| Basic Information | |
|---|---|
| Family ID | F032723 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 179 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MSAINGDKARFHRERKGKLARRERSRALRKKIAAAPVRPTGAQL |
| Number of Associated Samples | 137 |
| Number of Associated Scaffolds | 179 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 51.22 % |
| % of genes near scaffold ends (potentially truncated) | 25.70 % |
| % of genes from short scaffolds (< 2000 bps) | 77.09 % |
| Associated GOLD sequencing projects | 134 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (73.743 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil (9.497 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.961 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (33.520 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 37.50% β-sheet: 0.00% Coil/Unstructured: 62.50% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 179 Family Scaffolds |
|---|---|---|
| PF01804 | Penicil_amidase | 3.35 |
| PF00445 | Ribonuclease_T2 | 2.79 |
| PF01212 | Beta_elim_lyase | 2.79 |
| PF13204 | DUF4038 | 1.68 |
| PF02687 | FtsX | 1.68 |
| PF01965 | DJ-1_PfpI | 1.12 |
| PF00069 | Pkinase | 1.12 |
| PF00135 | COesterase | 1.12 |
| PF03631 | Virul_fac_BrkB | 1.12 |
| PF12704 | MacB_PCD | 1.12 |
| PF00079 | Serpin | 1.12 |
| PF12543 | DUF3738 | 1.12 |
| PF04379 | DUF525 | 1.12 |
| PF00724 | Oxidored_FMN | 1.12 |
| PF01053 | Cys_Met_Meta_PP | 1.12 |
| PF14559 | TPR_19 | 1.12 |
| PF02589 | LUD_dom | 0.56 |
| PF10431 | ClpB_D2-small | 0.56 |
| PF07690 | MFS_1 | 0.56 |
| PF02012 | BNR | 0.56 |
| PF00166 | Cpn10 | 0.56 |
| PF02784 | Orn_Arg_deC_N | 0.56 |
| PF13541 | ChlI | 0.56 |
| PF01381 | HTH_3 | 0.56 |
| PF01883 | FeS_assembly_P | 0.56 |
| PF12728 | HTH_17 | 0.56 |
| PF00111 | Fer2 | 0.56 |
| PF04087 | DUF389 | 0.56 |
| PF11154 | DUF2934 | 0.56 |
| PF07940 | Hepar_II_III | 0.56 |
| PF06240 | COXG | 0.56 |
| PF03167 | UDG | 0.56 |
| PF03458 | Gly_transporter | 0.56 |
| PF01810 | LysE | 0.56 |
| PF13185 | GAF_2 | 0.56 |
| PF11954 | DUF3471 | 0.56 |
| PF01814 | Hemerythrin | 0.56 |
| PF00795 | CN_hydrolase | 0.56 |
| PF00923 | TAL_FSA | 0.56 |
| PF04229 | GrpB | 0.56 |
| PF01435 | Peptidase_M48 | 0.56 |
| PF01431 | Peptidase_M13 | 0.56 |
| PF08448 | PAS_4 | 0.56 |
| PF07494 | Reg_prop | 0.56 |
| PF13560 | HTH_31 | 0.56 |
| PF07676 | PD40 | 0.56 |
| PF01432 | Peptidase_M3 | 0.56 |
| PF07593 | UnbV_ASPIC | 0.56 |
| PF01797 | Y1_Tnp | 0.56 |
| PF01925 | TauE | 0.56 |
| PF04041 | Glyco_hydro_130 | 0.56 |
| PF00149 | Metallophos | 0.56 |
| PF03551 | PadR | 0.56 |
| PF02775 | TPP_enzyme_C | 0.56 |
| PF13610 | DDE_Tnp_IS240 | 0.56 |
| PF02469 | Fasciclin | 0.56 |
| PF05163 | DinB | 0.56 |
| PF12779 | WXXGXW | 0.56 |
| PF01075 | Glyco_transf_9 | 0.56 |
| PF01833 | TIG | 0.56 |
| PF13271 | DUF4062 | 0.56 |
| PF02310 | B12-binding | 0.56 |
| PF00480 | ROK | 0.56 |
| PF13231 | PMT_2 | 0.56 |
| PF07228 | SpoIIE | 0.56 |
| PF01242 | PTPS | 0.56 |
| PF13183 | Fer4_8 | 0.56 |
| PF07995 | GSDH | 0.56 |
| PF03243 | MerB | 0.56 |
| PF03484 | B5 | 0.56 |
| PF01799 | Fer2_2 | 0.56 |
| PF12838 | Fer4_7 | 0.56 |
| PF13505 | OMP_b-brl | 0.56 |
| PF09285 | Elong-fact-P_C | 0.56 |
| PF13335 | Mg_chelatase_C | 0.56 |
| PF00072 | Response_reg | 0.56 |
| PF04365 | BrnT_toxin | 0.56 |
| PF13088 | BNR_2 | 0.56 |
| PF13432 | TPR_16 | 0.56 |
| PF00293 | NUDIX | 0.56 |
| COG ID | Name | Functional Category | % Frequency in 179 Family Scaffolds |
|---|---|---|---|
| COG1167 | DNA-binding transcriptional regulator, MocR family, contains an aminotransferase domain | Transcription [K] | 5.59 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 4.47 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 3.91 |
| COG2008 | Threonine aldolase | Amino acid transport and metabolism [E] | 3.91 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 3.91 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 3.91 |
| COG1982 | Arginine/lysine/ornithine decarboxylase | Amino acid transport and metabolism [E] | 3.91 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 3.91 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 3.91 |
| COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 3.91 |
| COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 3.91 |
| COG0075 | Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG | Amino acid transport and metabolism [E] | 3.91 |
| COG2366 | Acyl-homoserine lactone (AHL) acylase PvdQ | Secondary metabolites biosynthesis, transport and catabolism [Q] | 3.35 |
| COG4992 | Acetylornithine/succinyldiaminopimelate/putrescine aminotransferase | Amino acid transport and metabolism [E] | 2.79 |
| COG0112 | Glycine/serine hydroxymethyltransferase | Amino acid transport and metabolism [E] | 2.79 |
| COG3719 | Ribonuclease I | Translation, ribosomal structure and biogenesis [J] | 2.79 |
| COG0076 | Glutamate or tyrosine decarboxylase or a related PLP-dependent protein | Amino acid transport and metabolism [E] | 2.79 |
| COG1003 | Glycine cleavage system protein P (pyridoxal-binding), C-terminal domain | Amino acid transport and metabolism [E] | 2.79 |
| COG1104 | Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family | Amino acid transport and metabolism [E] | 2.79 |
| COG3033 | Tryptophanase | Amino acid transport and metabolism [E] | 2.79 |
| COG1940 | Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domain | Transcription [K] | 1.12 |
| COG2272 | Carboxylesterase type B | Lipid transport and metabolism [I] | 1.12 |
| COG1902 | 2,4-dienoyl-CoA reductase or related NADH-dependent reductase, Old Yellow Enzyme (OYE) family | Energy production and conversion [C] | 1.12 |
| COG2967 | Uncharacterized conserved protein ApaG affecting Mg2+/Co2+ transport | Inorganic ion transport and metabolism [P] | 1.12 |
| COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 1.12 |
| COG4100 | Cystathionine beta-lyase family protein involved in aluminum resistance | Inorganic ion transport and metabolism [P] | 1.12 |
| COG4826 | Serine protease inhibitor | Posttranslational modification, protein turnover, chaperones [O] | 1.12 |
| COG0042 | tRNA-dihydrouridine synthase | Translation, ribosomal structure and biogenesis [J] | 1.12 |
| COG3292 | Periplasmic ligand-binding sensor domain | Signal transduction mechanisms [T] | 0.56 |
| COG2929 | Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin system | Defense mechanisms [V] | 0.56 |
| COG3427 | Carbon monoxide dehydrogenase subunit CoxG | Energy production and conversion [C] | 0.56 |
| COG2860 | Uncharacterized membrane protein YeiH | Function unknown [S] | 0.56 |
| COG3590 | Predicted metalloendopeptidase | Posttranslational modification, protein turnover, chaperones [O] | 0.56 |
| COG3663 | G:T/U-mismatch repair DNA glycosylase | Replication, recombination and repair [L] | 0.56 |
| COG2335 | Uncaracterized surface protein containing fasciclin (FAS1) repeats | General function prediction only [R] | 0.56 |
| COG0019 | Diaminopimelate decarboxylase | Amino acid transport and metabolism [E] | 0.56 |
| COG2320 | GrpB domain, predicted nucleotidyltransferase, UPF0157 family | General function prediction only [R] | 0.56 |
| COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.56 |
| COG5360 | Uncharacterized conserved protein, heparinase superfamily | General function prediction only [R] | 0.56 |
| COG1164 | Oligoendopeptidase F | Amino acid transport and metabolism [E] | 0.56 |
| COG0072 | Phenylalanyl-tRNA synthetase beta subunit | Translation, ribosomal structure and biogenesis [J] | 0.56 |
| COG0176 | Transaldolase/fructose-6-phosphate aldolase | Carbohydrate transport and metabolism [G] | 0.56 |
| COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 0.56 |
| COG0339 | Zn-dependent oligopeptidase, M3 family | Posttranslational modification, protein turnover, chaperones [O] | 0.56 |
| COG0692 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 0.56 |
| COG0720 | 6-pyruvoyl-tetrahydropterin synthase | Coenzyme transport and metabolism [H] | 0.56 |
| COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 0.56 |
| COG0859 | ADP-heptose:LPS heptosyltransferase | Cell wall/membrane/envelope biogenesis [M] | 0.56 |
| COG2152 | Predicted glycosyl hydrolase, GH43/DUF377 family | Carbohydrate transport and metabolism [G] | 0.56 |
| COG1166 | Arginine decarboxylase (spermidine biosynthesis) | Amino acid transport and metabolism [E] | 0.56 |
| COG1573 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 0.56 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.56 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.56 |
| COG1808 | Uncharacterized membrane protein AF0785, contains DUF389 domain | Function unknown [S] | 0.56 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.56 |
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 0.56 |
| COG2133 | Glucose/arabinose dehydrogenase, beta-propeller fold | Carbohydrate transport and metabolism [G] | 0.56 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 73.74 % |
| Unclassified | root | N/A | 26.26 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004140|Ga0058894_1418698 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
| 3300004156|Ga0062589_101705976 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 628 | Open in IMG/M |
| 3300004476|Ga0068966_1381073 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 507 | Open in IMG/M |
| 3300004631|Ga0058899_12147549 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300004964|Ga0072331_1157627 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
| 3300005329|Ga0070683_101022145 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 794 | Open in IMG/M |
| 3300005331|Ga0070670_101996463 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300005356|Ga0070674_101658675 | Not Available | 577 | Open in IMG/M |
| 3300005531|Ga0070738_10077895 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1876 | Open in IMG/M |
| 3300005533|Ga0070734_10635519 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter | 607 | Open in IMG/M |
| 3300005534|Ga0070735_10816979 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300005538|Ga0070731_10898985 | Not Available | 587 | Open in IMG/M |
| 3300005541|Ga0070733_10570525 | Not Available | 758 | Open in IMG/M |
| 3300005543|Ga0070672_102011186 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 520 | Open in IMG/M |
| 3300005543|Ga0070672_102078160 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300005598|Ga0066706_10926092 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 677 | Open in IMG/M |
| 3300005764|Ga0066903_101183158 | Not Available | 1418 | Open in IMG/M |
| 3300005764|Ga0066903_103042082 | All Organisms → cellular organisms → Bacteria | 908 | Open in IMG/M |
| 3300005843|Ga0068860_100610205 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6 | 1097 | Open in IMG/M |
| 3300006028|Ga0070717_10417386 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1207 | Open in IMG/M |
| 3300006052|Ga0075029_100050413 | All Organisms → cellular organisms → Bacteria | 2408 | Open in IMG/M |
| 3300006176|Ga0070765_102090082 | Not Available | 529 | Open in IMG/M |
| 3300006755|Ga0079222_10277898 | All Organisms → cellular organisms → Bacteria | 1075 | Open in IMG/M |
| 3300006844|Ga0075428_102298297 | Not Available | 555 | Open in IMG/M |
| 3300006893|Ga0073928_11189775 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
| 3300009521|Ga0116222_1317583 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 674 | Open in IMG/M |
| 3300009645|Ga0116106_1073553 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1119 | Open in IMG/M |
| 3300009665|Ga0116135_1485828 | Not Available | 511 | Open in IMG/M |
| 3300009764|Ga0116134_1023160 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2515 | Open in IMG/M |
| 3300009839|Ga0116223_10682425 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 590 | Open in IMG/M |
| 3300010379|Ga0136449_100000501 | All Organisms → cellular organisms → Bacteria | 110013 | Open in IMG/M |
| 3300010379|Ga0136449_102048929 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
| 3300010379|Ga0136449_102920324 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli | 670 | Open in IMG/M |
| 3300010379|Ga0136449_104586032 | Not Available | 507 | Open in IMG/M |
| 3300011072|Ga0138563_1012999 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 532 | Open in IMG/M |
| 3300011110|Ga0138578_1017019 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
| 3300011120|Ga0150983_10098356 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300011120|Ga0150983_10314834 | Not Available | 633 | Open in IMG/M |
| 3300011340|Ga0151652_13741679 | Not Available | 795 | Open in IMG/M |
| 3300012212|Ga0150985_101457029 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 776 | Open in IMG/M |
| 3300012212|Ga0150985_107571430 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 505 | Open in IMG/M |
| 3300012212|Ga0150985_115389102 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300012212|Ga0150985_115742369 | Not Available | 1289 | Open in IMG/M |
| 3300012212|Ga0150985_121141521 | Not Available | 586 | Open in IMG/M |
| 3300012360|Ga0137375_10533849 | Not Available | 991 | Open in IMG/M |
| 3300012361|Ga0137360_10525436 | Not Available | 1009 | Open in IMG/M |
| 3300012469|Ga0150984_101020515 | Not Available | 772 | Open in IMG/M |
| 3300012469|Ga0150984_107143791 | Not Available | 727 | Open in IMG/M |
| 3300012469|Ga0150984_112382093 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 573 | Open in IMG/M |
| 3300012469|Ga0150984_120562336 | Not Available | 631 | Open in IMG/M |
| 3300013296|Ga0157374_11734332 | Not Available | 649 | Open in IMG/M |
| 3300014156|Ga0181518_10023117 | All Organisms → cellular organisms → Bacteria | 4215 | Open in IMG/M |
| 3300014156|Ga0181518_10191491 | All Organisms → cellular organisms → Bacteria | 1069 | Open in IMG/M |
| 3300014156|Ga0181518_10612272 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 506 | Open in IMG/M |
| 3300014158|Ga0181521_10269814 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
| 3300014160|Ga0181517_10385595 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 721 | Open in IMG/M |
| 3300014161|Ga0181529_10159374 | All Organisms → cellular organisms → Bacteria | 1364 | Open in IMG/M |
| 3300014162|Ga0181538_10348148 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 797 | Open in IMG/M |
| 3300014165|Ga0181523_10262957 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 982 | Open in IMG/M |
| 3300014165|Ga0181523_10440254 | Not Available | 723 | Open in IMG/M |
| 3300014165|Ga0181523_10726031 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 542 | Open in IMG/M |
| 3300014167|Ga0181528_10541623 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300014167|Ga0181528_10656256 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 584 | Open in IMG/M |
| 3300014200|Ga0181526_10109861 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1763 | Open in IMG/M |
| 3300014491|Ga0182014_10062735 | All Organisms → cellular organisms → Bacteria | 2449 | Open in IMG/M |
| 3300014491|Ga0182014_10211507 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1041 | Open in IMG/M |
| 3300014492|Ga0182013_10091358 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2091 | Open in IMG/M |
| 3300014492|Ga0182013_10119296 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1731 | Open in IMG/M |
| 3300014493|Ga0182016_10180442 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6 | 1385 | Open in IMG/M |
| 3300014495|Ga0182015_10021145 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5301 | Open in IMG/M |
| 3300014496|Ga0182011_10373116 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 935 | Open in IMG/M |
| 3300014658|Ga0181519_10937085 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 537 | Open in IMG/M |
| 3300014838|Ga0182030_10010965 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 18321 | Open in IMG/M |
| 3300015371|Ga0132258_13435238 | Not Available | 1087 | Open in IMG/M |
| 3300015373|Ga0132257_103446561 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 575 | Open in IMG/M |
| 3300015374|Ga0132255_104600421 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300017946|Ga0187879_10563265 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6 | 633 | Open in IMG/M |
| 3300017988|Ga0181520_10162696 | All Organisms → cellular organisms → Bacteria | 1799 | Open in IMG/M |
| 3300017988|Ga0181520_10628908 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300017988|Ga0181520_10984553 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 559 | Open in IMG/M |
| 3300017995|Ga0187816_10445353 | Not Available | 579 | Open in IMG/M |
| 3300018016|Ga0187880_1201928 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 901 | Open in IMG/M |
| 3300018020|Ga0187861_10453835 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6 | 533 | Open in IMG/M |
| 3300018038|Ga0187855_10887234 | Not Available | 521 | Open in IMG/M |
| 3300018042|Ga0187871_10115254 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1538 | Open in IMG/M |
| 3300018043|Ga0187887_10183566 | All Organisms → cellular organisms → Bacteria | 1247 | Open in IMG/M |
| 3300018044|Ga0187890_10774796 | Not Available | 543 | Open in IMG/M |
| 3300018047|Ga0187859_10425991 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300018047|Ga0187859_10889490 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
| 3300018057|Ga0187858_10623183 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 649 | Open in IMG/M |
| 3300018081|Ga0184625_10460961 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae | 650 | Open in IMG/M |
| 3300018433|Ga0066667_11070714 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300021477|Ga0210398_10469715 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1025 | Open in IMG/M |
| 3300021478|Ga0210402_11018953 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 755 | Open in IMG/M |
| 3300021478|Ga0210402_11230599 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 676 | Open in IMG/M |
| 3300021560|Ga0126371_11274598 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 869 | Open in IMG/M |
| 3300021861|Ga0213853_10658958 | All Organisms → cellular organisms → Bacteria | 1036 | Open in IMG/M |
| 3300022881|Ga0224545_1021429 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 931 | Open in IMG/M |
| 3300023068|Ga0224554_1125125 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300024295|Ga0224556_1033397 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1288 | Open in IMG/M |
| 3300025913|Ga0207695_10091386 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 3058 | Open in IMG/M |
| 3300025921|Ga0207652_11407019 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 601 | Open in IMG/M |
| 3300025942|Ga0207689_11565002 | Not Available | 549 | Open in IMG/M |
| 3300025972|Ga0207668_11380999 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 635 | Open in IMG/M |
| 3300027604|Ga0208324_1155323 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 621 | Open in IMG/M |
| 3300027625|Ga0208044_1004642 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 5949 | Open in IMG/M |
| 3300027854|Ga0209517_10383010 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 796 | Open in IMG/M |
| 3300027867|Ga0209167_10489208 | Not Available | 673 | Open in IMG/M |
| 3300027905|Ga0209415_10057420 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 4859 | Open in IMG/M |
| 3300027905|Ga0209415_11126926 | Not Available | 508 | Open in IMG/M |
| 3300028379|Ga0268266_10232123 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1700 | Open in IMG/M |
| 3300028800|Ga0265338_10366082 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1033 | Open in IMG/M |
| 3300028860|Ga0302199_1245667 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300028874|Ga0302155_10233211 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
| 3300029907|Ga0311329_10365609 | All Organisms → cellular organisms → Bacteria | 1021 | Open in IMG/M |
| 3300029910|Ga0311369_11020812 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300029913|Ga0311362_10295869 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1696 | Open in IMG/M |
| 3300029922|Ga0311363_10535086 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1177 | Open in IMG/M |
| 3300029943|Ga0311340_10140387 | All Organisms → cellular organisms → Bacteria | 2554 | Open in IMG/M |
| 3300029944|Ga0311352_10626357 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
| 3300029999|Ga0311339_11210250 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 691 | Open in IMG/M |
| 3300030294|Ga0311349_11677294 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300030580|Ga0311355_10676556 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 963 | Open in IMG/M |
| 3300031234|Ga0302325_10077824 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 6362 | Open in IMG/M |
| 3300031235|Ga0265330_10079198 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1417 | Open in IMG/M |
| 3300031236|Ga0302324_100890649 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 1225 | Open in IMG/M |
| 3300031250|Ga0265331_10037658 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2367 | Open in IMG/M |
| 3300031344|Ga0265316_10053270 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae | 3171 | Open in IMG/M |
| 3300031344|Ga0265316_10119154 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1994 | Open in IMG/M |
| 3300031708|Ga0310686_110202543 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
| 3300031715|Ga0307476_11178220 | Not Available | 561 | Open in IMG/M |
| 3300031716|Ga0310813_11495848 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 628 | Open in IMG/M |
| 3300031753|Ga0307477_10538085 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 791 | Open in IMG/M |
| 3300031788|Ga0302319_11090050 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300031788|Ga0302319_11492148 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 602 | Open in IMG/M |
| 3300031902|Ga0302322_103064327 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 575 | Open in IMG/M |
| 3300031939|Ga0308174_10693039 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
| 3300031954|Ga0306926_12246096 | Not Available | 606 | Open in IMG/M |
| 3300031996|Ga0308176_10702944 | All Organisms → cellular organisms → Bacteria | 1049 | Open in IMG/M |
| 3300031996|Ga0308176_12661132 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 533 | Open in IMG/M |
| 3300032074|Ga0308173_10029294 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3806 | Open in IMG/M |
| 3300032074|Ga0308173_10838285 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
| 3300032074|Ga0308173_11020543 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 769 | Open in IMG/M |
| 3300032160|Ga0311301_10295885 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2600 | Open in IMG/M |
| 3300032160|Ga0311301_11648248 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 777 | Open in IMG/M |
| 3300032515|Ga0348332_11852627 | Not Available | 560 | Open in IMG/M |
| 3300032782|Ga0335082_10875303 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300032805|Ga0335078_10051691 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 6068 | Open in IMG/M |
| 3300032805|Ga0335078_10068036 | All Organisms → cellular organisms → Bacteria | 5215 | Open in IMG/M |
| 3300032805|Ga0335078_12355605 | Not Available | 555 | Open in IMG/M |
| 3300032895|Ga0335074_10026418 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 8172 | Open in IMG/M |
| 3300033004|Ga0335084_11726454 | Not Available | 615 | Open in IMG/M |
| 3300033158|Ga0335077_10431379 | All Organisms → cellular organisms → Bacteria | 1409 | Open in IMG/M |
| 3300033402|Ga0326728_10001562 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 80537 | Open in IMG/M |
| 3300033402|Ga0326728_10010103 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 22273 | Open in IMG/M |
| 3300033402|Ga0326728_11012647 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300033513|Ga0316628_102356103 | Not Available | 704 | Open in IMG/M |
| 3300033887|Ga0334790_008195 | All Organisms → cellular organisms → Bacteria | 5869 | Open in IMG/M |
| 3300033982|Ga0371487_0004831 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 13086 | Open in IMG/M |
| 3300033982|Ga0371487_0283924 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 752 | Open in IMG/M |
| 3300033983|Ga0371488_0004023 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 14910 | Open in IMG/M |
| 3300034065|Ga0334827_234594 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 539 | Open in IMG/M |
| 3300034268|Ga0372943_0053100 | All Organisms → cellular organisms → Bacteria | 2270 | Open in IMG/M |
| 3300034282|Ga0370492_0198564 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 818 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 9.50% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 9.50% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 5.59% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.47% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.47% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.91% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 3.91% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.35% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 3.35% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 3.35% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 3.35% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 2.79% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 2.79% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 2.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.23% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.23% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.23% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.12% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.12% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.12% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.12% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.12% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.12% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.12% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.12% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.12% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.68% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.68% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.68% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.68% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.68% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.56% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.56% |
| Wetland | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Wetland | 0.56% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.56% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.56% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.56% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.56% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.56% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.56% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.56% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.56% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.56% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.56% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.56% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.56% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.56% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.56% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.56% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004140 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF224 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004476 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 58 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004631 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004964 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 77 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005531 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009645 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011072 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 48 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011110 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 65 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011340 | Combined Assembly of Wetland Metatranscriptomes | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
| 3300014158 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaG | Environmental | Open in IMG/M |
| 3300014160 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaG | Environmental | Open in IMG/M |
| 3300014161 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaG | Environmental | Open in IMG/M |
| 3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014167 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014491 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaG | Environmental | Open in IMG/M |
| 3300014492 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaG | Environmental | Open in IMG/M |
| 3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014496 | Permafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaG | Environmental | Open in IMG/M |
| 3300014658 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaG | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017988 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018016 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40 | Environmental | Open in IMG/M |
| 3300018020 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022881 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 20-24 | Environmental | Open in IMG/M |
| 3300023068 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 20-24 | Environmental | Open in IMG/M |
| 3300024295 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 1-5 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027625 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300028860 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_3 | Environmental | Open in IMG/M |
| 3300028874 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_1 | Environmental | Open in IMG/M |
| 3300029907 | I_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300029913 | III_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300029922 | III_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030294 | II_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Host-Associated | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Host-Associated | Open in IMG/M |
| 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Host-Associated | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2 | Environmental | Open in IMG/M |
| 3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033887 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-1-X1 | Environmental | Open in IMG/M |
| 3300033982 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB22AY SIP fraction | Environmental | Open in IMG/M |
| 3300033983 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB23AN SIP fraction | Environmental | Open in IMG/M |
| 3300034065 | Peat soil microbial communities from Stordalen Mire, Sweden - 714 S1 1-5 | Environmental | Open in IMG/M |
| 3300034127 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_05D_16 | Environmental | Open in IMG/M |
| 3300034268 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 | Environmental | Open in IMG/M |
| 3300034282 | Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0058894_14186982 | 3300004140 | Forest Soil | GDKARFHRERKSKLARRERSQALRKKITVRTPARPNGGQL* |
| Ga0062589_1017059761 | 3300004156 | Soil | MSALNGDKARFNRERKAKLARRERARVLRLKLAADSAKRPDGRDL* |
| Ga0068966_13810731 | 3300004476 | Peatlands Soil | GDKARFHRERKGKLARRERSQALRKKLIVRPPARPGGGDL* |
| Ga0058899_121475491 | 3300004631 | Forest Soil | GTMSAINGDKARFHRERKGKLARRERSQALRKKVTIATRTPARPSGAQL* |
| Ga0072331_11576272 | 3300004964 | Peatlands Soil | MSEFNGDKSRFHRERKSKLARRERSKVLRRKSSARTPARPNGGQL* |
| Ga0070683_1010221451 | 3300005329 | Corn Rhizosphere | MSGINGDKARFHRERKSKLARRERSQALRKKIEAHTPARPSGAQL* |
| Ga0070670_1019964631 | 3300005331 | Switchgrass Rhizosphere | MSAINGDKARFHRERKGKLARRERSQALRRELTAKAAERPASKPA* |
| Ga0070674_1016586751 | 3300005356 | Miscanthus Rhizosphere | MSALNGDKARFNRERKGKLARRERSQALRKKLKGHKPARATGTQL* |
| Ga0070738_100778953 | 3300005531 | Surface Soil | MSALNGDKARFNRERKGKLARRERSQALRKKLKSAAPPRANGTQL* |
| Ga0070734_106355192 | 3300005533 | Surface Soil | MSALNGDKARFNRERKGKLARRERSQILRKKMKSDAPARPTGAKL* |
| Ga0070735_108169791 | 3300005534 | Surface Soil | MSEINGDKARFHRERKSKLARRERNLALRKKLTAATPRRPDGRDL* |
| Ga0070731_108989852 | 3300005538 | Surface Soil | MSAINGDKARFNRVRKGKLARRERSQTLRKKPEGHPSPRPGTQL* |
| Ga0070733_105705251 | 3300005541 | Surface Soil | MSAINGDKARFNRVRKGKLARRERSQALRKKLEGNASPPPAVRL* |
| Ga0070672_1020111861 | 3300005543 | Miscanthus Rhizosphere | TYMSAINGDKARFHRERKAKLARRELSRAIRKKIAAGLPVKPTGANL* |
| Ga0070672_1020781602 | 3300005543 | Miscanthus Rhizosphere | MSAINGDKARFHRQRKAKLARRERSKELRKAAAAAAAKRPDGRDL* |
| Ga0066706_109260922 | 3300005598 | Soil | MSAINGDKARFHRQRKRKLALRERSQVLRKKVAAKAGGPPRPTGSQL* |
| Ga0066903_1011831583 | 3300005764 | Tropical Forest Soil | CYAWVTMSAINGDKARFHRERKSKLARRERSQALRKKLKASAPRRPDGRDL* |
| Ga0066903_1030420821 | 3300005764 | Tropical Forest Soil | WGTMSALNGDKARFNRERKRKLARREYSQALRKKLKGHRPPRATGTQL* |
| Ga0068860_1006102052 | 3300005843 | Switchgrass Rhizosphere | MSALNGDKARFNRQRKGKLARRERSQVLRKKMKSYSPARASGSQL* |
| Ga0070717_104173862 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MSGINGDKARFHRQRKSKLARREASQALRKKLASDATPRKPDGRDL* |
| Ga0075029_1000504133 | 3300006052 | Watersheds | MSALNGDKARFHRERKSKLARRERSQALRKKITVGTRPPARPSGAQL* |
| Ga0070765_1020900822 | 3300006176 | Soil | MSAINGDKARFHRERKGKLARRERSQALRKKLISPRGPVRPSGAQL* |
| Ga0079222_102778982 | 3300006755 | Agricultural Soil | MSALNGDKARFNRERKSKLARRERSQVLRKKLKGGALPRATGTQL* |
| Ga0075428_1022982972 | 3300006844 | Populus Rhizosphere | MSALNGDKARFHRERKSKLARRERSQVLRKKLAAPAPKRPDGRDL* |
| Ga0075428_1024667251 | 3300006844 | Populus Rhizosphere | ESLMSAINGDKARDHRKRKAKLAARERIRALRLKLAEAAATKKS* |
| Ga0073928_111897751 | 3300006893 | Iron-Sulfur Acid Spring | MSAFNGDKARFHRERKSKLARRERSRVLRAKITVRPVRPGGGQL* |
| Ga0111539_132434262 | 3300009094 | Populus Rhizosphere | MSAINGDKARYNRIRKARLAQRERTKAMRLKFAAEAAKRPDAANQ* |
| Ga0105245_131613411 | 3300009098 | Miscanthus Rhizosphere | MSAINGDKARFNRIRKARLARKERNLEMRKKLAESAAAKRPDGRDL* |
| Ga0116222_13175831 | 3300009521 | Peatlands Soil | MSAFNGDKARFHRERKSKLARRVRSQVLRKKIAVQAPLRPGGGQL* |
| Ga0116106_10735532 | 3300009645 | Peatland | MSAFNGDKARFHRERKGKLARRERSRVLRKKLTAQPPARPNGGQL* |
| Ga0116135_14858281 | 3300009665 | Peatland | MSAINGDKARFNRERKGKLARRERSQAIRKKLALGSAPAKPTGAQL* |
| Ga0116134_10231602 | 3300009764 | Peatland | MSAINGDKARFNRQRKGKLARRERSKAIREKLAPAGPVKPTGAQL* |
| Ga0116223_106824252 | 3300009839 | Peatlands Soil | MSAINGDKARFHRIRKGKLARRERSQALRRKLNLSSIKPPTGADL* |
| Ga0136449_10000050114 | 3300010379 | Peatlands Soil | MSAINGDKARFHRIRKKKLALRERSQLLRKKTAASLVPPAGAPVTPAVS* |
| Ga0136449_1020489291 | 3300010379 | Peatlands Soil | HRERKSKLARRERSQVLRKKMTAQPTSRPNGGQL* |
| Ga0136449_1029203242 | 3300010379 | Peatlands Soil | MSAINGDKARFHRIRKGKLARRERSQALRKKLNLSSIKPPTGADL* |
| Ga0136449_1045860321 | 3300010379 | Peatlands Soil | MSAFNGDKARFHRERKGKLARRERSRVLRKKIAAGTPKGPTGAQL* |
| Ga0138563_10129991 | 3300011072 | Peatlands Soil | NGDKARFHRERKGKLARRERSQALRKKLIVRPPARPGGGDL* |
| Ga0138578_10170192 | 3300011110 | Peatlands Soil | MSEFNGDKSRFHRERKSKLARRERSKVLRRKSSARTPAR |
| Ga0150983_100983562 | 3300011120 | Forest Soil | MSAINGDKARFHRERKGKLARRERSQALRKKVTIATRTPALPSGAQL* |
| Ga0150983_103148342 | 3300011120 | Forest Soil | GDKARFHRERKSKLARRERSQALRKKLTVRLPVRPGGGDL* |
| Ga0151652_137416793 | 3300011340 | Wetland | DKARFHRERKGKLARRERSRALRKEFAASAAKRPEGAA* |
| Ga0150985_1014570291 | 3300012212 | Avena Fatua Rhizosphere | MSAINGDKARFHRERKGKLARRERSLALRKKLKIHTPQRPTGAAL* |
| Ga0150985_1075714301 | 3300012212 | Avena Fatua Rhizosphere | INGDKARFHRQRKAKLARRERSKELRKAAAAAAAKRPNGGDL* |
| Ga0150985_1086430631 | 3300012212 | Avena Fatua Rhizosphere | GDKARYNRIRKARLAQRERMKELRLKLAATAAKRPDGRDL* |
| Ga0150985_1094427111 | 3300012212 | Avena Fatua Rhizosphere | GDKARFHRIRKARLARRELSQALRKKLAESKPRRPDGRDL* |
| Ga0150985_1153891021 | 3300012212 | Avena Fatua Rhizosphere | INGDKARFHRERKGKLARRERSKELRRKLADAAAKPAEAPKP* |
| Ga0150985_1157423691 | 3300012212 | Avena Fatua Rhizosphere | GDKARFHRQRKAKLARRERSQELRKAAAAAASKRPNGGNL* |
| Ga0150985_1211415211 | 3300012212 | Avena Fatua Rhizosphere | ARFHRERKGKLARRERSQALRKKLKGHTPPRATGTQL* |
| Ga0137375_105338492 | 3300012360 | Vadose Zone Soil | MSQLNGDKARFHRERKSKLARRERSQALRKKAATRSPLRPTGRQL* |
| Ga0137360_105254362 | 3300012361 | Vadose Zone Soil | IMSAINGDKARFHRERKGKLARRELSRSLRKKVAGGTPQRPSGRSL* |
| Ga0150984_1004807091 | 3300012469 | Avena Fatua Rhizosphere | NGDKARYNRIRKARLAQRERMKELRLKLAATAAKRPDGRDL* |
| Ga0150984_1010205151 | 3300012469 | Avena Fatua Rhizosphere | INGDKARFHRERKGKLARRERSKELRKKLAEAAAKPAEAPKA* |
| Ga0150984_1071437911 | 3300012469 | Avena Fatua Rhizosphere | NGDKARFHRERKAKLARRERSQELRKAAAAAAAKRPNGGDL* |
| Ga0150984_1123820931 | 3300012469 | Avena Fatua Rhizosphere | INGDKARFHRQRKAKLARRERSKELRKAAAAAAKRPNGGDL* |
| Ga0150984_1205623361 | 3300012469 | Avena Fatua Rhizosphere | INGDKARFHRERKGKLARRERSLALRKKLKIHTPQGPTGAAL* |
| Ga0157374_104692902 | 3300013296 | Miscanthus Rhizosphere | MSAINGDKARFHRIRKARLARKERNLEMRKKLAESAAAKRPDGRDL* |
| Ga0157374_117343321 | 3300013296 | Miscanthus Rhizosphere | MSAINGDKARFHRERKRKLERRELSRAIRKKIAAGLPVKPTGANL* |
| Ga0163162_116590281 | 3300013306 | Switchgrass Rhizosphere | MSALNGDKARFNRIRKSKLALRERSRALRLKLAAAAAKRPDGRDL* |
| Ga0181518_100231174 | 3300014156 | Bog | MSSLNGDKARFHRERKGKLARRERSQALRKKIANRTPARPSGAQL* |
| Ga0181518_101914912 | 3300014156 | Bog | MSAFNGDKARFHRERKGKLARRERSRALRKKIAAGAAPARPTGAQL* |
| Ga0181518_106122722 | 3300014156 | Bog | MSAINGDKARFHRERKGKLARRERSRVLRKKIADAATPKGPTGAQL* |
| Ga0181521_102698142 | 3300014158 | Bog | MSALNGDKARFHRQRKAKLARRESSQALRKKIAVRAAARPSGRDL* |
| Ga0181517_103855951 | 3300014160 | Bog | MSAINGDKARFHRIRKSKLALRERSREMRKKIEAAKIPAAPTGAQL* |
| Ga0181529_101593742 | 3300014161 | Bog | MSAFNGDKARFHRERKGKLARRERSRVLRKKIAAAGAPARPTGAQL* |
| Ga0181538_103481482 | 3300014162 | Bog | MSAFNGDKARFHRERKGKQARRERSRAIRKKLAAGNTPAKPTGAQL* |
| Ga0181523_102629572 | 3300014165 | Bog | MSAINGDKARFNRERKGKLARRERSKAIRQKLAPATPVKPTGAQL* |
| Ga0181523_104402543 | 3300014165 | Bog | MSALNGDKARFNRERKGKLARRELSRAIRKKLAPATPVKPTGAQL* |
| Ga0181523_107260312 | 3300014165 | Bog | MSGINGDKARFNRQRKGKLARRERSKAIREKLAPAGPVKPTGAQL* |
| Ga0181528_105416233 | 3300014167 | Bog | GQLCYPQGTMSAINGDKARFHRERKGKLARRELSRAIRKKLTAPGPAKPTGAQL* |
| Ga0181528_106562562 | 3300014167 | Bog | AINGDKARFHRERKGKLARRELSRAIRKKIALGSAPMKPTGAQL* |
| Ga0181526_101098612 | 3300014200 | Bog | MSAFNGDKARFHRERKGKQARRERSRAIRKKPAAGNTPAKPTGAQL* |
| Ga0157380_124956282 | 3300014326 | Switchgrass Rhizosphere | MSAINGDKARDHRKRKAKLAARERIRALRLKLAEAAAKKS* |
| Ga0182014_100627355 | 3300014491 | Bog | MSAINGDKARFHRERKGKLARRERSRAIRKKLAAGTVVKPTGAQL* |
| Ga0182014_102115072 | 3300014491 | Bog | MSAFNGDKARFHRERKGKLARRERSRAIRKKLAAGTPAKPTGAQL* |
| Ga0182013_100913581 | 3300014492 | Bog | MSAINGDKARFHRERKGKLARRERSREMRKNLKSPTPPKPTGAQL* |
| Ga0182013_101192961 | 3300014492 | Bog | MSAFTGDKARFNRERKGKLARRERSQAIRKKLAPAAPAKPTGAQL* |
| Ga0182016_101804422 | 3300014493 | Bog | MSASNGDKARFNRERKGKLARRERSQAIRKKLAPAAPAKPTGAQL* |
| Ga0182015_100211454 | 3300014495 | Palsa | MSAFNGDKARFHRERKSKLARRERSRVLREKIAARLPARPGGAQL* |
| Ga0182011_103731162 | 3300014496 | Fen | FTMSALNGDKARFHRQRKGKLARRERSQALRKKIAARAAARPTGRDL* |
| Ga0181519_109370852 | 3300014658 | Bog | MSAINGDKARFHRERKGKLARRERSKAIRAKLAPPAPVKPTGAQL* |
| Ga0182030_1001096512 | 3300014838 | Bog | MSAFTGDKARFHRERKAKLARRERSLAIRKKLAPSAPVKPTGAQL* |
| Ga0132258_131275532 | 3300015371 | Arabidopsis Rhizosphere | MSAINGDKARYNRIRKARLAQRERTKAIRLKLAAEAAKRPDGRDL* |
| Ga0132258_134352381 | 3300015371 | Arabidopsis Rhizosphere | MSALNGDKARFHRERKSKLARRERSQVLRKKLAAPAPRRPD |
| Ga0132257_1034465611 | 3300015373 | Arabidopsis Rhizosphere | MSALNGDKARFNRVRKAKLARRERVKALRLKIAANTAKRPDGRDL* |
| Ga0132255_1046004211 | 3300015374 | Arabidopsis Rhizosphere | MSGINGDKARFHRQRKAKLARRERSKELRKAAAAAAKRPNGGDL* |
| Ga0187879_105632651 | 3300017946 | Peatland | MSAFNGDKARFHRERKGKQARRERSRAIRKKLAAGNTPAKPTGAQL |
| Ga0181520_101626962 | 3300017988 | Bog | MSAINGDKARFHRERKGKLARRERSRVLRKKIADAAAPKGPTGAQL |
| Ga0181520_106289081 | 3300017988 | Bog | MSAFNGDKARFHRERKGKLARRERSRLLRKKAEPAVPVITVIPAPPTGAQL |
| Ga0181520_109845531 | 3300017988 | Bog | TLLRLGTMSAINGDKARFNRERKGKLARRERSKAIRKKLAPDTPAKPTGAQL |
| Ga0187816_104453531 | 3300017995 | Freshwater Sediment | MSAINGDKARFHRERKSKLARRERSQALRKKMTAPAATPRPNGGQL |
| Ga0187880_12019283 | 3300018016 | Peatland | MSAINGDKARFNRQRKGKLARRERSKAIRQKLAPATPVKPTGAQL |
| Ga0187861_104538352 | 3300018020 | Peatland | MSAINGDKARFNRQRKGKLARRERSKAIREKLAPAGPVKPTGAQL |
| Ga0187855_108872341 | 3300018038 | Peatland | MSAINGDKARFNRERKGKLARRERSQAIRKKLALGSAPAKPTGAQL |
| Ga0187871_101152542 | 3300018042 | Peatland | MSAFNGDKARFHRERKSKLARRERSRVLRAKITAQTPVRPGGAQL |
| Ga0187887_101835662 | 3300018043 | Peatland | MSALNGDKARFHRERKGKLARRERSKEIRKRLAPATPVKPTGAQL |
| Ga0187890_107747962 | 3300018044 | Peatland | MSALNGDKARFNRERKGKLARRELSRAIRKKLAPATPVKPTGAQL |
| Ga0187859_104259911 | 3300018047 | Peatland | MSAFNGDKARFHRERKSKLARRERSRVLRAKITAQTP |
| Ga0187859_108894902 | 3300018047 | Peatland | MSALNGDKARFNRERKGKLARRERSKAIRKKLAPDTPAKPTGAQL |
| Ga0187858_106231832 | 3300018057 | Peatland | DPGFCYAWVTMSAINGDKARFHRERKGKLARRERSRTLRNKLTAPAAKRPDGRDL |
| Ga0184625_104609611 | 3300018081 | Groundwater Sediment | MSAINGDKARFHRERKSKLARRERSQALRKKLLTPAPKRPTGGDL |
| Ga0184628_104100672 | 3300018083 | Groundwater Sediment | MSAINGDKARYNRIRKARLAQRERMRALRLKLAAEAAKRPDGRDL |
| Ga0066667_110707141 | 3300018433 | Grasslands Soil | MSGINGDKARFHRQRKAKLARRERSKELRKAAAAAAKRPNGGDL |
| Ga0210398_104697152 | 3300021477 | Soil | MSAINGDKARFNRERKGKLARRERSKAIRQKLAPATPPKPTGAQL |
| Ga0210402_110189532 | 3300021478 | Soil | MSAINGDKARFHRERKKKLALRERSQALRKGKLTTVSPRRPGGRDL |
| Ga0210402_112305991 | 3300021478 | Soil | SQVTMSAFNGDKARFHRERKSKLARRERSQALRKKITSRTPARPGGGQL |
| Ga0126371_112745982 | 3300021560 | Tropical Forest Soil | MSAINGDKARFHRRRKNALARRERAQKLLKKLKGEAAPAPTGAKL |
| Ga0213853_106589582 | 3300021861 | Watersheds | MSALNGDKARFHRERKSKLARRERSQALRKKITVGTRPPARPSGAQL |
| Ga0224545_10214293 | 3300022881 | Soil | MSAINGDKARFHRERKGKLARRERSRALRKKIAAAPVRPTGAQL |
| Ga0224554_11251252 | 3300023068 | Soil | MSAFNGDKARFHRERKGKLARRERSRVLRKKMAAAPVRPTGAQL |
| Ga0224556_10333972 | 3300024295 | Soil | MSAINGDKARFNRERKGKLARRERSKAIRQKLAPATPVKPTGAQL |
| Ga0207692_105311671 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | KANMSALNGDKARFHRERKAKLARRERSQTLRKTLSPKSGKRPRGRDL |
| Ga0207695_100913862 | 3300025913 | Corn Rhizosphere | MSGINGDKARFHRQRKSKLARRERSQEMRKALTVQAPEASKPPAK |
| Ga0207652_114070192 | 3300025921 | Corn Rhizosphere | MSAINGDKARFHRERKAKLARRERSRLLRKKLLPEGPKRPGGGDL |
| Ga0207689_115650022 | 3300025942 | Miscanthus Rhizosphere | MSAINGDKARFHRERKGKLARRERSQALRRELTAKAAERPASKPA |
| Ga0207668_113809992 | 3300025972 | Switchgrass Rhizosphere | KARFHRERKSKLARRERSQVLRKMLTAPVPRRPDGRDL |
| Ga0208324_11553231 | 3300027604 | Peatlands Soil | MSAFNGDKARFHRERKSKLARRVRSQVLRKKIAVQAPLRPGGGQL |
| Ga0208044_10046425 | 3300027625 | Peatlands Soil | MSEFNGDKSRFHRERKSKLARRERSKVLRRKSSARTPARPNGGQL |
| Ga0209517_103830102 | 3300027854 | Peatlands Soil | MSAINGDKARFHRIRKKKLALRERSQLLRKKTAASLVPPAGAPVTPAVS |
| Ga0209167_104892081 | 3300027867 | Surface Soil | MSAINGDKARFNRVRKGKLARRERSQALRKKLEGNASPPPAVRL |
| Ga0209415_100574201 | 3300027905 | Peatlands Soil | ETCYPQDTMSAINGDKARFHRERKSKLARRERSQALRKKLTAQPPARPNGGQL |
| Ga0209415_111269262 | 3300027905 | Peatlands Soil | ALNGDKARFHRERKAKLARRERSQALRKKIASTRAPVRPSGAQL |
| Ga0268266_102321232 | 3300028379 | Switchgrass Rhizosphere | MSAINGDKARFHRERKSKLARRERSQALRKKMDARTPARPGGAQL |
| Ga0265338_103660822 | 3300028800 | Rhizosphere | MSAINGDKARFHRERKGKLARRERSRLIRKKLKSGATPPVTGAQL |
| Ga0302199_12456672 | 3300028860 | Bog | TMSAINGDKARFHRERKGKLAHRERSRAIRKKLAAGTVVKPTGAQL |
| Ga0302155_102332112 | 3300028874 | Bog | RFHRERKGKLARRERSRAIRKKLAAGTVVKPTGAQL |
| Ga0311329_103656092 | 3300029907 | Bog | ARFHRERKGKLARRERSRAIRKKLAAGTVVKPTGAQL |
| Ga0311369_110208122 | 3300029910 | Palsa | CKLCYSQVAMSAFNGDKARFHRERKSKLARRERSRVLRAKITAQTPVRPGGAQL |
| Ga0311362_102958692 | 3300029913 | Bog | MSAINGDKARFHRERKGKLARRERSRLLRKKIVPAAAPVAPTGAQL |
| Ga0311363_105350862 | 3300029922 | Fen | MSAINGDKARFHRERKGKLARRERSRELRKNLKSPNPPKPTGAQL |
| Ga0311340_101403872 | 3300029943 | Palsa | MSAFNGDKARFHRERKSKLARRERSRVLREKIAARLPARPGGAQL |
| Ga0311352_106263573 | 3300029944 | Palsa | ARFNRERKGKLARRERSKEIRKKLAPATPVKPTGAQL |
| Ga0311339_112102501 | 3300029999 | Palsa | SAFNGDKARFHRERKSKLARRERSRVLREKIPVRPPARPGGAQL |
| Ga0311349_116772941 | 3300030294 | Fen | INGDKARYHRIRKGKLARRERSQALRKKLASHAPVRPGGAQL |
| Ga0311355_106765561 | 3300030580 | Palsa | MSAFNGDKARFHRERKSKLARRERSQALRKKIAARHPVRPGGGDL |
| Ga0302325_100778245 | 3300031234 | Palsa | MSGINGDKARFNRERKGKLARRERSKEIRKKLAPATPVKPTGAQL |
| Ga0265330_100791981 | 3300031235 | Rhizosphere | YSRITMSALNGDKARFHRQRKGKLARRERSQELRNQIAARAAVRPSGRDA |
| Ga0302324_1008906491 | 3300031236 | Palsa | INGDKARFHRERKSKLARRERSREIRKNLKSPTPPKPTGAQL |
| Ga0265331_100376582 | 3300031250 | Rhizosphere | MSASNGDKARFNRERKGKLARRERSQAIRKKLAPAAPAKPTGAQL |
| Ga0265316_100532702 | 3300031344 | Rhizosphere | MSALNGDKARFHRQRKGKLARRESSQALRKKLAARAVVRPPSGRDL |
| Ga0265316_101191543 | 3300031344 | Rhizosphere | MSALNGDKARFHRQRKGKLARRERSQELRNQIAARAAVRPSGRDA |
| Ga0302326_126906331 | 3300031525 | Palsa | MSAINGDKARFNREKKGKRARKERSRLLQKKIDALTPVVPVVAPV |
| Ga0310686_1102025432 | 3300031708 | Soil | MSGINGDKARFHRERKGKLARREKSREIRKKLVAATPAKPTGAQL |
| Ga0307476_111782202 | 3300031715 | Hardwood Forest Soil | MSAINGDKARFHRIRKKKLALRERSQELRKKANARSPVRPTGSQL |
| Ga0310813_114958482 | 3300031716 | Soil | MSALNGDKARFNRERKAKLARRERARVLRLKLAADSAKRPDGRDL |
| Ga0307477_105380853 | 3300031753 | Hardwood Forest Soil | MSAINGDKARFHRERKGKLARRERSQALRKKLKGITPPRPTGAQL |
| Ga0302319_110900502 | 3300031788 | Bog | MSAFNGDKARFHRERKGKLARRERSRVLRKKIAAAGAPARPTGAQL |
| Ga0302319_114921482 | 3300031788 | Bog | MSAFTGDKARFHRERKSKLARRERSREIRKNLKSQTPPKPTGAQL |
| Ga0302322_1030643272 | 3300031902 | Fen | MSAINGDKARFHRERKAKLARRELSRAMRKKIAAGQPVKPTGANL |
| Ga0308175_1000307594 | 3300031938 | Soil | MSAINGDKARFHRIRKARLARKERILEMRKKLAESAAAKRPDGRDL |
| Ga0308174_106930391 | 3300031939 | Soil | CYPWVTMSGINGDKARFHRQRKAKLARRERSKELRKAAAAVAAKRPNGGDL |
| Ga0306926_122460961 | 3300031954 | Soil | VAPPGFCYACVTVSAINGDKARFHRERKSKLARRERSQALRKKLKASAPRRPDGRDL |
| Ga0308176_107029441 | 3300031996 | Soil | MSGINGDKARFHRQRKAKLARRERSKELRKAIVAATAKRPNGRDL |
| Ga0308176_126611322 | 3300031996 | Soil | MSSINGDKARFHRQRKAKLARRERSQELRKAIAAAAAKRPNGGDL |
| Ga0308173_100292945 | 3300032074 | Soil | MSAINGDKARFHRERKSKLARRERSQALRKKIASRTPARPGGAQL |
| Ga0308173_108382851 | 3300032074 | Soil | MSGINGDKARFHRERKAKLARRERSQELRKAAAAAAAKRPNGGDL |
| Ga0308173_110205431 | 3300032074 | Soil | DKARFHRERKAKLARRERSKELRKATTATPATPKRPGGGDL |
| Ga0311301_102958852 | 3300032160 | Peatlands Soil | MHRARRQELCYPWGTMSAINGDKARFHRIRKGKLARRERSQALRRKLNLSSIKPPTGADL |
| Ga0311301_116482482 | 3300032160 | Peatlands Soil | MSAFNGDKARFHRERKGKLARRERSRLLRQKIAAATPKGPTGAQL |
| Ga0348332_118526271 | 3300032515 | Plant Litter | MSAINGDKARFHRERKGKLARRERSQALRKKLISPRAPVRPSGAQL |
| Ga0335082_108753031 | 3300032782 | Soil | ALNGDKARFNRERKSKLARRERSQVLRKKLKSPHSVPRPSGSQL |
| Ga0335078_100516913 | 3300032805 | Soil | MSAINGDKARFHRERKSKLARRERSQVLRKKMTAQPPARPNGGQL |
| Ga0335078_100680362 | 3300032805 | Soil | MSAINGDKARFHRERKSKLARRERSQALRKKLAPPAARRPDGRDL |
| Ga0335078_123556051 | 3300032805 | Soil | MSAINGDKARFHRERKSKLARRERSQALRKKLAAPAARRPDGRNL |
| Ga0335074_100264181 | 3300032895 | Soil | MSAINGDKARFHRERKAKLARRERSQALRKKLTVPGTPAAPTGAQL |
| Ga0335084_117264541 | 3300033004 | Soil | MSAINGDKARFNRERKGKLARRERSQALRKKLKVQTAARPTGAQL |
| Ga0335077_104313792 | 3300033158 | Soil | MSEFNGDKSRFHRERKSKLARRERSKVLRKKSNLRTPARPNGGQL |
| Ga0326728_100015625 | 3300033402 | Peat Soil | MSAINGDKARFNRERKGKLARRERSRAIRKKLAPETPVKPTGAQL |
| Ga0326728_100101036 | 3300033402 | Peat Soil | MSEINGDKARFHRQRKGRLARRERNQALRKKIAVRGAARPSGRDL |
| Ga0326728_110126472 | 3300033402 | Peat Soil | MSAINGDKARFHRERKGKLARRERSRTLRNKLTAPAAKRPDGRDL |
| Ga0316628_1023561032 | 3300033513 | Soil | MSALNGDKARFHRERKGKLARRERSQALRKKITTRAPARPGGAQL |
| Ga0334790_008195_878_1015 | 3300033887 | Soil | MSAFTGDKARFHRERKSKLARRERNRVLRAKIAVRTPVRPGGGQL |
| Ga0371487_0004831_9098_9235 | 3300033982 | Peat Soil | MSALNGDKARFHRQRKGKLARRERSQALRKKIAARAAARPSGRDL |
| Ga0371487_0283924_358_495 | 3300033982 | Peat Soil | MSALNGDKARFNRERKGKLARRERSLAIRKKLAPPAAIKPTGAQL |
| Ga0371488_0004023_8701_8838 | 3300033983 | Peat Soil | MSALNGDKARFHRQRKGKLARRERSQALRKKIALRTPARPSGAQL |
| Ga0334827_234594_423_539 | 3300034065 | Soil | MSASNGDKARFNRERKGKLARRERSQAIRKKLAPAAPAK |
| Ga0370489_0117025_209_346 | 3300034127 | Untreated Peat Soil | MSAINGDKARFHRIRKARLARKERFLEMRKKLTESATKRPDGRDL |
| Ga0372943_0053100_2080_2214 | 3300034268 | Soil | MSAINGDKARFHRERKKKLAMRERSQALRKKLANAPRRPDGRDL |
| Ga0370492_0198564_50_184 | 3300034282 | Untreated Peat Soil | MSASNGDKARFHRERKGKLARRERSRVLRKKLAAAPVVPTGAQL |
| ⦗Top⦘ |