Basic Information | |
---|---|
Family ID | F032632 |
Family Type | Metagenome |
Number of Sequences | 179 |
Average Sequence Length | 47 residues |
Representative Sequence | MKHHKHFHYPEVKNARLTARAEAALDLLTALAIGISLAALLVAWWSA |
Number of Associated Samples | 123 |
Number of Associated Scaffolds | 179 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 10.61 % |
% of genes near scaffold ends (potentially truncated) | 16.20 % |
% of genes from short scaffolds (< 2000 bps) | 72.07 % |
Associated GOLD sequencing projects | 110 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.52 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (77.654 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (19.553 % of family members) |
Environment Ontology (ENVO) | Unclassified (62.011 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (53.631 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 49.33% β-sheet: 0.00% Coil/Unstructured: 50.67% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 179 Family Scaffolds |
---|---|---|
PF13479 | AAA_24 | 11.17 |
PF13481 | AAA_25 | 6.15 |
PF01381 | HTH_3 | 5.03 |
PF12844 | HTH_19 | 2.79 |
PF05037 | DUF669 | 2.23 |
PF04851 | ResIII | 1.68 |
PF10991 | DUF2815 | 1.68 |
PF00462 | Glutaredoxin | 1.68 |
PF12705 | PDDEXK_1 | 1.12 |
PF03237 | Terminase_6N | 1.12 |
PF02902 | Peptidase_C48 | 0.56 |
PF08291 | Peptidase_M15_3 | 0.56 |
PF15943 | YdaS_antitoxin | 0.56 |
PF11134 | Phage_stabilise | 0.56 |
PF00166 | Cpn10 | 0.56 |
PF00959 | Phage_lysozyme | 0.56 |
PF00145 | DNA_methylase | 0.56 |
PF07460 | NUMOD3 | 0.56 |
PF00583 | Acetyltransf_1 | 0.56 |
PF13392 | HNH_3 | 0.56 |
COG ID | Name | Functional Category | % Frequency in 179 Family Scaffolds |
---|---|---|---|
COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 0.56 |
COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 0.56 |
COG5160 | Protease, Ulp1 family | Posttranslational modification, protein turnover, chaperones [O] | 0.56 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 90.50 % |
Unclassified | root | N/A | 9.50 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002835|B570J40625_100464210 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1203 | Open in IMG/M |
3300002835|B570J40625_100959915 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 734 | Open in IMG/M |
3300002835|B570J40625_101089111 | Not Available | 676 | Open in IMG/M |
3300004126|Ga0066179_10075736 | Not Available | 828 | Open in IMG/M |
3300004151|Ga0066602_10233829 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 802 | Open in IMG/M |
3300004448|Ga0065861_1060036 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1608 | Open in IMG/M |
3300004448|Ga0065861_1119005 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2061 | Open in IMG/M |
3300004481|Ga0069718_16148759 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 537 | Open in IMG/M |
3300004693|Ga0065167_1066335 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 608 | Open in IMG/M |
3300004774|Ga0007794_10115525 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 801 | Open in IMG/M |
3300005527|Ga0068876_10086598 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1877 | Open in IMG/M |
3300005581|Ga0049081_10027385 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2164 | Open in IMG/M |
3300005581|Ga0049081_10105998 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1046 | Open in IMG/M |
3300005581|Ga0049081_10190486 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 738 | Open in IMG/M |
3300005582|Ga0049080_10076026 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1150 | Open in IMG/M |
3300005805|Ga0079957_1210584 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 930 | Open in IMG/M |
3300006641|Ga0075471_10224549 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 972 | Open in IMG/M |
3300006802|Ga0070749_10033790 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3172 | Open in IMG/M |
3300006805|Ga0075464_10006798 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5485 | Open in IMG/M |
3300006805|Ga0075464_10174618 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1270 | Open in IMG/M |
3300006805|Ga0075464_10365807 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 873 | Open in IMG/M |
3300006805|Ga0075464_10638646 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 656 | Open in IMG/M |
3300006805|Ga0075464_10643815 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 654 | Open in IMG/M |
3300006805|Ga0075464_10903109 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 552 | Open in IMG/M |
3300006805|Ga0075464_10933207 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 543 | Open in IMG/M |
3300006920|Ga0070748_1153784 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 855 | Open in IMG/M |
3300006920|Ga0070748_1356891 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 515 | Open in IMG/M |
3300007543|Ga0102853_1098254 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 549 | Open in IMG/M |
3300007559|Ga0102828_1071361 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 824 | Open in IMG/M |
3300007622|Ga0102863_1055279 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1160 | Open in IMG/M |
3300007734|Ga0104986_1737 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 27097 | Open in IMG/M |
3300007972|Ga0105745_1324447 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 507 | Open in IMG/M |
3300008107|Ga0114340_1215307 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 626 | Open in IMG/M |
3300008259|Ga0114841_1005702 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11312 | Open in IMG/M |
3300008263|Ga0114349_1067700 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1664 | Open in IMG/M |
3300008267|Ga0114364_1017851 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3845 | Open in IMG/M |
3300008448|Ga0114876_1036657 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2339 | Open in IMG/M |
3300008448|Ga0114876_1125809 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 975 | Open in IMG/M |
3300008448|Ga0114876_1273582 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 503 | Open in IMG/M |
3300009068|Ga0114973_10339312 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 795 | Open in IMG/M |
3300009085|Ga0105103_10554514 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 650 | Open in IMG/M |
3300009151|Ga0114962_10002049 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 17131 | Open in IMG/M |
3300009151|Ga0114962_10159701 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1347 | Open in IMG/M |
3300009151|Ga0114962_10249469 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1012 | Open in IMG/M |
3300009152|Ga0114980_10412668 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 773 | Open in IMG/M |
3300009158|Ga0114977_10039263 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2954 | Open in IMG/M |
3300009158|Ga0114977_10380741 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 789 | Open in IMG/M |
3300009158|Ga0114977_10564159 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 617 | Open in IMG/M |
3300009159|Ga0114978_10003510 | Not Available | 12814 | Open in IMG/M |
3300009159|Ga0114978_10309601 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 965 | Open in IMG/M |
3300009163|Ga0114970_10049687 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2713 | Open in IMG/M |
3300009164|Ga0114975_10037794 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2873 | Open in IMG/M |
3300009165|Ga0105102_10039892 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2019 | Open in IMG/M |
3300009180|Ga0114979_10146737 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1445 | Open in IMG/M |
3300009182|Ga0114959_10489274 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 594 | Open in IMG/M |
3300009419|Ga0114982_1050988 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1307 | Open in IMG/M |
3300009684|Ga0114958_10564328 | Not Available | 545 | Open in IMG/M |
3300010374|Ga0114986_1015457 | Not Available | 1474 | Open in IMG/M |
3300010885|Ga0133913_10792517 | All Organisms → cellular organisms → Bacteria | 2470 | Open in IMG/M |
3300010970|Ga0137575_10001332 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5028 | Open in IMG/M |
3300011010|Ga0139557_1061888 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 629 | Open in IMG/M |
3300011334|Ga0153697_1598 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10166 | Open in IMG/M |
3300011336|Ga0153703_1105 | Not Available | 30854 | Open in IMG/M |
3300012012|Ga0153799_1001446 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6811 | Open in IMG/M |
3300012012|Ga0153799_1013759 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1722 | Open in IMG/M |
3300012017|Ga0153801_1012403 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1540 | Open in IMG/M |
3300012666|Ga0157498_1041759 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 704 | Open in IMG/M |
3300013005|Ga0164292_10875578 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 565 | Open in IMG/M |
3300013372|Ga0177922_10545337 | Not Available | 595 | Open in IMG/M |
3300013372|Ga0177922_10948878 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 715 | Open in IMG/M |
3300013372|Ga0177922_11089846 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1000 | Open in IMG/M |
3300014811|Ga0119960_1014513 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 894 | Open in IMG/M |
3300014811|Ga0119960_1019836 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 848 | Open in IMG/M |
3300017722|Ga0181347_1045744 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1331 | Open in IMG/M |
3300017747|Ga0181352_1002347 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6974 | Open in IMG/M |
3300017747|Ga0181352_1112517 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 739 | Open in IMG/M |
3300017747|Ga0181352_1115923 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 725 | Open in IMG/M |
3300017754|Ga0181344_1066339 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1067 | Open in IMG/M |
3300017754|Ga0181344_1152306 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 659 | Open in IMG/M |
3300017754|Ga0181344_1159951 | Not Available | 641 | Open in IMG/M |
3300017754|Ga0181344_1207845 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 548 | Open in IMG/M |
3300017766|Ga0181343_1137451 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 683 | Open in IMG/M |
3300017774|Ga0181358_1156131 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 775 | Open in IMG/M |
3300017777|Ga0181357_1274471 | Not Available | 580 | Open in IMG/M |
3300017780|Ga0181346_1021281 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2722 | Open in IMG/M |
3300017784|Ga0181348_1211671 | Not Available | 689 | Open in IMG/M |
3300017784|Ga0181348_1301850 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 536 | Open in IMG/M |
3300019784|Ga0181359_1026155 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2237 | Open in IMG/M |
3300019784|Ga0181359_1125790 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 910 | Open in IMG/M |
3300019784|Ga0181359_1182458 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 692 | Open in IMG/M |
3300019784|Ga0181359_1191238 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 667 | Open in IMG/M |
3300020048|Ga0207193_1035158 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5644 | Open in IMG/M |
3300020048|Ga0207193_1069278 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3465 | Open in IMG/M |
3300020141|Ga0211732_1352195 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3748 | Open in IMG/M |
3300020151|Ga0211736_10297154 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 729 | Open in IMG/M |
3300020160|Ga0211733_11001804 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3595 | Open in IMG/M |
3300020162|Ga0211735_11139580 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 500 | Open in IMG/M |
3300020172|Ga0211729_11312395 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1413 | Open in IMG/M |
3300020205|Ga0211731_10562482 | Not Available | 590 | Open in IMG/M |
3300020565|Ga0208718_1038384 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 934 | Open in IMG/M |
3300021952|Ga0213921_1000110 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 32934 | Open in IMG/M |
3300021961|Ga0222714_10012718 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7036 | Open in IMG/M |
3300021963|Ga0222712_10175399 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1424 | Open in IMG/M |
3300022179|Ga0181353_1060628 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 978 | Open in IMG/M |
3300022407|Ga0181351_1021752 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2715 | Open in IMG/M |
3300022407|Ga0181351_1073822 | Not Available | 1375 | Open in IMG/M |
3300022407|Ga0181351_1221092 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 615 | Open in IMG/M |
3300023174|Ga0214921_10001706 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 36983 | Open in IMG/M |
3300023174|Ga0214921_10009005 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12740 | Open in IMG/M |
3300025595|Ga0208248_1047758 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 976 | Open in IMG/M |
3300025595|Ga0208248_1135278 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 542 | Open in IMG/M |
3300025889|Ga0208644_1284678 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 665 | Open in IMG/M |
3300025896|Ga0208916_10005409 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5060 | Open in IMG/M |
3300025896|Ga0208916_10017029 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2857 | Open in IMG/M |
3300025896|Ga0208916_10037724 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1959 | Open in IMG/M |
3300027214|Ga0208306_1065585 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 615 | Open in IMG/M |
3300027365|Ga0209300_1023740 | All Organisms → Viruses → Predicted Viral | 1314 | Open in IMG/M |
3300027365|Ga0209300_1046697 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 753 | Open in IMG/M |
3300027693|Ga0209704_1051092 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1130 | Open in IMG/M |
3300027708|Ga0209188_1018636 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3622 | Open in IMG/M |
3300027710|Ga0209599_10009662 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3007 | Open in IMG/M |
3300027710|Ga0209599_10220496 | Not Available | 515 | Open in IMG/M |
3300027712|Ga0209499_1010684 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4686 | Open in IMG/M |
3300027712|Ga0209499_1225389 | Not Available | 655 | Open in IMG/M |
3300027733|Ga0209297_1000355 | All Organisms → cellular organisms → Bacteria | 29915 | Open in IMG/M |
3300027734|Ga0209087_1001294 | All Organisms → cellular organisms → Bacteria | 14737 | Open in IMG/M |
3300027736|Ga0209190_1167670 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 934 | Open in IMG/M |
3300027747|Ga0209189_1156426 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 971 | Open in IMG/M |
3300027763|Ga0209088_10124524 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1160 | Open in IMG/M |
3300027782|Ga0209500_10001355 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 18461 | Open in IMG/M |
3300027782|Ga0209500_10224757 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 833 | Open in IMG/M |
3300027785|Ga0209246_10306518 | Not Available | 609 | Open in IMG/M |
3300027899|Ga0209668_10001890 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 9113 | Open in IMG/M |
3300027900|Ga0209253_10374281 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium RBG_13_42_15 | 1088 | Open in IMG/M |
3300027963|Ga0209400_1000483 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 34742 | Open in IMG/M |
3300028025|Ga0247723_1001328 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14681 | Open in IMG/M |
3300031707|Ga0315291_10547850 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1062 | Open in IMG/M |
3300031758|Ga0315907_10002117 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 25658 | Open in IMG/M |
3300031787|Ga0315900_10382946 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1119 | Open in IMG/M |
3300031857|Ga0315909_10202156 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1573 | Open in IMG/M |
3300031885|Ga0315285_10752257 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 619 | Open in IMG/M |
3300031999|Ga0315274_10121243 | All Organisms → Viruses → Predicted Viral | 3364 | Open in IMG/M |
3300031999|Ga0315274_10812291 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 989 | Open in IMG/M |
3300031999|Ga0315274_11853814 | Not Available | 550 | Open in IMG/M |
3300032093|Ga0315902_10422329 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1195 | Open in IMG/M |
3300032116|Ga0315903_10256894 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1505 | Open in IMG/M |
3300032118|Ga0315277_10016455 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9134 | Open in IMG/M |
3300033981|Ga0334982_0226347 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 911 | Open in IMG/M |
3300033993|Ga0334994_0118397 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1531 | Open in IMG/M |
3300033996|Ga0334979_0011967 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5938 | Open in IMG/M |
3300033996|Ga0334979_0304883 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 904 | Open in IMG/M |
3300033996|Ga0334979_0459969 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 694 | Open in IMG/M |
3300034012|Ga0334986_0006779 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8560 | Open in IMG/M |
3300034012|Ga0334986_0100717 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1732 | Open in IMG/M |
3300034012|Ga0334986_0222268 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1042 | Open in IMG/M |
3300034012|Ga0334986_0470728 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 623 | Open in IMG/M |
3300034020|Ga0335002_0238602 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1101 | Open in IMG/M |
3300034022|Ga0335005_0265077 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1036 | Open in IMG/M |
3300034061|Ga0334987_0070114 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2806 | Open in IMG/M |
3300034061|Ga0334987_0211835 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1353 | Open in IMG/M |
3300034061|Ga0334987_0741448 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 556 | Open in IMG/M |
3300034062|Ga0334995_0376927 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 897 | Open in IMG/M |
3300034062|Ga0334995_0569572 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 665 | Open in IMG/M |
3300034068|Ga0334990_0307915 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 861 | Open in IMG/M |
3300034082|Ga0335020_0492876 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 582 | Open in IMG/M |
3300034101|Ga0335027_0380922 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 922 | Open in IMG/M |
3300034104|Ga0335031_0041634 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3327 | Open in IMG/M |
3300034104|Ga0335031_0508870 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 730 | Open in IMG/M |
3300034106|Ga0335036_0274010 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1132 | Open in IMG/M |
3300034106|Ga0335036_0315418 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1033 | Open in IMG/M |
3300034110|Ga0335055_0107616 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1273 | Open in IMG/M |
3300034111|Ga0335063_0195659 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1141 | Open in IMG/M |
3300034119|Ga0335054_0167132 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1339 | Open in IMG/M |
3300034120|Ga0335056_0085270 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1971 | Open in IMG/M |
3300034120|Ga0335056_0479434 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 658 | Open in IMG/M |
3300034167|Ga0335017_0398661 | Not Available | 746 | Open in IMG/M |
3300034200|Ga0335065_0685429 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 587 | Open in IMG/M |
3300034272|Ga0335049_0528637 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 745 | Open in IMG/M |
3300034283|Ga0335007_0088346 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2318 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 19.55% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 15.08% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 13.97% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 8.38% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 7.26% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 3.35% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 3.35% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 2.79% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 2.23% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 2.23% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 2.23% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 2.23% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.23% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 1.12% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 1.12% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.12% |
Aquatic | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Aquatic | 1.12% |
Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 1.12% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.12% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.68% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.68% |
Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.56% |
Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.56% |
Freshwater, Surface Ice | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Surface Ice | 0.56% |
Freshwater | Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater | 0.56% |
Pond Fresh Water | Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water | 0.56% |
Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 0.56% |
Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.56% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.56% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.56% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300004126 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (version 2) | Environmental | Open in IMG/M |
3300004151 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - High cellulose week 5 | Environmental | Open in IMG/M |
3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
3300004693 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA7.5M (version 2) | Environmental | Open in IMG/M |
3300004774 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA5M | Environmental | Open in IMG/M |
3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
3300007543 | Estuarine microbial communities from the Columbia River estuary - metaG 1370B-3 | Environmental | Open in IMG/M |
3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
3300007622 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02 | Environmental | Open in IMG/M |
3300007734 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Jan | Environmental | Open in IMG/M |
3300007972 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0um | Environmental | Open in IMG/M |
3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
3300008263 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-53-LTR | Environmental | Open in IMG/M |
3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
3300009684 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG | Environmental | Open in IMG/M |
3300010374 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S-1-Day17 | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300010970 | Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV1, april 2016 | Environmental | Open in IMG/M |
3300011010 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice | Environmental | Open in IMG/M |
3300011334 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Daesung | Environmental | Open in IMG/M |
3300011336 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Paldang | Environmental | Open in IMG/M |
3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
3300012666 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Surface Ice version 2 | Environmental | Open in IMG/M |
3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300014811 | Aquatic viral communities from ballast water - Michigan State University - AB_ballast water | Environmental | Open in IMG/M |
3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
3300020565 | Freshwater microbial communities from Lake Mendota, WI - 29APR2009 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
3300021952 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17 MG | Environmental | Open in IMG/M |
3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
3300025595 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA5M (SPAdes) | Environmental | Open in IMG/M |
3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300027214 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02 (SPAdes) | Environmental | Open in IMG/M |
3300027365 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT (SPAdes) | Environmental | Open in IMG/M |
3300027693 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300027708 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
3300027712 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027747 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031885 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36 | Environmental | Open in IMG/M |
3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
3300032118 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15 | Environmental | Open in IMG/M |
3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
3300034020 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2015-rr0055 | Environmental | Open in IMG/M |
3300034022 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058 | Environmental | Open in IMG/M |
3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
3300034068 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Apr2016-rr0031 | Environmental | Open in IMG/M |
3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
3300034110 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Jun2009D10-rr0171 | Environmental | Open in IMG/M |
3300034111 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Oct2011-rr0186 | Environmental | Open in IMG/M |
3300034119 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Jul2015-rr0166 | Environmental | Open in IMG/M |
3300034120 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172 | Environmental | Open in IMG/M |
3300034167 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Apr2015-rr0082 | Environmental | Open in IMG/M |
3300034200 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190 | Environmental | Open in IMG/M |
3300034272 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156 | Environmental | Open in IMG/M |
3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
B570J40625_1004642102 | 3300002835 | Freshwater | MKHHKHYYYPEVKNARLTARAEAALDLLTALAIGISLAALLVAWWSA* |
B570J40625_1009599151 | 3300002835 | Freshwater | MKHSKHFYYPEIKNERINARADAALGFLLALAIGVGLAVLLVAWWSA* |
B570J40625_1010891112 | 3300002835 | Freshwater | MKHHKYHYHPQVKAAKLHARAQAALDLVLALAIGIGLAVLLVAWWSS* |
Ga0066179_100757362 | 3300004126 | Freshwater Lake | MKHHRHYHYPEVKNARLNARAEAALDLFTAFAIGISLAALLVAWWSA* |
Ga0066602_102338292 | 3300004151 | Freshwater | MKHSKYFHYPEVKNAKLNARGEAVIDLIVAIAIGVGMAVLLVAWWSA* |
Ga0065861_10600363 | 3300004448 | Marine | MKHSKYYHYPEVKNAKLNARAAAAIDLLVVLAIGVGMAVLLVAWWSS* |
Ga0065861_11190052 | 3300004448 | Marine | MKHSKYYHYPEVKNARINARAEAALDFILAFIIGASLAGLLIAWWSA* |
Ga0069718_161487592 | 3300004481 | Sediment | PRKHNMKHHKHYYYPEVKNARLTARAQAGLDLLTALAIGISLAALLVAWWSA* |
Ga0065167_10663352 | 3300004693 | Freshwater | MKHSKYYHYPEVKNAKLNARAEAALDFILAIIIGVCLAMLLVAWWSA* |
Ga0007794_101155252 | 3300004774 | Freshwater | MKHSKYYHYPEVKNARINARAEAALDFILALIIGASLAALLIAWWSA* |
Ga0068876_100865984 | 3300005527 | Freshwater Lake | MKHHKHYHYPEVKSARLTARAEAGLDLLTALAIGISLAALLVAWWSA* |
Ga0049081_100273854 | 3300005581 | Freshwater Lentic | MKHSKHFYYPEVKSARLTARAEAGLDLLTALAIGISLAALLVAWWSA* |
Ga0049081_101059983 | 3300005581 | Freshwater Lentic | MKHHKHFHYPEVKNARLTARADAALDLLTALAIGISLAALLVAWWSA* |
Ga0049081_101904862 | 3300005581 | Freshwater Lentic | MKHHRHYHYPEVKNARLTARADAALDLLTALAIGISLAALLVAWWSA* |
Ga0049080_100760262 | 3300005582 | Freshwater Lentic | MKHHKHFHYPEVKNARLTARAEAALDLLTALAIGISLAALLVAWWSA* |
Ga0079957_12105841 | 3300005805 | Lake | KHNMKHSKYFHYPEVKNAKLNARGEAVIDFIVAIAIGVGMAVLLVAWWSA* |
Ga0075471_102245494 | 3300006641 | Aqueous | MKYHNHFQYPEVKNAKLNARTEAAMGLLLAIAIGVGMACLLVAWWSA* |
Ga0070749_100337905 | 3300006802 | Aqueous | MKHSKYFHYPEVKNAKLNARGEAVLDLILAIAIGVGMAVLLVAWWST* |
Ga0075464_100067982 | 3300006805 | Aqueous | MKHSKYFHYPEVKNAKLHSRADAALDLLTALAIGFGLAVLLVAWWSA* |
Ga0075464_101746182 | 3300006805 | Aqueous | MKHHKHFHYPEVKSARLTARAEAGLDLLTALAIGISLAALLVAWWSA* |
Ga0075464_103658073 | 3300006805 | Aqueous | MKHHKHYYYPEVKNARLTARADAALDLLTALAIGISLAALLVAWWSA* |
Ga0075464_106386462 | 3300006805 | Aqueous | MKHHKHYYYPEVKNAKLTARADAALDLLTALAIGISLAALLVAWWSA* |
Ga0075464_106438152 | 3300006805 | Aqueous | MKHSKHFYYPEVKNAKLNARAEAALDLLAVLAIGVGMAVLLVAWWSA* |
Ga0075464_109031091 | 3300006805 | Aqueous | MKHHKHFYYPEVKSARLTARAQAALDLLTALAIGISLAALLV |
Ga0075464_109332071 | 3300006805 | Aqueous | PRKHTMKHSKYFHYPEVKNARLNARAEAALDLLTALAIGISLAALLIAWWSA* |
Ga0070748_11537842 | 3300006920 | Aqueous | MKHHKHFYYPEVKNAKLTARADAALDLLTALAIGISLAALLVAWWSA* |
Ga0070748_13568912 | 3300006920 | Aqueous | MKHSKYFHYPEVKNAKLNSRGEAIMDLLAVLAIGVGMAVLLVAWWST* |
Ga0102853_10982542 | 3300007543 | Estuarine | KHSKYFHYPEVKNAKLNARGEAVIDLIVAIAIGVGMAVLLVAWWST* |
Ga0102828_10713612 | 3300007559 | Estuarine | MKHHKHFHYPEVKNARLNARAEAALDLLTALAIGISLAALLVAWWSV* |
Ga0102863_10552793 | 3300007622 | Estuarine | MKHHKHYHYPEVKNARLNSRAEAALDLLTALAIGISFAALLVAWWSA* |
Ga0104986_17379 | 3300007734 | Freshwater | MKHHKHFHYPEVKSARLTACAEAGLDLLTALAIGISLAALLVAWWST* |
Ga0105745_13244471 | 3300007972 | Estuary Water | HYPEVKNAKLNARAEAALDLLAVLAIGVGLAVLLVAWWSA* |
Ga0114340_12153073 | 3300008107 | Freshwater, Plankton | TKRGASPRKHNMKHHKHFHYPEVKNARLNSRADAALDLLTALAIGISLAALMVAWWSA* |
Ga0114841_10057026 | 3300008259 | Freshwater, Plankton | MKHHKHFHYPEVKNARLNSRADAALDLLTALAIGISLAALMVAWWSA* |
Ga0114349_10677005 | 3300008263 | Freshwater, Plankton | MKHSKHFYYPEVKSARLTARAQAGLDLLTALAIGISLAALLVAWWSA* |
Ga0114364_10178515 | 3300008267 | Freshwater, Plankton | MKHSKHFYYPEVKNARLEARAEAGLDLLTALAIGISLAALLVAWWSA* |
Ga0114876_10366575 | 3300008448 | Freshwater Lake | MKHHRHYHYPEVKNAKLTARADAALDLLTALAIGISLAALLVAWWSA* |
Ga0114876_11258091 | 3300008448 | Freshwater Lake | NPRGHGPRKHNMKHSKHFYYPEVKSARLTARAEAGLDLLTALAIGISLAALLVAWWSA* |
Ga0114876_12735821 | 3300008448 | Freshwater Lake | HNMKHSKHFYYPEVKSARLTARAEAGLDLLTALAIGISLAALLVAWWSA* |
Ga0114973_103393121 | 3300009068 | Freshwater Lake | SKYFHYPEVKNAKLIARAEAAVDFLLALAIGSGMAVLLIAWWTA* |
Ga0105103_105545142 | 3300009085 | Freshwater Sediment | MKHSKYFHYPEVKNAKLNARGEAVLDFILAIAIGVGMAVLLVAWWSA* |
Ga0114962_1000204914 | 3300009151 | Freshwater Lake | MKHHKYYHYPEVKNAKLIARAEAAVDFLLALAIGSGMAVLLIAWWTA* |
Ga0114962_101597014 | 3300009151 | Freshwater Lake | MKHHKHYHYSEIKNAKLHARAEAALDFITALAIGCGFAWLLVAWWSA* |
Ga0114962_102494691 | 3300009151 | Freshwater Lake | MKHHKHYHYPEVKNAKLHARAEAALDFITALAIGCGFAWLLVAWWSA* |
Ga0114980_104126682 | 3300009152 | Freshwater Lake | MKHSKYFHYPEVKNAKLNARGEAVIDLLTVLAIGVGMAVLLVAWWSA* |
Ga0114977_100392635 | 3300009158 | Freshwater Lake | MKHSKYYHYPEVKNARINARAEAALDFILALIIGASLAVLLIAWWTA* |
Ga0114977_103807413 | 3300009158 | Freshwater Lake | HMKHSKYFHYPEVKNAKLNARGEAVIDLIVAIAIGVGMAVLLVAWWST* |
Ga0114977_105641591 | 3300009158 | Freshwater Lake | MKHHKHFYYPEVKNARLNARADAALDLLTALAIGISLAALLVAWWSA* |
Ga0114978_100035106 | 3300009159 | Freshwater Lake | MKHHKHYHYPEIKNARLNARAEAAVDFLLALAIGSGMAVLLIAWWTA* |
Ga0114978_103096011 | 3300009159 | Freshwater Lake | VVGNGENEMKHQKYNHYPEVKNAKLNARAEAAVDFLAAIAVGIVLAVLLAWRG* |
Ga0114970_100496872 | 3300009163 | Freshwater Lake | MKHQKYNHYPEVKNAKLNARAEAAVDFLAAIAVGIVLAVLLAWRG* |
Ga0114975_100377944 | 3300009164 | Freshwater Lake | MKHSKYYHYPEVKNAKLNSRGEAIIDLLTVLAIGVGMAVLLVAWWST* |
Ga0105102_100398926 | 3300009165 | Freshwater Sediment | MKHSKYFHYPEVKNAKLNARGEAVIDFILAIAIGVGMAVLLVAWWSA* |
Ga0114979_101467373 | 3300009180 | Freshwater Lake | MKHSKYFHYPEVKNAKLNARCEAVMDLLAVLAIGVGMAVLLVAWWST* |
Ga0114959_104892741 | 3300009182 | Freshwater Lake | MKHHKHYHYPEIKNAKLHARAEAALNFITALAIGCGFAWLLVAWWSA* |
Ga0114982_10509883 | 3300009419 | Deep Subsurface | MKHHKHFHYPEIKNARLNARADAALDLLTALAIGISLAALLVAWWSA* |
Ga0114958_105643281 | 3300009684 | Freshwater Lake | MKHHKHYHYPEVKNAKLHVRAEAALDFITALAIGCGFAWLLVAWWSA* |
Ga0114986_10154575 | 3300010374 | Deep Subsurface | MKHHKHFHYPEVKNARLTARAEAALDLLTALAIGISLAAL |
Ga0133913_107925176 | 3300010885 | Freshwater Lake | MKYHNHFQYPEVKNAKLYARAEAAMGLLLAIAIGVGMACLLVAWWSA* |
Ga0137575_100013322 | 3300010970 | Pond Fresh Water | MKHSKYYHYPEVKNAKLNARAEAALDLFTVLAIGVGLAVLLVAWWSA* |
Ga0139557_10618883 | 3300011010 | Freshwater | MKHSKHFYYPEVKNARLTARAEAALDLLTALAIGISLAALLVAWWSA* |
Ga0153697_15984 | 3300011334 | Freshwater | MKHSKHFYYPEIKNERINARADAALGFLTALAIGVGLAVLLVAWWSA* |
Ga0153703_110539 | 3300011336 | Freshwater | MKHHKHFYYPEIKSARLTARAEPGLDLLTALAIGISLAALLVAWWSA* |
Ga0153799_10014463 | 3300012012 | Freshwater | MKHHRHYHYPEVKNARLTARAEAALDLLTALAIGISLAALLVAWWSA* |
Ga0153799_10137594 | 3300012012 | Freshwater | MKHHKHYHYPEVKNARLTARAEAALDLLTALAIGISLAALLVAWWSA* |
Ga0153801_10124031 | 3300012017 | Freshwater | MKHHRHYHYPEVKNARLTARADAALDLLTALAIGISLAAL |
Ga0157498_10417593 | 3300012666 | Freshwater, Surface Ice | MKHHKHFHYPEVKNARLNARAEAGLDLLTALAIGISLAALLVAWWLA* |
Ga0164292_108755782 | 3300013005 | Freshwater | MKHSKHFYYPEVKNARLTARAEAALDLLTALAIGISLAVLLVAWWSA* |
Ga0177922_105453373 | 3300013372 | Freshwater | MKHHKHYYYPEVKNARLTARAEAGLDLLTALAIGISLAALLVAWWSA* |
Ga0177922_109488782 | 3300013372 | Freshwater | MKHHKHYHYPEVKNARLTARADAALDLLTALAIGISLAALLVAWWSA* |
Ga0177922_110898462 | 3300013372 | Freshwater | MKHHRHYHYPEVKNARLTARADAALDLLTALAIGISLAALLVAWWLS* |
Ga0119960_10145131 | 3300014811 | Aquatic | MKHSKYYHYPEVKNAKLNARGEAVLDLLTALAIGISLAALLVAWWSA* |
Ga0119960_10198361 | 3300014811 | Aquatic | MKHHRHYHYPEVKNARLNSRADAALDLLTALAIGISLAALLVAWWSA* |
Ga0181347_10457442 | 3300017722 | Freshwater Lake | MKHHRHYHYPEVKNARLNSRADAALDLLTALAIGISLAALLVAWWSA |
Ga0181352_10023474 | 3300017747 | Freshwater Lake | MKHHKHYYYPEVKSARLTARAQAGLDLLTALAIGISLAALLVAWWSA |
Ga0181352_11125173 | 3300017747 | Freshwater Lake | MKHSKHFYYPEVKSARLTARAEAGLDLLTALAIGGSPDGLLV |
Ga0181352_11159232 | 3300017747 | Freshwater Lake | MKHHRHYHYPEVKNARLTARAEAALDLLTALAIGISLAALLVAWWSA |
Ga0181344_10663391 | 3300017754 | Freshwater Lake | QRGLGPHRKHNMKHSKYFHYPEVKNAKLNARGEAVIDFILAIAIGVGMAVLLVAWWSA |
Ga0181344_11523062 | 3300017754 | Freshwater Lake | MKHSKYFHHPEVKNAKLNARGEAVIDFILAIAIGVGMAVLLVAWWSA |
Ga0181344_11599512 | 3300017754 | Freshwater Lake | MKHHRHYHYPEVKNARLTSRAEAALDLLTALAIGISLAALLVAWWSA |
Ga0181344_12078452 | 3300017754 | Freshwater Lake | MKHSKYFHYPEVKNAKLNARGEAVIDFILAIAIGVGMAV |
Ga0181343_11374512 | 3300017766 | Freshwater Lake | MKHSKYFHYPEVKNAKLNARGEAVIDLLVAIAIGVGMAVLLVAWWSA |
Ga0181358_11561314 | 3300017774 | Freshwater Lake | YPEVKNARLNARAEAALDLFTAFAIGISLAALLVAWWSA |
Ga0181357_12744712 | 3300017777 | Freshwater Lake | MKHSKHFYYPKVKNARLTARAEAALDLLTALAIGISFAALLVAWWS |
Ga0181346_10212811 | 3300017780 | Freshwater Lake | MKHSKHFYYPKVKNARLTARAEAALDLLTALAIGISFAALLVAW |
Ga0181348_12116711 | 3300017784 | Freshwater Lake | MKHSKHFYYPKVKNARLTSRAEAALDLLTALAIGISLAALLVAWWSA |
Ga0181348_13018502 | 3300017784 | Freshwater Lake | MKHHRHYHYPEVKNARLTSRAEAALDLLTALAIGISFAALLVAWWSA |
Ga0181359_10261553 | 3300019784 | Freshwater Lake | MKHHKHFHYPEVKNARLTARADAALDLLTALAIGISLAALLVAWWSA |
Ga0181359_11257902 | 3300019784 | Freshwater Lake | MKHSKHFYYPEVKNARLTARAEAALDLLTALAIGISFAAKLVAWWSA |
Ga0181359_11824581 | 3300019784 | Freshwater Lake | MKHSKYYHYPEVKNAKLHARAEAALDLILAISIGIGMAVLLVAWWSA |
Ga0181359_11912381 | 3300019784 | Freshwater Lake | MKHHRHYHYPEVKNARLTARADAALDLLTALAIGISLAALLVAWWSA |
Ga0207193_10351587 | 3300020048 | Freshwater Lake Sediment | MKHHKHYHYPEVKNARLTARAEAALDLLTALAIGISLAALLVAWWSA |
Ga0207193_10692785 | 3300020048 | Freshwater Lake Sediment | MKHSKYFHYPEVKNAKLNARGEAVLDLLLAIAIGVGMAVLLVAWWSA |
Ga0211732_13521956 | 3300020141 | Freshwater | MKHHKHYHYPEVKTARLTARAEAGLDLLTALAIGISLAALLVAWWSA |
Ga0211736_102971541 | 3300020151 | Freshwater | MKHSKYFHYPEVKNAKLNARGEAILDLLLAIAIGIGMAVLLVAWWSA |
Ga0211733_110018045 | 3300020160 | Freshwater | MKHSKYFHYPEVKNAKLNARGEAVIDLLVAIAIGIGMAVLLVAWWTL |
Ga0211735_111395803 | 3300020162 | Freshwater | MKHSKHFYYPEVKNARLTARAQAGLDLLTALAIGISLAAL |
Ga0211729_113123952 | 3300020172 | Freshwater | MKHSKHFYYPEVKTARLTARAQAGLDLLTALAIGISLAALLVAWWSA |
Ga0211731_105624822 | 3300020205 | Freshwater | MKHSKHFYYPEIKNERINARADAALGFLTALAIGVGLAALLVAWWSA |
Ga0208718_10383842 | 3300020565 | Freshwater | MKHHKHYYYPEVKNARLTARAEAALDLLTALAIGISLAALLIAWWSA |
Ga0213921_100011031 | 3300021952 | Freshwater | MKHSKYFHYPEVKNAKLNSRGEAVIDLIVAIVIGVGMAALLVAWWSA |
Ga0222714_100127188 | 3300021961 | Estuarine Water | MKHHKHYHYPEVKNARLNARADAALDLLTALAIGISLAALLVAWWSV |
Ga0222712_101753991 | 3300021963 | Estuarine Water | MKHHKHYHYPEVKNARLTARADAALDLLTALAIGISLAALLVAWW |
Ga0181353_10606281 | 3300022179 | Freshwater Lake | GKYYHYPEVKNAKLHARAEAALDLILAISIGIGMAVLLVAWWSA |
Ga0181351_10217524 | 3300022407 | Freshwater Lake | MKHHRHYHYPEVKNARLNARAEAALDLFTAFAIGISLAALLVAWWSA |
Ga0181351_10738224 | 3300022407 | Freshwater Lake | MKHHKHFQYPEVKNAKLHARADAAVDFLAAVAIGVGLAVLLVAWWST |
Ga0181351_12210922 | 3300022407 | Freshwater Lake | MKHSKYFHYPEVKNAKLNARGEAVIDLIVAIAIGVGMAVLLVAWWST |
Ga0214921_1000170655 | 3300023174 | Freshwater | MKHSKYYHYPEVKNARINARAEAALDFILALIIGASLAVLLIAWWTA |
Ga0214921_1000900515 | 3300023174 | Freshwater | MKHQKYNHYPEVKNAKLNARAEAAVDFLAAIAIGIVLAVLLAWRG |
Ga0208248_10477582 | 3300025595 | Freshwater | MKHSKYYHYPEVKNARINARAEAALDFILALIIGASLAALLIAWWSA |
Ga0208248_11352783 | 3300025595 | Freshwater | MKHSKYYHYPEVKNAKLNARAEAALDFILAIIIGVCLAMLLVAWWSA |
Ga0208644_12846782 | 3300025889 | Aqueous | MKHHNHFQYPEVKNAKLHARADAAMDLLTALAIGFGLAALLVAWWSA |
Ga0208916_100054096 | 3300025896 | Aqueous | MKHSKYFHYPEVKNAKLHSRADAALDLLTALAIGFGLAVLLVAWWSA |
Ga0208916_100170295 | 3300025896 | Aqueous | MKHHKHYYYPEVKNAKLTARADAALDLLTALAIGISLAALLVAWWSA |
Ga0208916_100377244 | 3300025896 | Aqueous | MKHHKHFHYPEVKSARLTARAEAGLDLLTALAIGISLAALLVAWWSA |
Ga0208306_10655852 | 3300027214 | Estuarine | MKHHKHYHYPEVKNARLNSRAEAALDLLTALAIGISLAALLVAWWSA |
Ga0209300_10237403 | 3300027365 | Deep Subsurface | MKHSKYFHYPEVKNAKLNARGEAVIDLIVAIVIGVGMAVLLVAWWSA |
Ga0209300_10466973 | 3300027365 | Deep Subsurface | MKHHKHFHYPEVKNARLTARAEAALDLLTALAIGISLAALLVAWWSA |
Ga0209704_10510921 | 3300027693 | Freshwater Sediment | GPHRKHNMKHSKYFHYPEVKNAKLNARGEAVIDFILAIAIGVGMAVLLVAWWSA |
Ga0209188_10186365 | 3300027708 | Freshwater Lake | MKHHKHYHYPEVKNAKLHARAEAALDFITALAIGCGFAWLLVAWWSA |
Ga0209599_100096623 | 3300027710 | Deep Subsurface | MKHHKHFHYPEIKNARLNARADAALDLLTALAIGISLAALLVAWWSA |
Ga0209599_102204961 | 3300027710 | Deep Subsurface | MKHHKHFYYPEVKSARLTARAQAALDLLTALAIGISLAALLVAW |
Ga0209499_10106844 | 3300027712 | Freshwater Lake | MKHHKHYHYSEIKNAKLHARAEAALDFITALAIGCGFAWLLVAWWSA |
Ga0209499_12253891 | 3300027712 | Freshwater Lake | MKHHKHYHYPEVKNAKLHVRAEAALDFITALAIGCGFAWLLVAWWSA |
Ga0209297_100035520 | 3300027733 | Freshwater Lake | MKHSKYFHYPEVKNAKLNARGEAVIDLLTVLAIGVGMAVLLVAWWSA |
Ga0209087_10012944 | 3300027734 | Freshwater Lake | MKHSKYYHYPEVKNAKLNSRGEAIIDLLTVLAIGVGMAVLLVAWWST |
Ga0209190_11676702 | 3300027736 | Freshwater Lake | MKHHKYYHYPEVKNAKLIARAEAAVDFLLALAIGSGMAVLLIAWWTA |
Ga0209189_11564261 | 3300027747 | Freshwater Lake | MKHHKHYHYPEIKNAKLHARAEAALDFITALAIGCGFAWLLVAWWSA |
Ga0209088_101245243 | 3300027763 | Freshwater Lake | MKHSKYFHYPEVKNAKLNARCEAVMDLLAVLAIGVGMAVLLVAWWST |
Ga0209500_1000135519 | 3300027782 | Freshwater Lake | MKHHKHYHYPEIKNARLNARAEAAVDFLLALAIGSGMAVLLIAWWTA |
Ga0209500_102247572 | 3300027782 | Freshwater Lake | VVGNGENEMKHQKYNHYPEVKNAKLNARAEAAVDFLAAIAVGIVLAVLLAWRG |
Ga0209246_103065181 | 3300027785 | Freshwater Lake | MKHSKHFYYPKVKNARLTARAEAALDLLTALAIGISFAALLVAWWSA |
Ga0209668_100018907 | 3300027899 | Freshwater Lake Sediment | MKHSKYFHYPEVKNAKLNARGEAVLDFILAIAIGVGMAVLLVAWWSA |
Ga0209253_103742812 | 3300027900 | Freshwater Lake Sediment | MKHHKHFYYPEVKSARLTARAEAGLDLLTALAIGISLAALLVAWWSA |
Ga0209400_100048340 | 3300027963 | Freshwater Lake | MKHSKYYHYPEVKNAKLNARAAAAIDLLVVLAIGVGMAVLLVAWWSS |
Ga0247723_100132823 | 3300028025 | Deep Subsurface Sediment | MKHHKHFYYPEVKSARLTARAQAALDLLTALAIGISLAALLVAWWSA |
Ga0315291_105478503 | 3300031707 | Sediment | MKHHKHFHYPEVKNARLTARAEAGLDLLTALAIGISLAALLVAWWSA |
Ga0315907_1000211714 | 3300031758 | Freshwater | MKHSKHFYYPEVKSARLTARAQAGLDLLTALAIGISLAALLVAWWSA |
Ga0315900_103829462 | 3300031787 | Freshwater | MKHHKHFHYPEVKNARLNSRADAALDLLTALAIGISLAALMVAWWSA |
Ga0315909_102021564 | 3300031857 | Freshwater | PEVKNARLTARADAALDLLTALAIGISLAALLVAWWSA |
Ga0315285_107522573 | 3300031885 | Sediment | MKHHRHYHYPEVKNARLTARAEAGLDLLTALAIGISLAALLVAWWSA |
Ga0315274_101212432 | 3300031999 | Sediment | MKHHKHYYYPEVKNARLTARADAALDLLTALAIGISLATLLFAWWLA |
Ga0315274_108122912 | 3300031999 | Sediment | MKHHKHYYYPEVKNARLTARAEAALDLLTVLAIGVGMAVLMVAWWSA |
Ga0315274_118538141 | 3300031999 | Sediment | MKHHRHYHYPEVKNARLTARADAALDLLTALAIGISL |
Ga0315902_104223294 | 3300032093 | Freshwater | HRHYHYPEVKNARLTARADAALDLLTALAIGISLAALLVAWWSA |
Ga0315903_102568944 | 3300032116 | Freshwater | NPRGHGPRKHNMKHSKHFYYPEVKSARLTARAEAGLDLLTALAIGISLAALLVAWWSA |
Ga0315277_1001645510 | 3300032118 | Sediment | MKHHKHFHYPEVKNARLTARAEAALDLLAVLAIGAGMAVLLVAWWSA |
Ga0334982_0226347_294_437 | 3300033981 | Freshwater | MKHHKHYHYPEVKNARLNARADAALDLLTALAIGISLAALLVAWWSA |
Ga0334994_0118397_873_1016 | 3300033993 | Freshwater | MKHSKYYHYPEVKNARLTARAEAGLDLLTALAIGISLAALLVAWWSA |
Ga0334979_0011967_3686_3829 | 3300033996 | Freshwater | MKHHKHYHYPEVKNARLTARAEAALDLLTALAIGISLATLLVAWWSA |
Ga0334979_0304883_491_634 | 3300033996 | Freshwater | MKHSKYFHYPEVKNAKLNARGEAVLDLLLAIAIGVGMAVLLVAWWSV |
Ga0334979_0459969_339_482 | 3300033996 | Freshwater | MKHSKHFYYPEVKNARLTARAEAALDLLTALAIGISLAVLLVAWWSA |
Ga0334986_0006779_3997_4140 | 3300034012 | Freshwater | MKHSKHFYYPEVKNARLTARAQAGLDLLTALAIGISLAALLVAWWSA |
Ga0334986_0100717_401_544 | 3300034012 | Freshwater | MKHHKHYYYPEVKNARLTARADAALDLLTALAIGISLAALLVAWWSA |
Ga0334986_0222268_88_231 | 3300034012 | Freshwater | MKHNKYYHYPEVKNAKLNARGEAIIDLLTVLAIGVGMAVLMVAWWSA |
Ga0334986_0470728_304_447 | 3300034012 | Freshwater | MKHSKYFHYPEVKNAKLNARGEAVIDFILAIAIGVGMAILLVAWWSA |
Ga0335002_0238602_458_601 | 3300034020 | Freshwater | MKHHRHYHYPEVKNARLTARAEAALDLLTALAIGISLAVLLVAWWSA |
Ga0335005_0265077_832_975 | 3300034022 | Freshwater | MKNSKHFYYPEVKNARLTARAEAGLDLLTALAIGISLAALLVAWWSA |
Ga0334987_0070114_686_829 | 3300034061 | Freshwater | MKHSKYFHYPEVKNAKLNARGEAVIDLLVAIAIGIGMAVLLVAWWST |
Ga0334987_0211835_547_690 | 3300034061 | Freshwater | MKHSKYFHYPEVKNAKLNARGEAVIDFILAIAIGVGMAVLLVAWWLA |
Ga0334987_0741448_380_523 | 3300034061 | Freshwater | MKHSKYFHYPEVKNAKLNARGEAVLDLIVAIAIGVGMAVLLVAWWSA |
Ga0334995_0376927_527_670 | 3300034062 | Freshwater | MKHSKYYHYPEVKNAKLNARGEAVIDLLTVLAIGVGMAVLLVAWWST |
Ga0334995_0569572_279_422 | 3300034062 | Freshwater | MKHSQYYHYPEVKNAKLNARGEAVIDLLTVLAIGVGMAVLLIAWWSA |
Ga0334990_0307915_637_780 | 3300034068 | Freshwater | MKHHRHYHYPEVKNARLTVRAQAGLDLLTALAIGISLAALLVAWWSA |
Ga0335020_0492876_233_376 | 3300034082 | Freshwater | MKHHKHYYYPEVKNARLTARAQAALDLLTALAIGISLAALLVAWWSA |
Ga0335027_0380922_89_232 | 3300034101 | Freshwater | MKHSKYYHYPEVKNARLNARGEAVMDLLTALAIGVGMACLLVAWWST |
Ga0335031_0041634_1375_1518 | 3300034104 | Freshwater | MKHHRHYHYPEVKNARINSRAEAALDLLTALAIGISFAALLVAWWSA |
Ga0335031_0508870_296_439 | 3300034104 | Freshwater | MKHHRHYHYPEVKNTRLTARAEAALDLLTALAIGISLAALLVAWWSA |
Ga0335036_0274010_792_935 | 3300034106 | Freshwater | MKHHRHYHYPEVKNARLNARADAGLDLLTALAIGISLAALLVAWWSA |
Ga0335036_0315418_670_813 | 3300034106 | Freshwater | MKHHRHYHYPEVKNARLTARAEAALDLLTALAIGISFAALLVAWWSA |
Ga0335055_0107616_573_716 | 3300034110 | Freshwater | MKHSKYYHYPEVKNAKLTARAEAALDLLTALAIGISFAALLVAWWSA |
Ga0335063_0195659_12_155 | 3300034111 | Freshwater | MKHSQYYHYPEVKNAKLNARGEAVIDLLTVLAIGVGLAVLLVAWWST |
Ga0335054_0167132_814_957 | 3300034119 | Freshwater | MKHHKHYYYPEVKNARLTARAEAALDLLTALAIGISLAALLVAWWSA |
Ga0335056_0085270_124_267 | 3300034120 | Freshwater | MKHHKHYYYPKVKNARLTARAEAGLDLLTALAIGISLAALLVAWWSA |
Ga0335056_0479434_19_162 | 3300034120 | Freshwater | MKHHRHFHYPEVKNARLTARADAALDLLTALAIGISLAALLVAWWSA |
Ga0335017_0398661_506_670 | 3300034167 | Freshwater | MVVRNSNMKHSKHFYYPEVKNARLTARAEAALDLLTVLAIGVGMAVLLVAWWSA |
Ga0335065_0685429_2_118 | 3300034200 | Freshwater | PEVKNAKLNARGEAVIDFILAIAIGVGMAVLLVAWWSA |
Ga0335049_0528637_478_621 | 3300034272 | Freshwater | MKHHRHYHYPEVKNARINSRADAALDLLTALAIGISLAALLVAWWSA |
Ga0335007_0088346_1467_1610 | 3300034283 | Freshwater | MKHHKHFHYPEVKNARLNARADAALDLLTALAIGISLAALLVAWWSA |
⦗Top⦘ |