NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F032636

Metagenome Family F032636

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F032636
Family Type Metagenome
Number of Sequences 179
Average Sequence Length 36 residues
Representative Sequence MAHLQLLESLMGRETDYRDRTIDDHIDDFEDISVI
Number of Associated Samples 127
Number of Associated Scaffolds 179

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Viruses
% of genes with valid RBS motifs 3.37 %
% of genes near scaffold ends (potentially truncated) 24.58 %
% of genes from short scaffolds (< 2000 bps) 86.03 %
Associated GOLD sequencing projects 121
AlphaFold2 3D model prediction Yes
3D model pTM-score0.17

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (81.564 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater
(29.050 % of family members)
Environment Ontology (ENVO) Unclassified
(66.480 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(45.251 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 22.22%    β-sheet: 0.00%    Coil/Unstructured: 77.78%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.17
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 179 Family Scaffolds
PF09250Prim-Pol 20.11
PF12850Metallophos_2 1.68
PF09723Zn-ribbon_8 1.68
PF05869Dam 1.12
PF03354TerL_ATPase 0.56
PF00149Metallophos 0.56

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 179 Family Scaffolds
COG4626Phage terminase-like protein, large subunit, contains N-terminal HTH domainMobilome: prophages, transposons [X] 0.56


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms85.47 %
UnclassifiedrootN/A14.53 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002294|B570J29584_1005515All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage849Open in IMG/M
3300002408|B570J29032_109108629All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage597Open in IMG/M
3300005527|Ga0068876_10005764All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage8517Open in IMG/M
3300005527|Ga0068876_10112719All Organisms → cellular organisms → Bacteria1617Open in IMG/M
3300005581|Ga0049081_10190726All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage738Open in IMG/M
3300005582|Ga0049080_10168761All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage729Open in IMG/M
3300005662|Ga0078894_10164181All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2001Open in IMG/M
3300005662|Ga0078894_11204459All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage641Open in IMG/M
3300005805|Ga0079957_1134544All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1283Open in IMG/M
3300006639|Ga0079301_1185659All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage602Open in IMG/M
3300006802|Ga0070749_10324879Not Available859Open in IMG/M
3300006802|Ga0070749_10354472All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage815Open in IMG/M
3300006802|Ga0070749_10664376All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage559Open in IMG/M
3300006805|Ga0075464_10077945All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1877Open in IMG/M
3300006805|Ga0075464_10208639All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1161Open in IMG/M
3300006805|Ga0075464_10625743All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage663Open in IMG/M
3300006805|Ga0075464_10951949All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage537Open in IMG/M
3300006805|Ga0075464_10985304All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage528Open in IMG/M
3300006805|Ga0075464_11024308All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage519Open in IMG/M
3300006920|Ga0070748_1145349All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage884Open in IMG/M
3300007540|Ga0099847_1128827All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage760Open in IMG/M
3300007559|Ga0102828_1012237All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1776Open in IMG/M
3300007973|Ga0105746_1343246All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage521Open in IMG/M
3300008114|Ga0114347_1261559All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage521Open in IMG/M
3300008119|Ga0114354_1276706All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage522Open in IMG/M
3300008266|Ga0114363_1040444All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1908Open in IMG/M
3300008266|Ga0114363_1162697All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage728Open in IMG/M
3300008266|Ga0114363_1240270All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage518Open in IMG/M
3300008450|Ga0114880_1083856All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1265Open in IMG/M
3300008450|Ga0114880_1245503All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage562Open in IMG/M
3300009026|Ga0102829_1144087All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage760Open in IMG/M
3300009051|Ga0102864_1133588All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage678Open in IMG/M
3300009111|Ga0115026_11658257All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage537Open in IMG/M
3300009146|Ga0105091_10200173All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage951Open in IMG/M
3300009152|Ga0114980_10087277All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1869Open in IMG/M
3300009164|Ga0114975_10507200All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage650Open in IMG/M
3300009169|Ga0105097_10317833All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage861Open in IMG/M
3300009169|Ga0105097_10642599All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage598Open in IMG/M
3300010354|Ga0129333_11186914All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage634Open in IMG/M
3300010885|Ga0133913_13504233All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1023Open in IMG/M
3300012663|Ga0157203_1049368Not Available571Open in IMG/M
3300013004|Ga0164293_10812063Not Available592Open in IMG/M
3300013006|Ga0164294_10266451All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1196Open in IMG/M
3300013014|Ga0164295_11307575All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage563Open in IMG/M
3300013295|Ga0170791_13422290Not Available879Open in IMG/M
3300013372|Ga0177922_10339644All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage622Open in IMG/M
3300013372|Ga0177922_10882443All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage873Open in IMG/M
3300013372|Ga0177922_11345082All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage918Open in IMG/M
3300017701|Ga0181364_1069450All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage540Open in IMG/M
3300017707|Ga0181363_1012710All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1713Open in IMG/M
3300017716|Ga0181350_1136043All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage581Open in IMG/M
3300017722|Ga0181347_1079817All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage956Open in IMG/M
3300017747|Ga0181352_1027387All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1734Open in IMG/M
3300017747|Ga0181352_1066543All Organisms → Viruses → Predicted Viral1024Open in IMG/M
3300017774|Ga0181358_1059439All Organisms → Viruses → Predicted Viral1429Open in IMG/M
3300017777|Ga0181357_1221045Not Available668Open in IMG/M
3300017780|Ga0181346_1206154All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage706Open in IMG/M
3300017784|Ga0181348_1114653All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1040Open in IMG/M
3300017785|Ga0181355_1097111Not Available1220Open in IMG/M
3300017785|Ga0181355_1309682Not Available590Open in IMG/M
3300018790|Ga0187842_1134158All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage739Open in IMG/M
3300018815|Ga0187845_1110237All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage915Open in IMG/M
3300019093|Ga0187843_10298230Not Available661Open in IMG/M
3300019784|Ga0181359_1005983All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4019Open in IMG/M
3300020151|Ga0211736_10556244All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1287Open in IMG/M
3300020159|Ga0211734_10677808All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage524Open in IMG/M
3300020161|Ga0211726_10818615All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1469Open in IMG/M
3300020172|Ga0211729_10471904All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3164Open in IMG/M
3300020501|Ga0208590_1017935All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage833Open in IMG/M
3300020527|Ga0208232_1000772All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage6149Open in IMG/M
3300020529|Ga0208233_1011402All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1269Open in IMG/M
3300020536|Ga0207939_1036768All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage626Open in IMG/M
3300020571|Ga0208723_1001843All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4644Open in IMG/M
3300020571|Ga0208723_1005811All Organisms → Viruses → Predicted Viral2280Open in IMG/M
3300020571|Ga0208723_1020073All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1043Open in IMG/M
3300021092|Ga0194122_10660983Not Available511Open in IMG/M
3300021956|Ga0213922_1041557All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1055Open in IMG/M
3300021962|Ga0222713_10160488All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1541Open in IMG/M
3300021963|Ga0222712_10012060All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage7708Open in IMG/M
3300022190|Ga0181354_1098251All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage955Open in IMG/M
3300022190|Ga0181354_1198338All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage599Open in IMG/M
3300022407|Ga0181351_1034799All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2137Open in IMG/M
3300025896|Ga0208916_10147744All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1009Open in IMG/M
3300027144|Ga0255102_1013991All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1487Open in IMG/M
3300027156|Ga0255078_1057757All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage771Open in IMG/M
3300027193|Ga0208800_1009888All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1212Open in IMG/M
3300027563|Ga0209552_1058575Not Available1080Open in IMG/M
3300027631|Ga0208133_1132783All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage576Open in IMG/M
3300027659|Ga0208975_1175500All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage585Open in IMG/M
3300027697|Ga0209033_1033264All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1967Open in IMG/M
3300027721|Ga0209492_1201705All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage683Open in IMG/M
3300027734|Ga0209087_1017553All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3553Open in IMG/M
3300027756|Ga0209444_10084120All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1339Open in IMG/M
3300027759|Ga0209296_1257340All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage714Open in IMG/M
3300027763|Ga0209088_10222766All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage796Open in IMG/M
3300027764|Ga0209134_10264150All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage588Open in IMG/M
3300027764|Ga0209134_10288853All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage558Open in IMG/M
3300027769|Ga0209770_10060583All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1595Open in IMG/M
3300027782|Ga0209500_10165708Not Available1026Open in IMG/M
3300027785|Ga0209246_10162443All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage877Open in IMG/M
3300027798|Ga0209353_10098686All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1319Open in IMG/M
3300027808|Ga0209354_10170551All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage886Open in IMG/M
3300027808|Ga0209354_10244819All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage721Open in IMG/M
3300027816|Ga0209990_10009709All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage6042Open in IMG/M
3300027816|Ga0209990_10043945All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2312Open in IMG/M
3300027956|Ga0209820_1119300All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage722Open in IMG/M
3300027969|Ga0209191_1076370All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1471Open in IMG/M
3300027974|Ga0209299_1320659All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage535Open in IMG/M
3300028025|Ga0247723_1011092All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3474Open in IMG/M
3300028025|Ga0247723_1021737All Organisms → cellular organisms → Bacteria2148Open in IMG/M
3300028025|Ga0247723_1048747All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1223Open in IMG/M
3300028027|Ga0247722_10326190Not Available521Open in IMG/M
3300031566|Ga0307378_10281488All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1583Open in IMG/M
3300031758|Ga0315907_10077730All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2865Open in IMG/M
3300031758|Ga0315907_10446453All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1034Open in IMG/M
3300031772|Ga0315288_10547651Not Available1129Open in IMG/M
3300031857|Ga0315909_10012511All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage8884Open in IMG/M
3300031857|Ga0315909_10280065All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1260Open in IMG/M
3300031873|Ga0315297_10826875Not Available772Open in IMG/M
3300031952|Ga0315294_10359000All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1379Open in IMG/M
3300031997|Ga0315278_10723612Not Available1011Open in IMG/M
3300031999|Ga0315274_10355895All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1718Open in IMG/M
3300032053|Ga0315284_11218915All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage825Open in IMG/M
3300032116|Ga0315903_10360340All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1201Open in IMG/M
3300032116|Ga0315903_10375720Not Available1167Open in IMG/M
3300032116|Ga0315903_11221744All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage505Open in IMG/M
3300032177|Ga0315276_11134365Not Available827Open in IMG/M
3300032401|Ga0315275_12176534Not Available581Open in IMG/M
3300033816|Ga0334980_0313821All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage606Open in IMG/M
3300033980|Ga0334981_0104648All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1399Open in IMG/M
3300033981|Ga0334982_0195830All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1002Open in IMG/M
3300033992|Ga0334992_0492631All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage532Open in IMG/M
3300033993|Ga0334994_0079971All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1961Open in IMG/M
3300033993|Ga0334994_0194806All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1101Open in IMG/M
3300033996|Ga0334979_0009056All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage6904Open in IMG/M
3300034019|Ga0334998_0156335All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1456Open in IMG/M
3300034019|Ga0334998_0364663Not Available839Open in IMG/M
3300034061|Ga0334987_0043859All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3774Open in IMG/M
3300034061|Ga0334987_0067917All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2864Open in IMG/M
3300034061|Ga0334987_0464067Not Available782Open in IMG/M
3300034061|Ga0334987_0762408All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage545Open in IMG/M
3300034061|Ga0334987_0792664Not Available529Open in IMG/M
3300034062|Ga0334995_0158852All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1621Open in IMG/M
3300034062|Ga0334995_0436760All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage807Open in IMG/M
3300034062|Ga0334995_0592857All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage645Open in IMG/M
3300034071|Ga0335028_0001732All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage15704Open in IMG/M
3300034073|Ga0310130_0002611All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage8292Open in IMG/M
3300034082|Ga0335020_0012111All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5144Open in IMG/M
3300034092|Ga0335010_0191856All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1255Open in IMG/M
3300034092|Ga0335010_0217283All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1152Open in IMG/M
3300034092|Ga0335010_0236587All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1087Open in IMG/M
3300034092|Ga0335010_0251947All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1042Open in IMG/M
3300034092|Ga0335010_0613839All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage549Open in IMG/M
3300034092|Ga0335010_0685673Not Available506Open in IMG/M
3300034093|Ga0335012_0402199All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage669Open in IMG/M
3300034101|Ga0335027_0127362All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1901Open in IMG/M
3300034101|Ga0335027_0452034All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage818Open in IMG/M
3300034101|Ga0335027_0622801All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage653Open in IMG/M
3300034101|Ga0335027_0701629Not Available600Open in IMG/M
3300034101|Ga0335027_0842939All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage526Open in IMG/M
3300034102|Ga0335029_0629406All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage596Open in IMG/M
3300034103|Ga0335030_0352106All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage970Open in IMG/M
3300034104|Ga0335031_0647989All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage615Open in IMG/M
3300034104|Ga0335031_0719360All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage570Open in IMG/M
3300034106|Ga0335036_0084312All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2361Open in IMG/M
3300034106|Ga0335036_0313984Not Available1037Open in IMG/M
3300034106|Ga0335036_0330191All Organisms → Viruses → Predicted Viral1003Open in IMG/M
3300034111|Ga0335063_0457315All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage631Open in IMG/M
3300034112|Ga0335066_0152610All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1408Open in IMG/M
3300034112|Ga0335066_0230341All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1081Open in IMG/M
3300034117|Ga0335033_0413347Not Available663Open in IMG/M
3300034118|Ga0335053_0446038All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage775Open in IMG/M
3300034272|Ga0335049_0084198All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2329Open in IMG/M
3300034283|Ga0335007_0698670All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage568Open in IMG/M
3300034284|Ga0335013_0611155All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage635Open in IMG/M
3300034355|Ga0335039_0403810All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage701Open in IMG/M
3300034355|Ga0335039_0456195All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage647Open in IMG/M
3300034355|Ga0335039_0474538All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage631Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater29.05%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake17.88%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous6.70%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater6.15%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake5.03%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment4.47%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater3.91%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment3.35%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater3.35%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton2.79%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine2.23%
Deep Subsurface SedimentEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment2.23%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater1.12%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water1.12%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater1.68%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic1.68%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake1.68%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland0.56%
LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake0.56%
FreshwaterEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater0.56%
FreshwaterEnvironmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater0.56%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.56%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.56%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine0.56%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil0.56%
Deep SubsurfaceEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface0.56%
Fracking WaterEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water0.56%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002294Freshwater microbial communities from Lake Mendota, WI - 17MAY2012 deep hole epilimnionEnvironmentalOpen in IMG/M
3300002408Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)EnvironmentalOpen in IMG/M
3300005527Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaGEnvironmentalOpen in IMG/M
3300005581Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRFEnvironmentalOpen in IMG/M
3300005582Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRFEnvironmentalOpen in IMG/M
3300005662Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)EnvironmentalOpen in IMG/M
3300005805Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USAEnvironmentalOpen in IMG/M
3300006639Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11EnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006805Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNAEnvironmentalOpen in IMG/M
3300006920Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12EnvironmentalOpen in IMG/M
3300007540Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007559Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541EnvironmentalOpen in IMG/M
3300007973Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2umEnvironmentalOpen in IMG/M
3300008114Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NAEnvironmentalOpen in IMG/M
3300008119Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0110-C-NAEnvironmentalOpen in IMG/M
3300008266Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300008450Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigsEnvironmentalOpen in IMG/M
3300009026Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575EnvironmentalOpen in IMG/M
3300009051Estuarine microbial communities from the Columbia River estuary - metaG 1449B-02EnvironmentalOpen in IMG/M
3300009111Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1EnvironmentalOpen in IMG/M
3300009146Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015EnvironmentalOpen in IMG/M
3300009152Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaGEnvironmentalOpen in IMG/M
3300009164Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaGEnvironmentalOpen in IMG/M
3300009168Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009169Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015EnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300010885northern Canada Lakes Co-assemblyEnvironmentalOpen in IMG/M
3300012663Freshwater microbial communities from Indian River, Ontario, Canada - S50EnvironmentalOpen in IMG/M
3300013004Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaGEnvironmentalOpen in IMG/M
3300013006Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaGEnvironmentalOpen in IMG/M
3300013014Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES006 metaGEnvironmentalOpen in IMG/M
3300013295northern Canada Lakes metatranscriptome co-assemblyEnvironmentalOpen in IMG/M
3300013372Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPsEnvironmentalOpen in IMG/M
3300017701Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.NEnvironmentalOpen in IMG/M
3300017707Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.NEnvironmentalOpen in IMG/M
3300017716Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.DEnvironmentalOpen in IMG/M
3300017722Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.NEnvironmentalOpen in IMG/M
3300017747Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.NEnvironmentalOpen in IMG/M
3300017774Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017777Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.NEnvironmentalOpen in IMG/M
3300017780Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300017784Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.NEnvironmentalOpen in IMG/M
3300017785Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300018790Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_41EnvironmentalOpen in IMG/M
3300018815Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_68EnvironmentalOpen in IMG/M
3300019093Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_43EnvironmentalOpen in IMG/M
3300019784Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300020151Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1EnvironmentalOpen in IMG/M
3300020159Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1EnvironmentalOpen in IMG/M
3300020161Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1EnvironmentalOpen in IMG/M
3300020172Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1EnvironmentalOpen in IMG/M
3300020501Freshwater microbial communities from Lake Mendota, WI - 27SEP2009 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020527Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020529Freshwater microbial communities from Lake Mendota, WI - 07SEP2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020536Freshwater microbial communities from Lake Mendota, WI - 02JUN2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020571Freshwater microbial communities from Lake Mendota, WI - 31AUG2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300021092Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015021 Mahale Deep Cast 10mEnvironmentalOpen in IMG/M
3300021956Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MGEnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300021963Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657DEnvironmentalOpen in IMG/M
3300022190Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.NEnvironmentalOpen in IMG/M
3300022407Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300025896Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027144Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepA_0hEnvironmentalOpen in IMG/M
3300027156Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepA_8hEnvironmentalOpen in IMG/M
3300027193Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 (SPAdes)EnvironmentalOpen in IMG/M
3300027563Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (SPAdes)EnvironmentalOpen in IMG/M
3300027631Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes)EnvironmentalOpen in IMG/M
3300027659Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027697Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes)EnvironmentalOpen in IMG/M
3300027721Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027734Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027756Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes)EnvironmentalOpen in IMG/M
3300027759Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027763Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027764Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027769Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes)EnvironmentalOpen in IMG/M
3300027782Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027785Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027798Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes)EnvironmentalOpen in IMG/M
3300027808Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes)EnvironmentalOpen in IMG/M
3300027816Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027956Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027969Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027974Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300028025Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FCEnvironmentalOpen in IMG/M
3300028027Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 3H_FCEnvironmentalOpen in IMG/M
3300031566Soil microbial communities from Risofladan, Vaasa, Finland - UN-1EnvironmentalOpen in IMG/M
3300031758Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123EnvironmentalOpen in IMG/M
3300031772Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20EnvironmentalOpen in IMG/M
3300031857Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125EnvironmentalOpen in IMG/M
3300031873Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0EnvironmentalOpen in IMG/M
3300031952Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40EnvironmentalOpen in IMG/M
3300031997Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0EnvironmentalOpen in IMG/M
3300031999Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20EnvironmentalOpen in IMG/M
3300032053Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16EnvironmentalOpen in IMG/M
3300032116Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119EnvironmentalOpen in IMG/M
3300032177Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0EnvironmentalOpen in IMG/M
3300032401Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0EnvironmentalOpen in IMG/M
3300033816Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005EnvironmentalOpen in IMG/M
3300033980Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME09Aug2015-rr0007EnvironmentalOpen in IMG/M
3300033981Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011EnvironmentalOpen in IMG/M
3300033992Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035EnvironmentalOpen in IMG/M
3300033993Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037EnvironmentalOpen in IMG/M
3300033996Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004EnvironmentalOpen in IMG/M
3300034019Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049EnvironmentalOpen in IMG/M
3300034061Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028EnvironmentalOpen in IMG/M
3300034062Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045EnvironmentalOpen in IMG/M
3300034071Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110EnvironmentalOpen in IMG/M
3300034073Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XLEnvironmentalOpen in IMG/M
3300034082Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088EnvironmentalOpen in IMG/M
3300034092Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069EnvironmentalOpen in IMG/M
3300034093Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072EnvironmentalOpen in IMG/M
3300034101Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107EnvironmentalOpen in IMG/M
3300034102Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112EnvironmentalOpen in IMG/M
3300034103Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119EnvironmentalOpen in IMG/M
3300034104Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120EnvironmentalOpen in IMG/M
3300034106Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131EnvironmentalOpen in IMG/M
3300034111Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Oct2011-rr0186EnvironmentalOpen in IMG/M
3300034112Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191EnvironmentalOpen in IMG/M
3300034117Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124EnvironmentalOpen in IMG/M
3300034118Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165EnvironmentalOpen in IMG/M
3300034272Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156EnvironmentalOpen in IMG/M
3300034283Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061EnvironmentalOpen in IMG/M
3300034284Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075EnvironmentalOpen in IMG/M
3300034355Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Oct2015-rr0135EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
B570J29584_100551513300002294FreshwaterFQLTKMAVLQLLESLMGRETDYIDRTIDDHIDDIEDIGVI*
B570J29032_10910862933300002408FreshwaterSAMTALSDTIKGIMGRETDYQPRTIDDHIDDFEDISVI*
Ga0068876_1000576483300005527Freshwater LakeMAHLQLLESLMGRETDYRDRTIDDHIDDFEDISVI*
Ga0068876_1011271943300005527Freshwater LakeMAVSQLLESLMGRETDYHERTIDDHIDDFEDISVI*
Ga0049081_1019072623300005581Freshwater LenticMAHSQLLESRMGLETDYRDRTIDDHIDQFEALGVI*
Ga0049080_1016876123300005582Freshwater LenticMAVSQLLESRMGLETDYKHRTIDDHIDDLEDIGVI*
Ga0078894_1016418113300005662Freshwater LakeMAHSQLLESRMGLETDYRDRTIDDHIDEFEDLGVI*
Ga0078894_1120445923300005662Freshwater LakeMAHSQLLESRMGRETDYIDRTIDDHIDELEDLGVI*
Ga0079957_113454433300005805LakeMTDHSPIIDGLMGLETDYHERTIDDHIDDFEDISVI*
Ga0079301_118565923300006639Deep SubsurfaceMAVSQLLESLMGLETDYHERTIDDHIDDFEDISVI*
Ga0070749_1032487933300006802AqueousMMGHLPTIEGLMGRETDYRDRTIDDHIDDFEDISVI*
Ga0070749_1035447213300006802AqueousRSFRLIMTGHLPIIEGRMGLETDYRDRTIDDHIDEFEEIGVI*
Ga0070749_1066437613300006802AqueousMAALHITGNPMGRETDYHERTIDDHIDDFEDLSVI*
Ga0075464_1007794563300006805AqueousMTDHLPIIDGLMGRETDYIDRTIDDHIDDVEDIGVI*
Ga0075464_1020863953300006805AqueousLRLFQSTKMDHLQLLESRMECETDYQPRTIDDHIDAVEALGFI*
Ga0075464_1062574313300006805AqueousMAVSQLLESLMGRETDYIERTIDTHIDEFEDLGVI*
Ga0075464_1095194913300006805AqueousAHSATISVLMGLETDYRDRSIDDHIDEFEDIGVI*
Ga0075464_1098530413300006805AqueousMAHLPRLEGRMGLETDYRDRTIDDHIDEFEDLGVI*
Ga0075464_1102430813300006805AqueousTKMEVLQLLESLMECETDYIPRTIDDHIDTVEGFGFI*
Ga0070748_114534933300006920AqueousMAHLQLLESLMGRETDYQPRTIDDHIDDFEDISVI*
Ga0099847_112882733300007540AqueousMTDHLPTIEGLMGLETDYRDRTIDDHIDDLEDLGVI*
Ga0102828_101223713300007559EstuarineMGHLPTTEGLMGLETDYKHRTIDDHIDDLEDISVI*
Ga0105746_134324613300007973Estuary WaterMTDHSDIIKGTMGRETDYNDRTIDDHIDELEDLGVI*
Ga0114347_126155923300008114Freshwater, PlanktonMAALLIIGNLMGHETDYHTRTIDDHIDDLEDLGVI*
Ga0114354_127670623300008119Freshwater, PlanktonMTDHLPIIDGLMGLETDYRDRTIDDHIDDLEDLGVI*
Ga0114363_104044413300008266Freshwater, PlanktonMAALLIIGSLMGRETDYHERTIDDHIDNFEDLGVI*
Ga0114363_116269713300008266Freshwater, PlanktonDHSPIIDGLMGLETDYHERTIDDHIDDFEDISVI*
Ga0114363_124027033300008266Freshwater, PlanktonMAALPITGNPMGRETDYHERTIDDHIDDLEDLSVI*
Ga0114880_108385653300008450Freshwater LakeVHSDTIKGLMGRETDYQPRTIDDHIDDFEDLFVI*
Ga0114880_124550333300008450Freshwater LakeAVSQLLESLMGRETDYHDRTIDDHIDELEDIGVI*
Ga0102829_114408723300009026EstuarineMAVSQLLESRMGLETDYRDRTIDDHIDDFEDISVI*
Ga0102864_113358823300009051EstuarineMDHLPTIEGLMGLETDYKHRTIDDHIDDLEDIGVI*
Ga0115026_1165825713300009111WetlandMTDLSDTIKGIMGRETDYQPRTIDTHIDEFEDLGVI*
Ga0105091_1020017343300009146Freshwater SedimentMMAHLHIIEGLMGRETDYRDRTIDEHIDDFEDISVISSL*
Ga0114980_1008727713300009152Freshwater LakeRLFQSTKMDHLQLLESPMECETDYQPRTIDDHIDAFEALSVI*
Ga0114975_1050720013300009164Freshwater LakeMAVLQLLESLMGRETDYIDRTIDDHIDDVEDIGVI*
Ga0105104_1032629413300009168Freshwater SedimentSQLTKMAALPIIGSPMGRETDYHERTIDDHIDDFEDLFVI*
Ga0105097_1031783313300009169Freshwater SedimentIKMAHLQLLESLMGRETDFRDRTIDDHIDDFEDISVI*
Ga0105097_1064259913300009169Freshwater SedimentMTDHSDLIKGIMGRETDYIDRTIDDHIDELEDLGVI*
Ga0129333_1118691413300010354Freshwater To Marine Saline GradientQLTKMGHLQLLESLMGRETDYRDRTIDDHIDDFEDISVI*
Ga0133913_1350423343300010885Freshwater LakeTDHSDTIKGIMGRETDYIERTIDTHIDEFEDLSVI*
Ga0157203_104936823300012663FreshwaterMDHLLTTEGLMGLETDYKHRTIDDHIDDVEDIGVI*
Ga0164293_1081206323300013004FreshwaterMMAVSHTTEGLMGLETDYRDRSIDDHIDEFEDIGVI*
Ga0164294_1026645143300013006FreshwaterMDHLLTTEGLMGLETDYKHRTIDEHIDDLEDIGVI*
Ga0164295_1130757533300013014FreshwaterMGHLLTTERLMGLETDYKHRTIDEHIDDLEDIGVI*
Ga0170791_1342229013300013295FreshwaterMGHLHTTEGLMGLETDYKHRTIDDHIDDFEDISVI*
Ga0177922_1033964413300013372FreshwaterFQSIKMAVSQLLESRMGLETDYKHRTIDDHIDEFEDIGVI*
Ga0177922_1088244333300013372FreshwaterAHSATISVLMGLETDYRDRSIDDHIDEFEDINVI*
Ga0177922_1134508213300013372FreshwaterKMAVSQLLESRMGLETDYKHRTIDDHIDDLEDIGVI*
Ga0181364_106945023300017701Freshwater LakeMMGHSATISVLMGRETDYIERTIDTHIDEFEDLGVI
Ga0181363_101271063300017707Freshwater LakeMGHSQHLEGRMGLETDYRDRTIDDHIDELEEIGVI
Ga0181350_113604313300017716Freshwater LakeMGHLHTTEGLMGLETDYKHRTIDDHIDDFEDISVI
Ga0181347_107981713300017722Freshwater LakeMTDHLDTIKGLMGRETDYIDRTIDDHIDDVEDLGVI
Ga0181352_102738723300017747Freshwater LakeMGHSQHLEGRMGLETDYRDRTIDDHIDEFEEIGVI
Ga0181352_106654333300017747Freshwater LakeMTDHLPIIDGLMGRETDYIDRTIDEHIDDIEDLGVI
Ga0181358_105943933300017774Freshwater LakeMVHLPITEGLMGFETDYKHRTIDDHIDDFEDIGVI
Ga0181357_122104523300017777Freshwater LakeMAVLHTTEGLMGLETDYRDRSIDDHIDKFEDIGVI
Ga0181346_120615433300017780Freshwater LakeMVHLQLLESLMGRETDYIDRTIDDHIDDLEDIGVI
Ga0181348_111465313300017784Freshwater LakeIMTDHSDTTKGIMGRETDYHERTIDDHIDDLEDIGVI
Ga0181355_109711133300017785Freshwater LakeMMVHSATISVLMGLETDYRDRSIDDHIDEFEDIGVI
Ga0181355_130968223300017785Freshwater LakeLFRLTKMAVSQLLESRMGLETDYRDRSIDDHIDEFEDIGVI
Ga0187842_113415833300018790FreshwaterLFQSIKMEVLQLLESHMECETDYQPRTIDDHIDTVEALGFI
Ga0187845_111023723300018815FreshwaterMEVLQLLESHMECETDYQPRTIDDHIDAVEALGFI
Ga0187843_1029823013300019093FreshwaterIKMGHLPTTEGLMGLETDYKHRTIDDHIDDLEDIGVI
Ga0181359_100598333300019784Freshwater LakeMAVLQLSESLMGRETDYIDRTIDDHIDDVEDIGVI
Ga0211736_1055624423300020151FreshwaterMAHSATISVLMGLETDYRDRSIDDHIDEFEDIGVI
Ga0211734_1067780833300020159FreshwaterMMVHSATISVLMGRETDYIERTIDTHIDEFEDLGVI
Ga0211726_1081861543300020161FreshwaterMMGLSDTTKGIMGLETDYRDRTIDDHIDQFEALGVI
Ga0211729_1047190413300020172FreshwaterQSIMTDHSDTIKGIMGRETDYIERTIDTHIDEFEDIGIL
Ga0208590_101793523300020501FreshwaterMTDHLPIIDGLMGLETDYHERTIDDHIDDFEDISVI
Ga0208232_100077223300020527FreshwaterMAVLQLLESLMGRETDYIDRTIDDHIDDIEDIGVI
Ga0208233_101140243300020529FreshwaterMTDHLHIIDGLMGLETDYHERTIDDHIDDFEDISVI
Ga0207939_103676823300020536FreshwaterMAVSQLLESLMGRETDYHDRTIDDHIDELEDLGVI
Ga0208723_100184383300020571FreshwaterMTAALDTTSGLMGLNTDYKDRTIDDHIDDFDAIGVL
Ga0208723_100581143300020571FreshwaterMAASLIIGSLMGRETDYHERTIDDHIDDFEDLFVI
Ga0208723_102007343300020571FreshwaterTDHSDLIKGTMGRETDYNDRTIDDHIDELEDLGVI
Ga0194122_1066098313300021092Freshwater LakeFQSIKMAVLLHVERVMGLETDYIDRTIDDHIDDLEDIGVI
Ga0213922_104155743300021956FreshwaterMMDRLPITEGHMGLETDYRDRTIDDHIDQFEDIGVI
Ga0222713_1016048853300021962Estuarine WaterIQLNLYQSAMMALFDTIKGIMGRETDYQPRTIDDHIDDFEDISVI
Ga0222712_1001206093300021963Estuarine WaterMAALLMAENPMGRETDYQPRTIDDHIDQVEDIGVI
Ga0181354_109825123300022190Freshwater LakeMMAVLHIIEGLMGFETDYRDRSIDDHIDDFEDIGVI
Ga0181354_119833813300022190Freshwater LakeMTDLFDLIKGIMGRETDYIERTIDTHIDEFEDLSVI
Ga0181351_103479963300022407Freshwater LakeMAVLQLLESLMGRETDYIDRTIDDHIDDVEDIGVI
Ga0208916_1014774443300025896AqueousQSTKMAHLQLLESRMECETDYQPRTIDDHIDAVEALGFI
Ga0255102_101399123300027144FreshwaterMAVSQLLESRMGLETDYKDRTIDDHIDELEDIGVI
Ga0255078_105775733300027156FreshwaterMAHLLTIDGLMGRETDYIDRTIDDHIDDVEDIGVI
Ga0208800_100988843300027193EstuarineMTDHLDTIKGIMGRETDYIDRTIDDHIDDLEDISVI
Ga0209552_105857513300027563Freshwater LakeMGHLPITEGLMGLETDYKHRTIDDHIDDLEDIGVI
Ga0208133_113278333300027631EstuarineMGHLQLLESRMECETDYQPRTIDDHIDAVEALGFI
Ga0208975_117550013300027659Freshwater LenticMAVSQLLESLMGRETDYIDRTIDDHIDDIEDIGVI
Ga0209033_103326423300027697Freshwater LakeMAVLQLLESLMGRETDYIERTIDTHIDEFEDLGVI
Ga0209492_120170523300027721Freshwater SedimentMAHLQLSESLMGRETDYRDRTIDDHIDDFEDISVI
Ga0209087_101755343300027734Freshwater LakeMAVSQLLESRMGLETDYRDRSIDDHIDEFEDIGVI
Ga0209444_1008412043300027756Freshwater LakeMGHLPTTEGLMGLETDYKHRTIDDHIDDFEDISVI
Ga0209296_125734033300027759Freshwater LakeKTAVSQLLESLMGRETDYIDRTIDDHIDDVEDIGVI
Ga0209088_1022276623300027763Freshwater LakeMAVLQLLESRMECETDYQPRTIDDHIDAVEALGFI
Ga0209134_1026415013300027764Freshwater LakePLLFQSIKMAVLQLLESLMGRETDYIDRTIDDHIDDVEDIGVI
Ga0209134_1028885333300027764Freshwater LakeLITMAHSATISVLMGLETDYRDRSIDDHIDEFEDIGVI
Ga0209770_1006058343300027769Freshwater LakeMAHSQLLESRMGLETDYRDRTIDDHIDEFEDLGVI
Ga0209500_1016570813300027782Freshwater LakeMMDHSATISVLMGRKTDYIERTIDTHIDEFEDLGVI
Ga0209246_1016244313300027785Freshwater LakeMDHLLTTEGLMGLETDYKHRTIDDHIDDLEDIGVI
Ga0209353_1009868633300027798Freshwater LakeMMVHSATISVPMGRETDYIDRTIDDHIDDVEDIGVI
Ga0209354_1017055113300027808Freshwater LakeLSIKMAVSQLLESRMGLETDYKHRTIDDHIDDFEDISVI
Ga0209354_1024481923300027808Freshwater LakeMMAVLHTTEGLMGLETDYRDRSIDDHIDEFEDIGVI
Ga0209990_10009709113300027816Freshwater LakeMAHLQLLESLMGRETDYRDRTIDDHIDDFEDISVI
Ga0209990_1004394543300027816Freshwater LakeMAVSQLLESLMGRETDYHERTIDDHIDDFEDISVI
Ga0209820_111930033300027956Freshwater SedimentMAHLQLLERVMGRETDYRDRTIDDHIDDFEDISVI
Ga0209191_107637053300027969Freshwater LakeIKMEVLQLLESLMECETDYQPRTIDDHIDAVEALGFI
Ga0209299_132065933300027974Freshwater LakeMEVSQLLESLMGRETDYIDRTIDDHIDDVEDLGVI
Ga0247723_101109253300028025Deep Subsurface SedimentMTDHLPIIDGLMGRETDYIDRTIDDHIDDVEDIGVI
Ga0247723_102173733300028025Deep Subsurface SedimentMMGHSAIISVLMGRETDYIERTIDTHIDEFEDLGVI
Ga0247723_104874723300028025Deep Subsurface SedimentMVHSQLLESRMGRETDYIDRTIDDHIDELEDLGVI
Ga0247722_1032619033300028027Deep Subsurface SedimentMAVLQLSESRMGLETDYRDRSIDDHIDEFEDIGVI
Ga0307378_1028148843300031566SoilMAALLIIGSLMGRETDYHERTIDDHIDDLEDLGVI
Ga0315907_1007773083300031758FreshwaterMAALPIIGSLMGLETDYKDRSIDDHIDDLEDLGVI
Ga0315907_1044645343300031758FreshwaterIVKFRLFLSRLTQMAALYLRVRSMGRETDYHERTIDDHIDDFEDISVI
Ga0315288_1054765123300031772SedimentMDHLPTTEGLMGLETDYRDRSIDDHIDEFEDIGVI
Ga0315909_10012511113300031857FreshwaterMAALLIIGSLMGRETDYHERTIDDHIDDLEDIGVI
Ga0315909_1028006553300031857FreshwaterMMVHSDTTKGLMGRETDYQPRTIDDHIDDFEDLFVI
Ga0315297_1082687533300031873SedimentMDHLPTTEGLMGLETDYKHRTIDDHIDDLEDIGVI
Ga0315294_1035900053300031952SedimentQLIKMGHLPTTEGLMGLETDYKHRTIDDHIDDLEDIGVI
Ga0315278_1072361233300031997SedimentMGHLPTTEGLMGLETDYKHRTIDDHIDDLEDIGVI
Ga0315274_1035589513300031999SedimentMGHLPIIEGLMGLETDYKHRTIDDHIDDFEDISVI
Ga0315284_1121891513300032053SedimentMGHLLTTEGLMGLETDYKHRTIDDHIDDFEDIGVI
Ga0315903_1036034023300032116FreshwaterMAHSQLLESLMGRETDYIDRTIDDHIDDVEDIGVI
Ga0315903_1037572013300032116FreshwaterMMGHSATISVLMGRETDYIDRTIDDHIDELEDLGVI
Ga0315903_1122174423300032116FreshwaterMTDHSDTIKGIMGRETDYNDRTIDDHIDELEDLGVI
Ga0315276_1113436533300032177SedimentMGHLPTIEGLMGLETDYKHRTIDDHIDDLEDIGVI
Ga0315275_1217653413300032401SedimentMVHLPTTEGLMGLETDYKHRTIDDHIDDFEDIGVI
Ga0334980_0313821_474_5813300033816FreshwaterMAVSQLLESLMGLETDYHERTIDDHIDDFEDISVI
Ga0334981_0104648_1240_13473300033980FreshwaterMAASPIIGSLMGRETDYHERTIDDHIDDFEDLFVI
Ga0334982_0195830_890_9973300033981FreshwaterMAVLQLLESRMGFETDYRDRSIDDHIDEFEDIGVI
Ga0334992_0492631_70_1773300033992FreshwaterMAVSQLLESRMGFETDYRDRSIDDHIDEFEDIGVI
Ga0334994_0079971_441_5483300033993FreshwaterMAHLQLLERVMGLETDYRVRTIDDHIDDFEDISVI
Ga0334994_0194806_308_4153300033993FreshwaterMAVSQLLESRMGFETDYKHRTIDDHIDDLEDIGVI
Ga0334979_0009056_2858_29683300033996FreshwaterMTDRSDTIKGIMGRETDYKDRTIDDHIDELEDLGVI
Ga0334998_0156335_290_3973300034019FreshwaterMAVLQLLESLMGRETDYIDRTIDDHIDDVEDLGVI
Ga0334998_0364663_713_8203300034019FreshwaterMAVSQLLESRMGLETDYKHRTIDDHIDDFENISVI
Ga0334987_0043859_2609_27193300034061FreshwaterMTDHLPIIDELMGLETDYLERTIDDHIDDIEDIGVI
Ga0334987_0067917_1795_19023300034061FreshwaterMAVSQLLESRMGLETDYKHRTIDDHIDEFEDIGVI
Ga0334987_0464067_202_3123300034061FreshwaterMMDHLPTIEGLMGLETDYRIRTIDDHIDDFEDIGVI
Ga0334987_0762408_385_4953300034061FreshwaterMTDHSDTIKGIMGRETDYIERTIDTHIDEFDDLSVI
Ga0334987_0792664_140_2503300034061FreshwaterMTDPSDTIKGIMGRETDYIDRTIDDHIDELEDLGVI
Ga0334995_0158852_968_10783300034062FreshwaterMTDHSDSIKGIMGRETDYIDRTIDDHIDELEDLGVI
Ga0334995_0436760_688_7953300034062FreshwaterMAVLQLLESLMGRETDYIDRTIDDHIDDLEDISVI
Ga0334995_0592857_305_4153300034062FreshwaterMTDHLPTIEGLMGLETDYRDRTIDDHIDDFEDLGVI
Ga0335028_0001732_15439_155463300034071FreshwaterMAVLQHLESRMGLETDYKHRTIDDHIDDFEDIGVI
Ga0310130_0002611_298_4083300034073Fracking WaterMMAHLHTIEGLMGRETDYRDRTIDDHIDDFEDISVI
Ga0335020_0012111_2750_28603300034082FreshwaterMMAVLHTIEGLMGLETDYRDRSIDDHIDEFENIGVI
Ga0335010_0191856_249_3563300034092FreshwaterMAHSQLLESRMGLETDYQPRTIDDHIDQFEALGVI
Ga0335010_0217283_438_5483300034092FreshwaterMTDHLPTIEGLMGRETDYRDRTIDDHIDDFEDIGVI
Ga0335010_0236587_630_7373300034092FreshwaterMAHSQLLESRMGRETDYIDRTIDDHIDELEDLGVI
Ga0335010_0251947_225_3353300034092FreshwaterMMAVLHTTEGLMGLETDYRDRSIDDHIDKFEDIGVI
Ga0335010_0613839_169_2763300034092FreshwaterMDHLQLLESRMGLETDYRDRTIDDHIDDLEDLGVI
Ga0335010_0685673_310_4203300034092FreshwaterMTDHSDTIKGIMGRETDYNDRTIDDHIDELEDLGVV
Ga0335012_0402199_62_1693300034093FreshwaterMAVSQLLESRMGLETDYKHRTIDDHIDDFEDIGVI
Ga0335027_0127362_1578_16853300034101FreshwaterMAVSQLLESLMECETEYQPRTIDDHIDAIEALGFI
Ga0335027_0452034_431_5383300034101FreshwaterMAHLQLSESLMGRETDFKDRTIDDHIDDFEDIGVI
Ga0335027_0622801_150_2603300034101FreshwaterMTDHLLIIDGLMGLETDYRDRTIDDHIDDLEDLGVI
Ga0335027_0701629_212_3223300034101FreshwaterMMDHLPTIEGLMGLETDYRVRTIDDHIDDFEDISVI
Ga0335027_0842939_374_4843300034101FreshwaterMTDHSDTIKGIMGRETDYNDRTIDDHIDKLEDLGVI
Ga0335029_0629406_478_5943300034102FreshwaterSIQTAQSPLLESRMGLETDYRDRTIDDHIDELEEIGVI
Ga0335030_0352106_511_6213300034103FreshwaterMTVHSPTIDGLMGLETDYHERTIDDHIDDFEDISVI
Ga0335031_0647989_506_6133300034104FreshwaterMAVLQLLESLMGRETDYHERTIDDHIDDFEDISVI
Ga0335031_0719360_246_3563300034104FreshwaterMTDHSGTIKGIMGRETDYIERTIDTHIDEFEDLSVI
Ga0335036_0084312_1385_14923300034106FreshwaterMAVLQLLESRMGLETDYKHRTIDDHIDDLEDIGVI
Ga0335036_0313984_836_9463300034106FreshwaterMTDRSDTIKGIMGRETDYNDRTIDDHIDELEDLGVI
Ga0335036_0330191_897_10013300034106FreshwaterMTDHLPIIDGLMGRETDYIDRTIDDHIDDVEDIGV
Ga0335063_0457315_393_5003300034111FreshwaterMAALPIIGSPMGRETDYHERTIDDHIDDFEDLFVI
Ga0335066_0152610_506_6133300034112FreshwaterMVVSQLLESLMGRETDYHDRTIDDHIDEFEDISVI
Ga0335066_0230341_112_2223300034112FreshwaterMMAVLHTTEGLMGLETDYRDRSIDDHIDEFEDISVI
Ga0335033_0413347_83_1903300034117FreshwaterMAVLQLLESRMGLETDYKHRTIDDHIDDFEDIGVI
Ga0335053_0446038_669_7733300034118FreshwaterMTDHSPIIDGLMGLETDYHERTIDDHIDDFEDISV
Ga0335049_0084198_1946_20563300034272FreshwaterMTDHSDIIKGIMGRETDYNDRTIDDHIDELEDLGVI
Ga0335007_0698670_424_5313300034283FreshwaterMAVLQLLESRMGLETDYRDRSIDDHIDEFEDIGVI
Ga0335013_0611155_77_1843300034284FreshwaterMAHLQLLESLMGRETDYIDRTIDDHIDELEDLGVI
Ga0335039_0403810_136_2433300034355FreshwaterMAASLIIGSLMGLETDYRDRTIDDHIDDLEDLGVI
Ga0335039_0456195_91_1983300034355FreshwaterMVHSQLLEGRMGLETDYRDRTIDDHIDEFEAIGVI
Ga0335039_0474538_10_1203300034355FreshwaterMTDHLPIIDGLMGLETDYRDRTIDDHIDDFEDISVI


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.