma70_r4_2	2.79
PF07369	DUF1488	2.23
PF13085	Fer2_3	1.68
PF13183	Fer4_8	1.68
PF13340	DUF4096	1.12
PF14499	DUF4437	1.12
PF00313	CSD	1.12
PF04542	Sigma70_r2	1.12
PF13924	Lipocalin_5	0.56
PF09954	DUF2188	0.56
PF01527	HTH_Tnp_1	0.56
PF05115	PetL	0.56
PF07690	MFS_1	0.56
PF12838	Fer4_7	0.56
PF03979	Sigma70_r1_1	0.56
PF02517	Rce1-like	0.56
PF00589	Phage_integrase	0.56
PF07045	DUF1330	0.56
PF00588	SpoU_methylase	0.56
PF00011	HSP20	0.56
PF00486	Trans_reg_C	0.56
PF13586	DDE_Tnp_1_2	0.56
PF05598	DUF772	0.56
PF13439	Glyco_transf_4	0.56
PF13592	HTH_33	0.56
PF12200	DUF3597	0.56
PF03401	TctC	0.56

COG ID	Name	Functional Category	% Frequency in 179 Family Scaffolds
COG0234	Co-chaperonin GroES (HSP10)	Posttranslational modification, protein turnover, chaperones [O]	10.06
COG0459	Chaperonin GroEL (HSP60 family)	Posttranslational modification, protein turnover, chaperones [O]	3.91
COG0568	DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)	Transcription [K]	1.68
COG1191	DNA-directed RNA polymerase specialized sigma subunit	Transcription [K]	1.12
COG1595	DNA-directed RNA polymerase specialized sigma subunit, sigma24 family	Transcription [K]	1.12
COG4941	Predicted RNA polymerase sigma factor, contains C-terminal TPR domain	Transcription [K]	1.12
COG0071	Small heat shock protein IbpA, HSP20 family	Posttranslational modification, protein turnover, chaperones [O]	0.56
COG0219	tRNA(Leu) C34 or U34 (ribose-2'-O)-methylase TrmL, contains SPOUT domain	Translation, ribosomal structure and biogenesis [J]	0.56
COG0565	tRNA C32,U32 (ribose-2'-O)-methylase TrmJ or a related methyltransferase	Translation, ribosomal structure and biogenesis [J]	0.56
COG0566	tRNA G18 (ribose-2'-O)-methylase SpoU	Translation, ribosomal structure and biogenesis [J]	0.56
COG1266	Membrane protease YdiL, CAAX protease family	Posttranslational modification, protein turnover, chaperones [O]	0.56
COG3181	Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC	Energy production and conversion [C]	0.56
COG4449	Predicted protease, Abi (CAAX) family	General function prediction only [R]	0.56
COG5470	Uncharacterized conserved protein, DUF1330 family	Function unknown [S]	0.56

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	64.25 %
Unclassified	root	N/A	35.75 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	64.25 %
Unclassified	root	N/A	35.75 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	64.25 %
Unclassified	root	N/A	35.75 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	54.19 %
Unclassified	root	N/A	35.75 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	50.28 %
Unclassified	root	N/A	35.75 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	35.75 %
unclassified Alphaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria	28.49 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	11.73 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	0.56 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	35.75 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	27.93 %
Methylocystaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae	2.23 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	2.79 %
Hyphomicrobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	1.12 %
Alphaproteobacteria bacterium 13_2_20CM_2_64_7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	0.56 %
Rhodospirillaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae	0.56 %
Methylobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae	0.56 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	35.75 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	27.93 %
Methylocystis	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis	2.23 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1.12 %
Methyloceanibacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter	0.56 %
Ferrovibrio	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Ferrovibrio	0.56 %
Nitrobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Nitrobacter	0.56 %
Rhodoplanes	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes	0.56 %
Alphaproteobacteria bacterium 13_2_20CM_2_64_7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	0.56 %
Methylobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae	0.56 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	35.75 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	27.93 %
Methylocystis hirsuta	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis → Methylocystis hirsuta	2.23 %
unclassified Bradyrhizobium	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium	0.56 %
unclassified Ferrovibrio	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Ferrovibrio → unclassified Ferrovibrio	0.56 %
unclassified Rhodoplanes	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes	0.56 %
Methyloceanibacter superfactus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter superfactus	0.56 %
Nitrobacter hamburgensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Nitrobacter → Nitrobacter hamburgensis	0.56 %
Alphaproteobacteria bacterium 13_2_20CM_2_64_7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	0.56 %
Methylobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae	0.56 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	35.75 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	27.93 %
Methylocystis hirsuta	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis → Methylocystis hirsuta	2.23 %
Bradyrhizobium sp. sBnM-33	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. sBnM-33	0.56 %
Ferrovibrio sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Ferrovibrio → unclassified Ferrovibrio → Ferrovibrio sp.	0.56 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.56 %
Methyloceanibacter superfactus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter superfactus	0.56 %
Nitrobacter hamburgensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Nitrobacter → Nitrobacter hamburgensis	0.56 %
Alphaproteobacteria bacterium 13_2_20CM_2_64_7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	0.56 %
Methylobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae	0.56 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2088090014\|GPIPI_16656483	All Organisms → cellular organisms → Bacteria	5074	Open in IMG/M
2088090014\|GPIPI_16801139	All Organisms → cellular organisms → Bacteria	1253	Open in IMG/M
2088090014\|GPIPI_17392019	All Organisms → cellular organisms → Bacteria	1557	Open in IMG/M
2162886013\|SwBSRL2_contig_12335401	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis → Methylocystis hirsuta	862	Open in IMG/M
3300000956\|JGI10216J12902_112111295	Not Available	864	Open in IMG/M
3300001431\|F14TB_100283818	Not Available	617	Open in IMG/M
3300005445\|Ga0070708_100633729	All Organisms → cellular organisms → Bacteria	1007	Open in IMG/M
3300005540\|Ga0066697_10227145	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1108	Open in IMG/M
3300005552\|Ga0066701_10744291	Not Available	586	Open in IMG/M
3300005554\|Ga0066661_10189675	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1270	Open in IMG/M
3300005561\|Ga0066699_10532005	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	842	Open in IMG/M
3300005574\|Ga0066694_10073955	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1571	Open in IMG/M
3300005575\|Ga0066702_10164875	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Nitrobacter → Nitrobacter hamburgensis	1321	Open in IMG/M
3300005713\|Ga0066905_101523268	Not Available	609	Open in IMG/M
3300006028\|Ga0070717_10152629	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1999	Open in IMG/M
3300006028\|Ga0070717_10779476	All Organisms → cellular organisms → Bacteria	869	Open in IMG/M
3300006028\|Ga0070717_10789998	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	863	Open in IMG/M
3300006028\|Ga0070717_11023074	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	752	Open in IMG/M
3300006028\|Ga0070717_11479843	Not Available	616	Open in IMG/M
3300006028\|Ga0070717_11950437	Not Available	529	Open in IMG/M
3300006032\|Ga0066696_10479006	Not Available	817	Open in IMG/M
3300006034\|Ga0066656_10900329	Not Available	567	Open in IMG/M
3300006038\|Ga0075365_10397402	Not Available	973	Open in IMG/M
3300006049\|Ga0075417_10027461	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2330	Open in IMG/M
3300006051\|Ga0075364_10005184	All Organisms → cellular organisms → Bacteria	7561	Open in IMG/M
3300006058\|Ga0075432_10018658	Not Available	2367	Open in IMG/M
3300006172\|Ga0075018_10245271	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	865	Open in IMG/M
3300006172\|Ga0075018_10276755	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	821	Open in IMG/M
3300006173\|Ga0070716_101482540	Not Available	554	Open in IMG/M
3300006175\|Ga0070712_100158195	Not Available	1747	Open in IMG/M
3300006176\|Ga0070765_101402782	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	658	Open in IMG/M
3300006196\|Ga0075422_10039115	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1683	Open in IMG/M
3300006791\|Ga0066653_10553027	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	582	Open in IMG/M
3300006794\|Ga0066658_10218091	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1014	Open in IMG/M
3300006844\|Ga0075428_100198447	All Organisms → cellular organisms → Bacteria → Proteobacteria	2170	Open in IMG/M
3300006844\|Ga0075428_100255855	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1886	Open in IMG/M
3300006844\|Ga0075428_102175755	Not Available	572	Open in IMG/M
3300006845\|Ga0075421_101092873	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	896	Open in IMG/M
3300006852\|Ga0075433_10698138	Not Available	889	Open in IMG/M
3300006854\|Ga0075425_101488786	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	765	Open in IMG/M
3300006969\|Ga0075419_10515048	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	832	Open in IMG/M
3300007258\|Ga0099793_10451747	Not Available	635	Open in IMG/M
3300007265\|Ga0099794_10279124	All Organisms → cellular organisms → Bacteria	864	Open in IMG/M
3300009012\|Ga0066710_100747715	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1495	Open in IMG/M
3300009012\|Ga0066710_101074961	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1244	Open in IMG/M
3300009038\|Ga0099829_10027137	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	4030	Open in IMG/M
3300009090\|Ga0099827_11170674	All Organisms → cellular organisms → Bacteria	668	Open in IMG/M
3300009147\|Ga0114129_10545147	Not Available	1509	Open in IMG/M
3300009147\|Ga0114129_12053989	All Organisms → cellular organisms → Bacteria → Proteobacteria	690	Open in IMG/M
3300009147\|Ga0114129_13235601	Not Available	529	Open in IMG/M
3300009156\|Ga0111538_12081995	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	713	Open in IMG/M
3300009162\|Ga0075423_11792554	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	662	Open in IMG/M
3300009168\|Ga0105104_10759978	Not Available	561	Open in IMG/M
3300009840\|Ga0126313_11158514	Not Available	636	Open in IMG/M
3300010038\|Ga0126315_10429029	Not Available	834	Open in IMG/M
3300010038\|Ga0126315_11205876	Not Available	514	Open in IMG/M
3300010042\|Ga0126314_10143113	All Organisms → cellular organisms → Bacteria → Proteobacteria	1660	Open in IMG/M
3300010159\|Ga0099796_10115923	Not Available	1024	Open in IMG/M
3300010303\|Ga0134082_10301350	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	672	Open in IMG/M
3300010321\|Ga0134067_10082852	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1077	Open in IMG/M
3300010362\|Ga0126377_10219308	Not Available	1834	Open in IMG/M
3300010373\|Ga0134128_10836375	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1020	Open in IMG/M
3300011120\|Ga0150983_13510750	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	831	Open in IMG/M
3300011423\|Ga0137436_1070506	Not Available	906	Open in IMG/M
3300011444\|Ga0137463_1152841	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	868	Open in IMG/M
3300012015\|Ga0120187_1031011	Not Available	619	Open in IMG/M
3300012096\|Ga0137389_10214730	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1607	Open in IMG/M
3300012096\|Ga0137389_10263818	All Organisms → cellular organisms → Bacteria	1450	Open in IMG/M
3300012198\|Ga0137364_10054904	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2667	Open in IMG/M
3300012198\|Ga0137364_10826844	Not Available	700	Open in IMG/M
3300012198\|Ga0137364_10875514	Not Available	679	Open in IMG/M
3300012199\|Ga0137383_10924489	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	637	Open in IMG/M
3300012199\|Ga0137383_11257937	Not Available	529	Open in IMG/M
3300012201\|Ga0137365_10075179	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2549	Open in IMG/M
3300012201\|Ga0137365_10166893	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1650	Open in IMG/M
3300012202\|Ga0137363_11257094	All Organisms → cellular organisms → Bacteria	628	Open in IMG/M
3300012202\|Ga0137363_11307112	All Organisms → cellular organisms → Bacteria	614	Open in IMG/M
3300012203\|Ga0137399_11022494	Not Available	696	Open in IMG/M
3300012204\|Ga0137374_10031517	All Organisms → cellular organisms → Bacteria → Proteobacteria	5790	Open in IMG/M
3300012204\|Ga0137374_10081643	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	3128	Open in IMG/M
3300012204\|Ga0137374_10345135	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. sBnM-33	1203	Open in IMG/M
3300012206\|Ga0137380_10344240	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1330	Open in IMG/M
3300012208\|Ga0137376_10168345	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1890	Open in IMG/M
3300012208\|Ga0137376_10670573	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	895	Open in IMG/M
3300012210\|Ga0137378_10936753	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	779	Open in IMG/M
3300012210\|Ga0137378_11564031	All Organisms → cellular organisms → Bacteria	569	Open in IMG/M
3300012350\|Ga0137372_10546133	Not Available	856	Open in IMG/M
3300012350\|Ga0137372_11002953	Not Available	582	Open in IMG/M
3300012356\|Ga0137371_10612280	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	836	Open in IMG/M
3300012356\|Ga0137371_11307232	Not Available	536	Open in IMG/M
3300012357\|Ga0137384_10370045	All Organisms → cellular organisms → Bacteria	1186	Open in IMG/M
3300012359\|Ga0137385_11010916	Not Available	686	Open in IMG/M
3300012372\|Ga0134037_1204633	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	723	Open in IMG/M
3300012392\|Ga0134043_1256958	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	578	Open in IMG/M
3300012582\|Ga0137358_10074877	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2276	Open in IMG/M
3300012892\|Ga0157294_10061307	Not Available	881	Open in IMG/M
3300012927\|Ga0137416_12263551	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	500	Open in IMG/M
3300012958\|Ga0164299_10026676	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2453	Open in IMG/M
3300012977\|Ga0134087_10103558	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1195	Open in IMG/M
3300013500\|Ga0120195_1001596	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1036	Open in IMG/M
3300013760\|Ga0120188_1052070	Not Available	530	Open in IMG/M
3300014318\|Ga0075351_1029154	All Organisms → cellular organisms → Bacteria → Proteobacteria	919	Open in IMG/M
3300014325\|Ga0163163_12737163	Not Available	550	Open in IMG/M
3300014326\|Ga0157380_11704034	Not Available	688	Open in IMG/M
3300015371\|Ga0132258_10981737	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis → Methylocystis hirsuta	2134	Open in IMG/M
3300015371\|Ga0132258_11183978	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1932	Open in IMG/M
3300015372\|Ga0132256_101469517	All Organisms → cellular organisms → Bacteria	793	Open in IMG/M
3300015372\|Ga0132256_102054078	Not Available	677	Open in IMG/M
3300015372\|Ga0132256_102331078	Not Available	638	Open in IMG/M
3300015374\|Ga0132255_103965569	All Organisms → cellular organisms → Bacteria → Proteobacteria	628	Open in IMG/M
3300016319\|Ga0182033_10405365	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1153	Open in IMG/M
3300017965\|Ga0190266_10714624	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis → Methylocystis hirsuta	628	Open in IMG/M
3300018028\|Ga0184608_10421008	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis → Methylocystis hirsuta	578	Open in IMG/M
3300018053\|Ga0184626_10186132	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	882	Open in IMG/M
3300018075\|Ga0184632_10088023	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1358	Open in IMG/M
3300018431\|Ga0066655_10587075	Not Available	749	Open in IMG/M
3300018433\|Ga0066667_10508940	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	993	Open in IMG/M
3300018433\|Ga0066667_11226808	Not Available	653	Open in IMG/M
3300018468\|Ga0066662_10071198	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2329	Open in IMG/M
3300018468\|Ga0066662_10430203	All Organisms → cellular organisms → Bacteria	1173	Open in IMG/M
3300018468\|Ga0066662_10518503	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1091	Open in IMG/M
3300018468\|Ga0066662_10758834	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter superfactus	935	Open in IMG/M
3300018468\|Ga0066662_11755265	Not Available	649	Open in IMG/M
3300018482\|Ga0066669_10759622	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	856	Open in IMG/M
3300018482\|Ga0066669_11126928	Not Available	708	Open in IMG/M
3300018482\|Ga0066669_11263251	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	667	Open in IMG/M
3300020170\|Ga0179594_10058175	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1321	Open in IMG/M
3300020581\|Ga0210399_10504407	All Organisms → cellular organisms → Bacteria	1006	Open in IMG/M
3300023662\|Ga0247545_100531	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	1103	Open in IMG/M
3300025910\|Ga0207684_10134625	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2121	Open in IMG/M
3300025910\|Ga0207684_10877409	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	755	Open in IMG/M
3300025915\|Ga0207693_10133356	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	1952	Open in IMG/M
3300026089\|Ga0207648_10127643	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2237	Open in IMG/M
3300026304\|Ga0209240_1002076	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	7690	Open in IMG/M
3300026320\|Ga0209131_1069104	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1935	Open in IMG/M
3300026328\|Ga0209802_1314875	Not Available	517	Open in IMG/M
3300026514\|Ga0257168_1076803	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	739	Open in IMG/M
3300026515\|Ga0257158_1087890	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	606	Open in IMG/M
3300026529\|Ga0209806_1263099	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	580	Open in IMG/M
3300026532\|Ga0209160_1107922	Not Available	1395	Open in IMG/M
3300026536\|Ga0209058_1079626	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1724	Open in IMG/M
3300027748\|Ga0209689_1104348	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1455	Open in IMG/M
3300027880\|Ga0209481_10064426	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1721	Open in IMG/M
3300027880\|Ga0209481_10284068	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae	837	Open in IMG/M
3300027909\|Ga0209382_10111835	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3191	Open in IMG/M
3300027909\|Ga0209382_10224809	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2141	Open in IMG/M
3300027909\|Ga0209382_11118779	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	812	Open in IMG/M
3300028536\|Ga0137415_10999149	Not Available	648	Open in IMG/M
3300028889\|Ga0247827_10781052	Not Available	631	Open in IMG/M
3300030563\|Ga0247653_1010728	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	790	Open in IMG/M
3300030571\|Ga0247652_1000027	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2433	Open in IMG/M
3300030574\|Ga0247648_1105176	Not Available	639	Open in IMG/M
3300030592\|Ga0247612_1069658	Not Available	749	Open in IMG/M
3300030604\|Ga0247637_1037497	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	826	Open in IMG/M
3300030987\|Ga0308155_1029200	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	545	Open in IMG/M
3300030990\|Ga0308178_1105472	Not Available	603	Open in IMG/M
3300031099\|Ga0308181_1098792	All Organisms → cellular organisms → Bacteria → Proteobacteria	628	Open in IMG/M
3300031099\|Ga0308181_1156554	Not Available	537	Open in IMG/M
3300031231\|Ga0170824_104949680	Not Available	607	Open in IMG/M
3300031274\|Ga0307442_1006016	All Organisms → cellular organisms → Bacteria	5356	Open in IMG/M
3300031446\|Ga0170820_17585797	Not Available	592	Open in IMG/M
3300031564\|Ga0318573_10513071	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	645	Open in IMG/M
3300031573\|Ga0310915_10016967	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	4355	Open in IMG/M
3300031573\|Ga0310915_10235367	Not Available	1287	Open in IMG/M
3300031720\|Ga0307469_11825411	Not Available	588	Open in IMG/M
3300031724\|Ga0318500_10460752	Not Available	637	Open in IMG/M
3300031740\|Ga0307468_100632106	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	881	Open in IMG/M
3300031890\|Ga0306925_11324364	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Ferrovibrio → unclassified Ferrovibrio → Ferrovibrio sp.	714	Open in IMG/M
3300031944\|Ga0310884_10060985	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1729	Open in IMG/M
3300031954\|Ga0306926_11928471	Not Available	666	Open in IMG/M
3300032035\|Ga0310911_10702082	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	586	Open in IMG/M
3300032059\|Ga0318533_10460863	Not Available	930	Open in IMG/M
3300032180\|Ga0307471_100903393	All Organisms → cellular organisms → Bacteria	1050	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	79.33%
Host-Associated	Host-Associated	20.67%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	74.30%
Plants	Host-Associated → Plants	20.67%
Aquatic	Environmental → Aquatic	5.03%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	74.30%
Rhizosphere	Host-Associated → Plants → Rhizosphere	16.20%
Sediment	Environmental → Aquatic → Sediment	3.91%
Rhizoplane	Host-Associated → Plants → Rhizoplane	2.79%
Roots	Host-Associated → Plants → Roots	1.68%
Freshwater	Environmental → Aquatic → Freshwater	0.56%
Marine	Environmental → Aquatic → Marine	0.56%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	64.80%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	13.97%
Loam	Environmental → Terrestrial → Soil → Loam	8.94%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	3.91%
Soil	Host-Associated → Plants → Rhizosphere → Soil	2.23%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	1.12%
Bulk Soil	Host-Associated → Plants → Roots → Bulk Soil	1.12%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	1.68%
Sediment	Environmental → Aquatic → Freshwater → Sediment	0.56%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	0.56%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	0.56%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.56%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	32.40%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	18.99%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	13.97%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	12.29%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	6.70%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	3.91%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	2.23%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	1.12%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	1.12%
Unclassified	Host-Associated → Plants → Roots → Bulk Soil → Unclassified	1.12%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	1.68%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	1.68%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	0.56%
Salt Marsh	Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh	0.56%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	0.56%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	0.56%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.56%

Habitat	Taxonomy	Distribution
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	19.55%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	13.41%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	10.61%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	8.38%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	7.82%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	6.70%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	4.47%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	2.79%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	2.23%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	2.23%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	1.12%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	1.12%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	1.12%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	1.12%
Populus Endosphere	Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere	1.12%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	1.68%
Terrestrial	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial	1.68%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	1.68%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	1.68%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	1.68%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	0.56%
Salt Marsh	Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh	0.56%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	0.56%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	0.56%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere	0.56%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	0.56%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	0.56%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	0.56%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	0.56%
Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil	0.56%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	0.56%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.56%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	0.56%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.56%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2088090014	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
2162886013	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil	Environmental	Open in IMG/M
3300000956	Soil microbial communities from Great Prairies - Kansas, Native Prairie soil	Environmental	Open in IMG/M
3300001431	Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly	Environmental	Open in IMG/M
3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Environmental	Open in IMG/M
3300005540	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146	Environmental	Open in IMG/M
3300005552	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150	Environmental	Open in IMG/M
3300005554	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110	Environmental	Open in IMG/M
3300005561	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148	Environmental	Open in IMG/M
3300005574	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143	Environmental	Open in IMG/M
3300005575	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151	Environmental	Open in IMG/M
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental	Open in IMG/M
3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Host-Associated	Open in IMG/M
3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Environmental	Open in IMG/M
3300006032	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145	Environmental	Open in IMG/M
3300006034	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105	Environmental	Open in IMG/M
3300006038	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Host-Associated	Open in IMG/M
3300006049	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1	Host-Associated	Open in IMG/M
3300006051	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Host-Associated	Open in IMG/M
3300006058	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Host-Associated	Open in IMG/M
3300006172	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014	Environmental	Open in IMG/M
3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Environmental	Open in IMG/M
3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Environmental	Open in IMG/M
3300006176	Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5	Environmental	Open in IMG/M
3300006196	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1	Host-Associated	Open in IMG/M
3300006791	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102	Environmental	Open in IMG/M
3300006794	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107	Environmental	Open in IMG/M
3300006844	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Host-Associated	Open in IMG/M
3300006845	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5	Host-Associated	Open in IMG/M
3300006847	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Host-Associated	Open in IMG/M
3300006852	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Host-Associated	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300006880	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Host-Associated	Open in IMG/M
3300006969	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3	Host-Associated	Open in IMG/M
3300007258	Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3	Environmental	Open in IMG/M
3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Environmental	Open in IMG/M
3300009012	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159	Environmental	Open in IMG/M
3300009038	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG	Environmental	Open in IMG/M
3300009090	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG	Environmental	Open in IMG/M
3300009147	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)	Host-Associated	Open in IMG/M
3300009156	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)	Host-Associated	Open in IMG/M
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated	Open in IMG/M
3300009168	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015	Environmental	Open in IMG/M
3300009840	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A	Environmental	Open in IMG/M
3300010038	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106	Environmental	Open in IMG/M
3300010042	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B	Environmental	Open in IMG/M
3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Environmental	Open in IMG/M
3300010303	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015	Environmental	Open in IMG/M
3300010321	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010373	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4	Environmental	Open in IMG/M
3300011120	Combined assembly of Microbial Forest Soil metaT	Environmental	Open in IMG/M
3300011423	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT119_2	Environmental	Open in IMG/M
3300011444	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2	Environmental	Open in IMG/M
3300012015	Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C3.rep1	Environmental	Open in IMG/M
3300012096	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG	Environmental	Open in IMG/M
3300012198	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG	Environmental	Open in IMG/M
3300012199	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG	Environmental	Open in IMG/M
3300012201	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG	Environmental	Open in IMG/M
3300012202	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG	Environmental	Open in IMG/M
3300012203	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG	Environmental	Open in IMG/M
3300012204	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG	Environmental	Open in IMG/M
3300012206	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG	Environmental	Open in IMG/M
3300012208	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG	Environmental	Open in IMG/M
3300012210	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG	Environmental	Open in IMG/M
3300012350	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG	Environmental	Open in IMG/M
3300012356	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG	Environmental	Open in IMG/M
3300012357	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG	Environmental	Open in IMG/M
3300012359	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG	Environmental	Open in IMG/M
3300012372	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_0_2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012392	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_4_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012582	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG	Environmental	Open in IMG/M
3300012892	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1	Environmental	Open in IMG/M
3300012927	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012958	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG	Environmental	Open in IMG/M
3300012977	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG	Environmental	Open in IMG/M
3300013500	Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T4.rep2	Environmental	Open in IMG/M
3300013760	Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C3.rep2	Environmental	Open in IMG/M
3300014318	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D1_rd	Environmental	Open in IMG/M
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated	Open in IMG/M
3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Host-Associated	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015372	Soil combined assembly	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300016319	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H	Environmental	Open in IMG/M
3300017965	Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T	Environmental	Open in IMG/M
3300018028	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex	Environmental	Open in IMG/M
3300018053	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1	Environmental	Open in IMG/M
3300018075	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1	Environmental	Open in IMG/M
3300018431	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104	Environmental	Open in IMG/M
3300018433	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116	Environmental	Open in IMG/M
3300018468	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111	Environmental	Open in IMG/M
3300018482	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118	Environmental	Open in IMG/M
3300020170	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300020581	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M	Environmental	Open in IMG/M
3300023662	Metatranscriptome of soil microbial communities from Bohemian Forest, Czech Republic ? CSE5 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026304	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes)	Environmental	Open in IMG/M
3300026320	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes)	Environmental	Open in IMG/M
3300026328	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes)	Environmental	Open in IMG/M
3300026514	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B	Environmental	Open in IMG/M
3300026515	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-A	Environmental	Open in IMG/M
3300026529	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes)	Environmental	Open in IMG/M
3300026532	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes)	Environmental	Open in IMG/M
3300026536	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes)	Environmental	Open in IMG/M
3300027748	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes)	Environmental	Open in IMG/M
3300027880	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)	Host-Associated	Open in IMG/M
3300027909	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)	Host-Associated	Open in IMG/M
3300028536	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300028889	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2	Environmental	Open in IMG/M
3300030563	Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Dnb6 (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300030571	Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Dnb5 (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300030574	Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Db1 (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300030592	Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Ab1 (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300030604	Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cb2 (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300030987	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_144 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300030990	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_149 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031099	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_152 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031231	Coassembly Site 11 (all samples) - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031274	Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1604-30	Environmental	Open in IMG/M
3300031446	Fir Summer Coassembly Site 11 - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031564	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21	Environmental	Open in IMG/M
3300031573	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111	Environmental	Open in IMG/M
3300031720	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515	Environmental	Open in IMG/M
3300031724	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20	Environmental	Open in IMG/M
3300031740	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05	Environmental	Open in IMG/M
3300031890	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)	Environmental	Open in IMG/M
3300031944	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1	Environmental	Open in IMG/M
3300031954	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)	Environmental	Open in IMG/M
3300032035	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170	Environmental	Open in IMG/M
3300032059	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
GPIPI_02022120	2088090014	Soil	MTARYVLADVSTKAAYFSLVAAAFIFVSMLLLTGLHP
GPIPI_03463120	2088090014	Soil	MTNGYIVADVAIKTAYFSLVAXAAFIFVSMLLLAGVHP
GPIPI_02128450	2088090014	Soil	MTQGIVADVAIKTAYFSLVAAALILVSMLLLAGVHP
SwBSRL2_0910.00003950	2162886013	Switchgrass Rhizosphere	MATGYVVSDVATKAVYFCFAAVAFAFVAMLLLTTLHP
JGI10216J12902_1121112951	3300000956	Soil	MTKGYIVADVAIKTAYFSFVAVALIFVSMLLLAGVHP*
F14TB_1002838182	3300001431	Soil	MTKGYIAADVAIKTAYFSFVVAAFIFVSMLLLAGVHP*
Ga0070708_1006337292	3300005445	Corn, Switchgrass And Miscanthus Rhizosphere	MTNGYIVADVAIKTAYFSLVAAAFIFVSMLLLAGVTPKAVQP
Ga0066697_102271452	3300005540	Soil	MTQGIVADVAIKTAYFSLVAAAFIFVSMLLLAGVHP*
Ga0066701_107442911	3300005552	Soil	MTKGYIVADVAIKTAYFSLVAAAFIFVSMLLLAGVHP*
Ga0066661_101896754	3300005554	Soil	MTSGYIVADVAIKTAYFSLVAAAFIFVSMLLLAGVHP*
Ga0066699_105320053	3300005561	Soil	MTKGYISTDVAIKTAYFSFVAAAFIFVSMLLLAGVHP*
Ga0066694_100739551	3300005574	Soil	GYIVADVAIKTAYFSLVAAAFIFVSMLLLAGVHP*
Ga0066702_101648751	3300005575	Soil	MTTGYALADVATKVVYFSLTAAAFIFVSMLLLTGLHP*
Ga0066905_1015232682	3300005713	Tropical Forest Soil	MTARYVLADVATKAAYFSLVAAAFIFVSMLLLTGLHP*
Ga0081455_100165545	3300005937	Tabebuia Heterophylla Rhizosphere	MAFREEIMTKNPVLADVITKIAYFSLIIAALVFVSMLLLTRLHP*
Ga0070717_101526292	3300006028	Corn, Switchgrass And Miscanthus Rhizosphere	MTKGYIVADVAIKTAYFSLVTAALIFVSMLLLAGVHP*
Ga0070717_107794761	3300006028	Corn, Switchgrass And Miscanthus Rhizosphere	MTKGYISADVAIKTAYFSFVAAAFIFVSMLLLAGVHP*
Ga0070717_107899983	3300006028	Corn, Switchgrass And Miscanthus Rhizosphere	MTKGYIVTDVAIKTAYFSLVAAAFIFVSMLLLAGVHP*
Ga0070717_110230742	3300006028	Corn, Switchgrass And Miscanthus Rhizosphere	MTSGDIVADVAIKTAYFSLVAAAFIFVSMLLLAGVHP*
Ga0070717_114798432	3300006028	Corn, Switchgrass And Miscanthus Rhizosphere	MTKNLVLADVVTKTFYFSLIAAAFVFVSMLLLTGLHS*
Ga0070717_119504371	3300006028	Corn, Switchgrass And Miscanthus Rhizosphere	MTKGYIVTDVAIKTAYFSLAAAAFIFVSMLLLAGVHP*
Ga0066696_104790061	3300006032	Soil	MTSGDIVADVAIKTACFSLVAAAFIFVSMLLLAGVHP*
Ga0066656_109003292	3300006034	Soil	MTNGYIVADVAIKTAYFSLVAAAFIFVSMLLLAGVHP*
Ga0075365_103974023	3300006038	Populus Endosphere	MTTGYVLSDVATKVFYFSLTAAAVIFVSMLLLTGLHP*
Ga0075417_100274613	3300006049	Populus Rhizosphere	MATGHALSAVLTKAAYFCLAAAAFVFVAMLLLTRLHP*
Ga0075417_105177081	3300006049	Populus Rhizosphere	MASQGEIMTKNPVFADVVTKIAYFSLIIAALVFVSMLLLIASILK
Ga0075364_100051843	3300006051	Populus Endosphere	MTTGYIFSDVATKVFYFSLTAVALLFVSMLLLTGLHP*
Ga0075432_100186581	3300006058	Populus Rhizosphere	CRRLVMTARYVLADVATKAACFSLVAAAFIFVSMLLLTGLHP*
Ga0075018_102452713	3300006172	Watersheds	MTKDYIVADVAIKTAYFSLAAAAFIFVSMLLLAGIHP*
Ga0075018_102767552	3300006172	Watersheds	MTKGYIVADVAIKTAYFFFAAAAFIFVSMLLLAGVHP*
Ga0070716_1014825402	3300006173	Corn, Switchgrass And Miscanthus Rhizosphere	MTQGIVADVAIKTAYFSLVAAALIFVSMLLLAGVHP*
Ga0070712_1001581952	3300006175	Corn, Switchgrass And Miscanthus Rhizosphere	MTARYVLADVSTKAAYFSLVAAAFIFVSMLLLTGLHP*
Ga0070765_1014027822	3300006176	Soil	MTKGYIVTDVAIKTAYFSLAAAVFIFVSMLLLAGVHP*
Ga0075422_100391152	3300006196	Populus Rhizosphere	MATGYVLSDVITKAAYVCLAAAAFVFVAMLLMTGLHL*
Ga0066653_105530272	3300006791	Soil	MTTGNMLADVATKAVYFSFAAAALVFVSMLLLLTGLHP*
Ga0066658_102180912	3300006794	Soil	MQITKLITRRLLETVMTQGIVADVAIKTAYFSLVAAAFIFVSMLLLAGVHP*
Ga0075428_1001624112	3300006844	Populus Rhizosphere	MTRNPVFADVITKMAYFSLIVAALVFVSMLLLTRLHP*
Ga0075428_1001984473	3300006844	Populus Rhizosphere	VLKNYLAADAITKTAYLSLVAAAFIFVFMLLLTGAHP*
Ga0075428_1002558552	3300006844	Populus Rhizosphere	MTTGYVLADLATKVAYFSLTAVAFLFVWMLLTGIHP*
Ga0075428_1021757552	3300006844	Populus Rhizosphere	QELNHYFDYRRLVMTTGYIFSDVATKVFYFSLTAAAVIFVSMLLLTGLHP*
Ga0075421_1010928731	3300006845	Populus Rhizosphere	IMATGYVLSDVITKAAYVCLAAAAFVFVAMLLMTGLHP*
Ga0075431_1003820023	3300006847	Populus Rhizosphere	MAFQGETMTKNPVFADVVTKIAYFSLIIAALVFVSMLLLTRLHP*
Ga0075433_106981383	3300006852	Populus Rhizosphere	VVKNYLVADAIAKTAYLSLVAAAFIFVLMVLLTGAHP
Ga0075425_1014887862	3300006854	Populus Rhizosphere	MTKGYIAADVAIKTAYFSFVAAAFIFVSMLLLAGVHP*
Ga0075429_1000845461	3300006880	Populus Rhizosphere	MAFQEEIMTRNPVFADVITKMAYFSLIVAALVFVSMLLLTRLHP*
Ga0075419_105150481	3300006969	Populus Rhizosphere	NHYFDYRRLVMTTGYIFSDVATKVFYFSLTAVALLFVSMLLLTGLHP*
Ga0099793_104517471	3300007258	Vadose Zone Soil	MTKGYIVADVAIKTAYFLFAAAAFIFVSMLLLAGVHP*
Ga0099794_102791241	3300007265	Vadose Zone Soil	MATGYVLSDVVTKMAYFSLAAAAFVFVAMILVTGLHP*
Ga0066710_1007477152	3300009012	Grasslands Soil	MTSGYIVADVAIKTAYFSLAAAAFIFVSMLLLAGVHP
Ga0066710_1010749612	3300009012	Grasslands Soil	MTSGYIVADVAIKTAYFSLVAAAFIFVSMLLLAGVHP
Ga0099829_100271373	3300009038	Vadose Zone Soil	MTNGYIVADVAIKTAYFSLVTAALIFVSMLLLAGVHP*
Ga0099827_111706741	3300009090	Vadose Zone Soil	MAAGYVLSDVVTKMAYFSLVAAAFVFVAMILLTGVHP*
Ga0114129_105451471	3300009147	Populus Rhizosphere	MTARYVLADVATKAACFSLVAAAFIFISMLLLTGLHP*
Ga0114129_120539892	3300009147	Populus Rhizosphere	MSSGYIVADVAIKTAYFSLVAAAVIFVSMLLLAGVHP*
Ga0114129_132356012	3300009147	Populus Rhizosphere	MTTGYIVSDVATKVFYFSLTAAAVIFVSMLLLTGLHP*
Ga0111538_120819951	3300009156	Populus Rhizosphere	MATGYVLSDVITKAAYVCLAAAAFVFVAMLLMTGLH
Ga0075423_117925542	3300009162	Populus Rhizosphere	MTNGYADVAIKTAYFSLVAAAFIFVSMLLLAGVHP*
Ga0105104_107599782	3300009168	Freshwater Sediment	MTTGYALADVATKVAYFSLTAAAFIFFSMLLLTGLHP*
Ga0126313_111585141	3300009840	Serpentine Soil	MATGYAVSDVATKAAYFGLAAAAFVFVAMLLLTALHP*
Ga0126315_104290292	3300010038	Serpentine Soil	VSNYVLADVATKTAYFSLIAAALIFVSLLVLTTLHP*
Ga0126315_112058761	3300010038	Serpentine Soil	MIVSNHVLSDVTTKTYFALMAAAFIFVLLLTLTTLHP*
Ga0126314_101431133	3300010042	Serpentine Soil	MATGYAVSDVATKAAYFGLAAAAFVFVAMLLLTTLHP*
Ga0099796_101159232	3300010159	Vadose Zone Soil	CRRLVMTARYVLADVATKAAYFSLVAAAFIFVSMLLLTGLHP*
Ga0134082_103013501	3300010303	Grasslands Soil	MTQGIVADVAIKTAYFSLVAAAFIFVSMLLLASVHP*
Ga0134067_100828522	3300010321	Grasslands Soil	MTQGVIADVAIKTAYFSLVAAAFIFVLMLLLAGVHP*
Ga0126377_102193081	3300010362	Tropical Forest Soil	MTARYVLADVATKAAYFSLVAATFIFVSMLLLTGLHP*
Ga0134128_108363751	3300010373	Terrestrial Soil	MTNGYIVADVAIKTAYFSLVAAAFIFVSMLLLAGVQP*
Ga0150983_135107501	3300011120	Forest Soil	RDDCRRLVMTKGYIAADVAIKTAYFSFVAAAFIFVSMLLLAGVHP*
Ga0137436_10705062	3300011423	Soil	MTRGYVLTDVAIKAAYFSLAAAAVIFVSMLLLTGLHP*
Ga0137463_11528412	3300011444	Soil	MWGLAKTVCRRLVMTRGYVLTDVAIKAAYFSLAAAAVIFVSMLLLTGLHP*
Ga0120187_10310112	3300012015	Terrestrial	MATGYVSDVVTKAAYFCLAATAAAFVFVAMLLLTGL
Ga0137389_102147304	3300012096	Vadose Zone Soil	MTQGIVADVAIKTAYFSLLAAAFIFVSMLLLAGVHP*
Ga0137389_102638182	3300012096	Vadose Zone Soil	MATGYVLSDVVTKMAYFSLAAAAFVFVAMISLTGLHP*
Ga0137364_100549042	3300012198	Vadose Zone Soil	MTQGVVADVAIKTAYFSLVAAAFIFVSMLLLAGVHP*
Ga0137364_108268443	3300012198	Vadose Zone Soil	SRDDCKRLAMTSSYIVADVAIKTAYFSLVAAAFLFFLIVLVVGFHP*
Ga0137364_108755142	3300012198	Vadose Zone Soil	MTSSYIVADVAIKTAYFSLVAAAFIFVSMLLLAGVHP*
Ga0137383_109244892	3300012199	Vadose Zone Soil	MTTGNVLADVATNAVYFSLVAAAFVFVSMLLLTGLHP*
Ga0137383_112579372	3300012199	Vadose Zone Soil	MTKGYVVADVAIKTAYFSFVAIAFIFVSMLLLAGVHP*
Ga0137365_100751796	3300012201	Vadose Zone Soil	MTNGYIVADVAIKTAYFSLAAAAFIFVSMLLLAGVHP
Ga0137365_101668936	3300012201	Vadose Zone Soil	VMTNGYIVADVAIKTAYFSLAAAAFIFVSMLLLAGVHP*
Ga0137363_112570941	3300012202	Vadose Zone Soil	MTSGDIVADVAIKTAYFSLVAAAFIFVSMLLLAGV
Ga0137363_113071121	3300012202	Vadose Zone Soil	MTTGYVFTEVASKVAYFSFAAMAFIFVSMLLLTSLHP*
Ga0137399_110224941	3300012203	Vadose Zone Soil	MTTSYVLADVAAKAAYFSLAAAVLIFVSMLLLTALHP*
Ga0137374_1003151710	3300012204	Vadose Zone Soil	MSAISVHSDLVTKTVYFSLTAAAFVFVAMLLLTGLHP*
Ga0137374_100816435	3300012204	Vadose Zone Soil	MTTSYVLADLATKVAYFSFTAVAFIFVWMLLTGMHP*
Ga0137374_103451352	3300012204	Vadose Zone Soil	MTKGYIVADVAIKTTYFSLVAAAFIFVSMLLLAGVHP*
Ga0137380_103442404	3300012206	Vadose Zone Soil	MTSGNVLADVATKALYFSLVAAAFVFVSMLLLTGLHP*
Ga0137376_101683453	3300012208	Vadose Zone Soil	MICRRLVMTNGYIVADVAIKTAYFSLVAAAFIFVSMLLLAGVHS*
Ga0137376_106705733	3300012208	Vadose Zone Soil	LVMTTGYALADVATKVVYFSLTAAAFIFVSMLLLTGLHP*
Ga0137378_109367531	3300012210	Vadose Zone Soil	MTQGVVADVAIKTAYFSLVAAAFIFVLMLLLAGVHP*
Ga0137378_115640312	3300012210	Vadose Zone Soil	DDCRRLVMTKGYVVADVAIKTAYFSFVAIAFIFVSMLLLAGVHP*
Ga0137372_105461332	3300012350	Vadose Zone Soil	MTKGYIVADVAIKTAYFSFVAIAFIFVSMLLLAGVHP*
Ga0137372_110029531	3300012350	Vadose Zone Soil	MTSGYIVADVAIKTTYFSLVAAAFIFVSMLLLAGVHP*
Ga0137371_106122802	3300012356	Vadose Zone Soil	MTKGYIVADVAIKTAYFSLVAAAFVFVSMLLLIGLHP*
Ga0137371_113072322	3300012356	Vadose Zone Soil	MTNGYIVADVAIKTAYFSLAAAAFIFVSMLLLAGVHP*
Ga0137384_103700451	3300012357	Vadose Zone Soil	MTNGYIVADVAIRTAYFSLVTAALIFVSMLLLAGVHP*
Ga0137385_110109161	3300012359	Vadose Zone Soil	TLARRLTMTTGNVLADVATKAAYFFLVAAAFVFVSMLLLTGLHP*
Ga0134037_12046333	3300012372	Grasslands Soil	LLETVMTQGIVADVAIKTAYFSLVAAAFIFVSMLLLAGVHP*
Ga0134043_12569582	3300012392	Grasslands Soil	DDCRRLVMTSGYIVADVAIKTAYFSLAAAAFIFVSMLLLAGVHP*
Ga0137358_100748771	3300012582	Vadose Zone Soil	RLVMTNGYIVADVAIKTAYFSLVAAAFIFVSMLLLAGVHP*
Ga0157294_100613071	3300012892	Soil	VVKNYLAADATAKTVYLSLVAAAFIFVLMLLLTGAHP*
Ga0137416_122635511	3300012927	Vadose Zone Soil	RLVMTKGYIAADVAIKTAYFSFVAAAFIFVSMLLLAGVHP*
Ga0164299_100266764	3300012958	Soil	MTSGDIVADVAIKTAYFSLVAAAFIFVSMLLLAGVHA*
Ga0134087_101035582	3300012977	Grasslands Soil	MIKNFVLSDFGTKTAYFSLVAAAVVFVSMLLLTGLHP*
Ga0120195_10015961	3300013500	Terrestrial	MTTGYALADVATKVAYFSLAAAAFIFVSMLLLAGVHP*
Ga0120188_10520702	3300013760	Terrestrial	MATGYAVSDVATKTAYFSLVAAAFVFVAMLLLTRLHP*
Ga0075351_10291542	3300014318	Natural And Restored Wetlands	MTRGHVLADLATKVAYFSLTAAAFIFVSMLLLTGVHP*
Ga0163163_127371631	3300014325	Switchgrass Rhizosphere	MTTSYVLADLATKIVYFSLTAVAFLFVWMLLTGIHP*
Ga0157380_117040342	3300014326	Switchgrass Rhizosphere	VVKNYLAADATTKTVYLSLVAAAFIFVLMLLLTGAHP*
Ga0132258_109817372	3300015371	Arabidopsis Rhizosphere	MATGYAVSDVATKAAYFGLAAAAFVFVTMLLLTTLHP*
Ga0132258_111839781	3300015371	Arabidopsis Rhizosphere	KGYIVADVAIKTAYFSLVTAALIFVSMLLLAGVHP*
Ga0132256_1001411613	3300015372	Arabidopsis Rhizosphere	MASQGEIMTKDPVFADVVTKIAYFSLIIAALVFVSMLLLTHLHP*
Ga0132256_1014695172	3300015372	Arabidopsis Rhizosphere	MVMTTGYALADVATKVAYFSLAAAAFIFVSMLLLTGLHP*
Ga0132256_1020540781	3300015372	Arabidopsis Rhizosphere	MLGGRLVMATGYAVSDVATKAAYFGLAAAAFVFVTMLLLTTLHP*
Ga0132256_1023310782	3300015372	Arabidopsis Rhizosphere	MTTILADLATKVVYFSLTAVAFLFVWMLLTGIHP*
Ga0132255_1039655691	3300015374	Arabidopsis Rhizosphere	RRLIVLKNYLAADAITKTAYLSLVAAAFIFVFMLLLTGAHP*
Ga0182033_104053653	3300016319	Soil	DDCRRPVMTKGYIVADVAIKTAYFSLVTAALIFVSMLLLAGVHP
Ga0190266_107146242	3300017965	Soil	MTTGYVLADLATKVAYFSLTAVAFLFVWMLLTGIHP
Ga0184608_104210082	3300018028	Groundwater Sediment	MTTGYVLADVATKVAYFSLTAVAFLFVWMLLTGIHP
Ga0184626_101861321	3300018053	Groundwater Sediment	MTTGYVLADLATKVAYFSLTAVAFVFVWMLLTGIHP
Ga0184632_100880233	3300018075	Groundwater Sediment	MTTGYILADLATKVAYFSLTAVAFLFVWMLLTGIHP
Ga0066655_105870751	3300018431	Grasslands Soil	MTKGYIVADVAIKTAYFSLVAAAFIFVSMLLLAGVHP
Ga0066667_105089402	3300018433	Grasslands Soil	MTQGVVADVAIKTAYFSLVAAAFIFVSMLLLAGVHP
Ga0066667_112268082	3300018433	Grasslands Soil	MTSGDIVADVAIKTACFSLVAAAFIFVSMLLLAGVHP
Ga0066662_100711985	3300018468	Grasslands Soil	LVMTKGYIVADVAIKTAYFSLVTAALIFVSMLLLAGVHP
Ga0066662_104302032	3300018468	Grasslands Soil	MTNGYIVADVAIKTAYFSLVAAAFIFVSMLLLAGVHP
Ga0066662_105185032	3300018468	Grasslands Soil	MTSGNVLADVATKALYFSLVVAAFVFVSMLLLTGLHP
Ga0066662_107588341	3300018468	Grasslands Soil	MLARRLTMTTGNVLADVATKAAYFFLVAAAFVFVSMLLLTGLHP
Ga0066662_117552651	3300018468	Grasslands Soil	MTKGYIAADVAIKTAYFSFVAAAFIFVSMLLLAGVHP
Ga0066669_107596222	3300018482	Grasslands Soil	MTQGIVADVAIKTAYFSLVAAAFIFVSMLLLAGVHP
Ga0066669_111269281	3300018482	Grasslands Soil	MATGYAVSDVATKAAYFGLAAAAFVFVAMLLLTALHP
Ga0066669_112632511	3300018482	Grasslands Soil	MTKGYIVADVAIKTAYLSLVTAALIFVSMLLLAGVHP
Ga0179594_100581753	3300020170	Vadose Zone Soil	MTKGYIVADVAIKTAYFFFAAAAFIFVSMLLLAGVHP
Ga0210399_105044071	3300020581	Soil	MTKGYIVTDVAIKTAYFSLAAAVFIFVSMLLLAGVHP
Ga0247545_1005311	3300023662	Soil	MMKDYVLSDTVPKAAYFSLVVAAFVFVAMLLLTGMHL
Ga0207684_101346253	3300025910	Corn, Switchgrass And Miscanthus Rhizosphere	MTKGYIVTDVAIKTAYFSLAAAAFIFVSMLLLAGVHP
Ga0207684_108774092	3300025910	Corn, Switchgrass And Miscanthus Rhizosphere	MTKGYIVTDVAIKTAYFSLVAAAFIFVSMLLLAGVHP
Ga0207693_101333562	3300025915	Corn, Switchgrass And Miscanthus Rhizosphere	MTKNLVLADVVTKTFYFSLIAAAFVFVSMLLLTGLHS
Ga0207648_101276433	3300026089	Miscanthus Rhizosphere	VVKNYLAADATAKTVYLSLVAAAFIFVLMLLLTGAHP
Ga0209240_10020767	3300026304	Grasslands Soil	MTNGYIVADVAIKTAYFSLVTAALIFVSMLLLAGVHP
Ga0209131_10691042	3300026320	Grasslands Soil	MTKGYIVADVAIKTAYFLFAAAAFIFVSMLLLAGVHP
Ga0209802_13148751	3300026328	Soil	RRLVMTARYVLADVATKAAYFSLVAAAFIFVSMLLLTGLHP
Ga0257168_10768031	3300026514	Soil	NGYIVADVAIKTAYFSLVTAALIFVSMLLLAGVHP
Ga0257158_10878901	3300026515	Soil	RLVMTKGYIVADVAIKTAYFLFAAAAFIFVSMLLLAGVHP
Ga0209806_12630991	3300026529	Soil	DDCRRLVMTNGYIVADVAIKTAYFSLVAAAFIFVSMLLLAGVHP
Ga0209160_11079221	3300026532	Soil	TNGYIVADVAIKTAYFSLVAAAFIFVSMLLLAGVHP
Ga0209058_10796264	3300026536	Soil	TQGIVADVAIKTAYFSLVAAAFIFVSMLLLAGVHP
Ga0209689_11043483	3300027748	Soil	MTQGIVADVAIKTAYFSLLAAAFIFVSMLLLAGVHP
Ga0209481_100644263	3300027880	Populus Rhizosphere	MATGYVLSDVITKAAYVCLAAAAFVFVAMLLMTGLHL
Ga0209481_102840683	3300027880	Populus Rhizosphere	MATGHALSAVLTKAAYFCLAAAAFVFVAMLLLTRLHP
Ga0209382_101118354	3300027909	Populus Rhizosphere	VRRLVMTTGYVLADLATKVAYFSLTAVAFLFVWMLLTGIHP
Ga0209382_102248092	3300027909	Populus Rhizosphere	MTTGYALADVATKVAYFSLTAAAFIFVSMLLLTGLHP
Ga0209382_111187791	3300027909	Populus Rhizosphere	ATGYVLSDVITKAAYVCLAAAAFVFVAMLLMTGLHP
Ga0137415_109991491	3300028536	Vadose Zone Soil	MTTSYVLADVAAKAAYFSLAAAVFIFVSMLLLTALHP
Ga0247827_107810522	3300028889	Soil	VLKNFLVADAITKTAYLSLVAAAFIFVFMLLLTGAH
Ga0247653_10107281	3300030563	Soil	VDALREVIMATDYVLSEVITKKDYVCIAAAALVFVAML
Ga0247652_10000273	3300030571	Soil	MATGYVLSDVITKAAYVCLAAAAFVFVAMLLLTGLHL
Ga0247648_11051762	3300030574	Soil	MTTGYVLADLATKVAYFSLTTVAFLFVWMLLTGIHP
Ga0247612_10696581	3300030592	Soil	MAAGYVLSDVITKAAYVCLAAAAFVFVAMLLLTGLHL
Ga0247637_10374971	3300030604	Soil	VDALREVIMATGYVLSDVITKAAYVCLAAAAFVFVAMLLLTGLHL
Ga0308155_10292002	3300030987	Soil	ETVMTQGIVADVAIKTAYFSLLAAAFIFVSMLLLAGVHP
Ga0308178_11054721	3300030990	Soil	GRLAMTSGDIVADVAIKTAYFSLVAAAFIFVSMLLLAGVHP
Ga0308181_10987922	3300031099	Soil	FIMATGRDLTGVATKAAYFCLAAATIVFAAMLLLTGLHP
Ga0308181_11565542	3300031099	Soil	DDCGRLAMTSGDIVADVAIKTAYFSLVAAAFIFVSMLLLAGVHP
Ga0170824_1049496801	3300031231	Forest Soil	MTKGIVADVAIKTAYFSLVAAALIFVSMLLLAGVHP
Ga0307442_10060161	3300031274	Salt Marsh	MTPGHVLADLATKVAYFSLAAAAFIFVSMLLLTGVHP
Ga0170820_175857972	3300031446	Forest Soil	MTKGIVADVAIKTAYFSLVAAAFIFVSMLLLAGVHP
Ga0318573_105130713	3300031564	Soil	MTARYVLADVATKAAYFSLVAATFIFVSMLLLTGLHP
Ga0310915_100169674	3300031573	Soil	MTKGYIVADVAIKTAYFSLVTAALIFVSMLLLAGVHP
Ga0310915_102353671	3300031573	Soil	MTARYVLADVATKAAYFSLVAAAFIFVSMLLLTGLH
Ga0307469_118254112	3300031720	Hardwood Forest Soil	MTTGYALADVATKVAYFSLAAAAFIFVSMLLLTGLHP
Ga0318500_104607521	3300031724	Soil	MTARYVLADVATKAAYFSLVAAAFIFVLMLLLTGLHP
Ga0307468_1006321063	3300031740	Hardwood Forest Soil	MTSGGIVADVAIKTAYFSLVAAAFIFVSMLLLAGVHP
Ga0306925_113243642	3300031890	Soil	MTARYVLADVATKATYFSLVAAAFIFVSMLLLTGLHPS
Ga0310884_100609852	3300031944	Soil	VVKNYLAADAITKTAYLSLVAAAFIFVLMLLLTGAHP
Ga0306926_119284711	3300031954	Soil	MTARYVLADVATKAAYFSLVAAAFIFVSMLLLTGL
Ga0310911_107020821	3300032035	Soil	PVMTKGYIVADVAIKTAYFSLVTAALIFVSMLLLAGVHP
Ga0318533_104608631	3300032059	Soil	VMTARYVLADVATKAAYFSLVAAAFIFVSMLLLTGLHP
Ga0307471_1009033933	3300032180	Hardwood Forest Soil	MTNGYADVAIKTAYFSLVAAAFIFVSMLLLAGVHP

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F032796

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences