| Basic Information | |
|---|---|
| Family ID | F032543 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 179 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MTCQPEGGCWCAELPHVPMPADAEGCLCRNCLLAKIEALQNPGKRKEA |
| Number of Associated Samples | 103 |
| Number of Associated Scaffolds | 179 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 58.10 % |
| % of genes near scaffold ends (potentially truncated) | 36.31 % |
| % of genes from short scaffolds (< 2000 bps) | 65.92 % |
| Associated GOLD sequencing projects | 90 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (77.654 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (51.397 % of family members) |
| Environment Ontology (ENVO) | Unclassified (49.721 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (51.955 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 22.37% β-sheet: 0.00% Coil/Unstructured: 77.63% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 179 Family Scaffolds |
|---|---|---|
| PF10609 | ParA | 41.34 |
| PF00132 | Hexapep | 21.79 |
| PF13393 | tRNA-synt_His | 10.06 |
| PF07516 | SecA_SW | 7.26 |
| PF01336 | tRNA_anti-codon | 3.35 |
| PF07517 | SecA_DEAD | 2.79 |
| PF13589 | HATPase_c_3 | 1.12 |
| PF02810 | SEC-C | 1.12 |
| PF15594 | Imm50 | 0.56 |
| PF03061 | 4HBT | 0.56 |
| PF01797 | Y1_Tnp | 0.56 |
| PF04191 | PEMT | 0.56 |
| PF07238 | PilZ | 0.56 |
| PF13561 | adh_short_C2 | 0.56 |
| PF09413 | DUF2007 | 0.56 |
| PF13614 | AAA_31 | 0.56 |
| PF12704 | MacB_PCD | 0.56 |
| COG ID | Name | Functional Category | % Frequency in 179 Family Scaffolds |
|---|---|---|---|
| COG0653 | Preprotein translocase subunit SecA (ATPase, RNA helicase) | Intracellular trafficking, secretion, and vesicular transport [U] | 10.06 |
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 0.56 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 77.65 % |
| Unclassified | root | N/A | 22.35 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001154|JGI12636J13339_1000646 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5711 | Open in IMG/M |
| 3300001593|JGI12635J15846_10039628 | All Organisms → cellular organisms → Bacteria | 3681 | Open in IMG/M |
| 3300001593|JGI12635J15846_10123320 | All Organisms → cellular organisms → Bacteria | 1827 | Open in IMG/M |
| 3300002907|JGI25613J43889_10007334 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3019 | Open in IMG/M |
| 3300002914|JGI25617J43924_10027083 | All Organisms → cellular organisms → Bacteria | 2018 | Open in IMG/M |
| 3300002914|JGI25617J43924_10031351 | All Organisms → cellular organisms → Bacteria | 1892 | Open in IMG/M |
| 3300002914|JGI25617J43924_10047593 | All Organisms → cellular organisms → Bacteria | 1558 | Open in IMG/M |
| 3300002914|JGI25617J43924_10050164 | All Organisms → cellular organisms → Bacteria | 1518 | Open in IMG/M |
| 3300002917|JGI25616J43925_10013092 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3661 | Open in IMG/M |
| 3300005174|Ga0066680_10402524 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
| 3300005176|Ga0066679_10047289 | All Organisms → cellular organisms → Bacteria | 2461 | Open in IMG/M |
| 3300005176|Ga0066679_10321572 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1009 | Open in IMG/M |
| 3300005447|Ga0066689_10229864 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1135 | Open in IMG/M |
| 3300005555|Ga0066692_10017655 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3554 | Open in IMG/M |
| 3300005555|Ga0066692_10609096 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300005586|Ga0066691_10156143 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1315 | Open in IMG/M |
| 3300005598|Ga0066706_10487457 | All Organisms → cellular organisms → Bacteria | 982 | Open in IMG/M |
| 3300006034|Ga0066656_10951183 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 551 | Open in IMG/M |
| 3300006050|Ga0075028_100888905 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 548 | Open in IMG/M |
| 3300006052|Ga0075029_100024126 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 3422 | Open in IMG/M |
| 3300006162|Ga0075030_101425404 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300007255|Ga0099791_10154306 | Not Available | 1073 | Open in IMG/M |
| 3300007255|Ga0099791_10307266 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 756 | Open in IMG/M |
| 3300007258|Ga0099793_10076652 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1519 | Open in IMG/M |
| 3300007265|Ga0099794_10203321 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1014 | Open in IMG/M |
| 3300007788|Ga0099795_10431975 | Not Available | 603 | Open in IMG/M |
| 3300009012|Ga0066710_100000257 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 29048 | Open in IMG/M |
| 3300009038|Ga0099829_10105232 | All Organisms → cellular organisms → Bacteria | 2201 | Open in IMG/M |
| 3300009038|Ga0099829_11215084 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 624 | Open in IMG/M |
| 3300009038|Ga0099829_11478174 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 561 | Open in IMG/M |
| 3300009038|Ga0099829_11572392 | Not Available | 543 | Open in IMG/M |
| 3300009088|Ga0099830_10051901 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2897 | Open in IMG/M |
| 3300009088|Ga0099830_10631579 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 879 | Open in IMG/M |
| 3300009089|Ga0099828_10143837 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2102 | Open in IMG/M |
| 3300009089|Ga0099828_10235532 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1639 | Open in IMG/M |
| 3300009089|Ga0099828_11281374 | Not Available | 649 | Open in IMG/M |
| 3300009090|Ga0099827_11442539 | Not Available | 599 | Open in IMG/M |
| 3300009090|Ga0099827_11786378 | Not Available | 536 | Open in IMG/M |
| 3300009137|Ga0066709_100408213 | All Organisms → cellular organisms → Bacteria | 1886 | Open in IMG/M |
| 3300009143|Ga0099792_11035919 | Not Available | 550 | Open in IMG/M |
| 3300011120|Ga0150983_15912258 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
| 3300011269|Ga0137392_10849981 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 752 | Open in IMG/M |
| 3300011269|Ga0137392_11070265 | Not Available | 662 | Open in IMG/M |
| 3300011269|Ga0137392_11396118 | Not Available | 559 | Open in IMG/M |
| 3300011270|Ga0137391_10376565 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1216 | Open in IMG/M |
| 3300011270|Ga0137391_10506452 | Not Available | 1021 | Open in IMG/M |
| 3300011270|Ga0137391_10716412 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 830 | Open in IMG/M |
| 3300011270|Ga0137391_10919900 | Not Available | 715 | Open in IMG/M |
| 3300011271|Ga0137393_10487246 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1058 | Open in IMG/M |
| 3300011271|Ga0137393_10793282 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 810 | Open in IMG/M |
| 3300012096|Ga0137389_10239340 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1522 | Open in IMG/M |
| 3300012096|Ga0137389_10588436 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 956 | Open in IMG/M |
| 3300012096|Ga0137389_10899031 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 760 | Open in IMG/M |
| 3300012189|Ga0137388_10147983 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2076 | Open in IMG/M |
| 3300012189|Ga0137388_10185874 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1865 | Open in IMG/M |
| 3300012189|Ga0137388_10278575 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1529 | Open in IMG/M |
| 3300012202|Ga0137363_10003326 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 9771 | Open in IMG/M |
| 3300012202|Ga0137363_10009975 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6044 | Open in IMG/M |
| 3300012202|Ga0137363_10018481 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4634 | Open in IMG/M |
| 3300012202|Ga0137363_10055129 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2867 | Open in IMG/M |
| 3300012202|Ga0137363_10743639 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 831 | Open in IMG/M |
| 3300012202|Ga0137363_11452765 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 576 | Open in IMG/M |
| 3300012203|Ga0137399_10303133 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1320 | Open in IMG/M |
| 3300012205|Ga0137362_10019757 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5164 | Open in IMG/M |
| 3300012206|Ga0137380_10646758 | Not Available | 921 | Open in IMG/M |
| 3300012207|Ga0137381_10084939 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2664 | Open in IMG/M |
| 3300012207|Ga0137381_11209027 | Not Available | 649 | Open in IMG/M |
| 3300012209|Ga0137379_10572073 | Not Available | 1037 | Open in IMG/M |
| 3300012209|Ga0137379_10695845 | Not Available | 922 | Open in IMG/M |
| 3300012209|Ga0137379_11398770 | Not Available | 603 | Open in IMG/M |
| 3300012285|Ga0137370_10000707 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 13076 | Open in IMG/M |
| 3300012349|Ga0137387_11024908 | Not Available | 591 | Open in IMG/M |
| 3300012354|Ga0137366_10972545 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 592 | Open in IMG/M |
| 3300012357|Ga0137384_11189058 | Not Available | 607 | Open in IMG/M |
| 3300012361|Ga0137360_10596136 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 946 | Open in IMG/M |
| 3300012361|Ga0137360_10640159 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 911 | Open in IMG/M |
| 3300012362|Ga0137361_10234302 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1669 | Open in IMG/M |
| 3300012363|Ga0137390_10211526 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1926 | Open in IMG/M |
| 3300012582|Ga0137358_10036476 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3246 | Open in IMG/M |
| 3300012582|Ga0137358_10552704 | Not Available | 774 | Open in IMG/M |
| 3300012683|Ga0137398_10019231 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3675 | Open in IMG/M |
| 3300012683|Ga0137398_10061928 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2255 | Open in IMG/M |
| 3300012683|Ga0137398_10229774 | Not Available | 1231 | Open in IMG/M |
| 3300012683|Ga0137398_10823842 | Not Available | 649 | Open in IMG/M |
| 3300012683|Ga0137398_10838944 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 642 | Open in IMG/M |
| 3300012685|Ga0137397_10034237 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3625 | Open in IMG/M |
| 3300012685|Ga0137397_10056841 | All Organisms → cellular organisms → Bacteria | 2817 | Open in IMG/M |
| 3300012685|Ga0137397_10961574 | Not Available | 631 | Open in IMG/M |
| 3300012918|Ga0137396_10178637 | All Organisms → cellular organisms → Bacteria | 1555 | Open in IMG/M |
| 3300012922|Ga0137394_10023115 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5001 | Open in IMG/M |
| 3300012925|Ga0137419_10682904 | Not Available | 832 | Open in IMG/M |
| 3300012927|Ga0137416_10299758 | All Organisms → cellular organisms → Bacteria | 1332 | Open in IMG/M |
| 3300012929|Ga0137404_10638893 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 959 | Open in IMG/M |
| 3300012944|Ga0137410_10725213 | Not Available | 830 | Open in IMG/M |
| 3300015054|Ga0137420_1264220 | Not Available | 610 | Open in IMG/M |
| 3300019789|Ga0137408_1061711 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2190 | Open in IMG/M |
| 3300019887|Ga0193729_1000114 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 37135 | Open in IMG/M |
| 3300020170|Ga0179594_10086067 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1114 | Open in IMG/M |
| 3300020199|Ga0179592_10002900 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7177 | Open in IMG/M |
| 3300020579|Ga0210407_10021290 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4814 | Open in IMG/M |
| 3300020579|Ga0210407_10163385 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1720 | Open in IMG/M |
| 3300020579|Ga0210407_10495984 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 954 | Open in IMG/M |
| 3300020580|Ga0210403_10018817 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5517 | Open in IMG/M |
| 3300020581|Ga0210399_10126473 | All Organisms → cellular organisms → Bacteria | 2103 | Open in IMG/M |
| 3300020581|Ga0210399_10204682 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1642 | Open in IMG/M |
| 3300021046|Ga0215015_10375373 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 638 | Open in IMG/M |
| 3300021088|Ga0210404_10238588 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
| 3300021168|Ga0210406_10035796 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4449 | Open in IMG/M |
| 3300021168|Ga0210406_10143365 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2008 | Open in IMG/M |
| 3300021170|Ga0210400_10000016 | All Organisms → cellular organisms → Bacteria | 337035 | Open in IMG/M |
| 3300021171|Ga0210405_10001349 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 28205 | Open in IMG/M |
| 3300021178|Ga0210408_10010344 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7779 | Open in IMG/M |
| 3300021178|Ga0210408_10620090 | Not Available | 856 | Open in IMG/M |
| 3300021178|Ga0210408_11382453 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
| 3300021420|Ga0210394_11475461 | Not Available | 576 | Open in IMG/M |
| 3300021432|Ga0210384_11366032 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 613 | Open in IMG/M |
| 3300021478|Ga0210402_10032740 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4497 | Open in IMG/M |
| 3300026295|Ga0209234_1007505 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4138 | Open in IMG/M |
| 3300026298|Ga0209236_1321427 | Not Available | 501 | Open in IMG/M |
| 3300026304|Ga0209240_1003884 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5635 | Open in IMG/M |
| 3300026304|Ga0209240_1080856 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1197 | Open in IMG/M |
| 3300026318|Ga0209471_1089284 | All Organisms → cellular organisms → Bacteria | 1349 | Open in IMG/M |
| 3300026320|Ga0209131_1018091 | All Organisms → cellular organisms → Bacteria | 4265 | Open in IMG/M |
| 3300026320|Ga0209131_1105088 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1483 | Open in IMG/M |
| 3300026335|Ga0209804_1007517 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6028 | Open in IMG/M |
| 3300026551|Ga0209648_10000743 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 25517 | Open in IMG/M |
| 3300026551|Ga0209648_10001908 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 17041 | Open in IMG/M |
| 3300026551|Ga0209648_10098485 | All Organisms → cellular organisms → Bacteria | 2401 | Open in IMG/M |
| 3300026551|Ga0209648_10100390 | All Organisms → cellular organisms → Bacteria | 2372 | Open in IMG/M |
| 3300026551|Ga0209648_10176403 | Not Available | 1658 | Open in IMG/M |
| 3300026557|Ga0179587_10005699 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6237 | Open in IMG/M |
| 3300026557|Ga0179587_10028865 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3061 | Open in IMG/M |
| 3300026557|Ga0179587_10478037 | Not Available | 816 | Open in IMG/M |
| 3300026557|Ga0179587_10968354 | Not Available | 560 | Open in IMG/M |
| 3300027591|Ga0209733_1027382 | All Organisms → cellular organisms → Bacteria | 1537 | Open in IMG/M |
| 3300027655|Ga0209388_1216650 | Not Available | 527 | Open in IMG/M |
| 3300027671|Ga0209588_1017314 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2233 | Open in IMG/M |
| 3300027671|Ga0209588_1138659 | Not Available | 774 | Open in IMG/M |
| 3300027671|Ga0209588_1193374 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 636 | Open in IMG/M |
| 3300027674|Ga0209118_1000188 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 40392 | Open in IMG/M |
| 3300027674|Ga0209118_1001921 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 9230 | Open in IMG/M |
| 3300027748|Ga0209689_1262742 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 694 | Open in IMG/M |
| 3300027846|Ga0209180_10054769 | All Organisms → cellular organisms → Bacteria | 2208 | Open in IMG/M |
| 3300027846|Ga0209180_10073866 | All Organisms → cellular organisms → Bacteria | 1916 | Open in IMG/M |
| 3300027846|Ga0209180_10086205 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1777 | Open in IMG/M |
| 3300027846|Ga0209180_10207900 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1128 | Open in IMG/M |
| 3300027862|Ga0209701_10005059 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8675 | Open in IMG/M |
| 3300027862|Ga0209701_10024544 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3920 | Open in IMG/M |
| 3300027862|Ga0209701_10114234 | All Organisms → cellular organisms → Bacteria | 1677 | Open in IMG/M |
| 3300027862|Ga0209701_10233957 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1081 | Open in IMG/M |
| 3300027875|Ga0209283_10519701 | Not Available | 764 | Open in IMG/M |
| 3300027875|Ga0209283_10896213 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 537 | Open in IMG/M |
| 3300027911|Ga0209698_10078191 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2810 | Open in IMG/M |
| 3300027911|Ga0209698_11260812 | Not Available | 542 | Open in IMG/M |
| 3300028379|Ga0268266_10500299 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella | 1160 | Open in IMG/M |
| 3300030991|Ga0073994_12356985 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1376 | Open in IMG/M |
| 3300031057|Ga0170834_100900862 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 948 | Open in IMG/M |
| 3300031128|Ga0170823_12329119 | Not Available | 607 | Open in IMG/M |
| 3300031231|Ga0170824_124310652 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 983 | Open in IMG/M |
| 3300031715|Ga0307476_10042305 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3078 | Open in IMG/M |
| 3300031720|Ga0307469_10416804 | All Organisms → cellular organisms → Bacteria | 1152 | Open in IMG/M |
| 3300031753|Ga0307477_10052210 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2812 | Open in IMG/M |
| 3300031754|Ga0307475_10151481 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1841 | Open in IMG/M |
| 3300031754|Ga0307475_10155158 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1819 | Open in IMG/M |
| 3300031754|Ga0307475_10974858 | Not Available | 667 | Open in IMG/M |
| 3300031754|Ga0307475_10975448 | Not Available | 667 | Open in IMG/M |
| 3300031754|Ga0307475_11149033 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 606 | Open in IMG/M |
| 3300031754|Ga0307475_11287011 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
| 3300031754|Ga0307475_11398562 | Not Available | 539 | Open in IMG/M |
| 3300031754|Ga0307475_11546983 | Not Available | 508 | Open in IMG/M |
| 3300031823|Ga0307478_11375332 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 586 | Open in IMG/M |
| 3300031823|Ga0307478_11442037 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 571 | Open in IMG/M |
| 3300031962|Ga0307479_10003108 | All Organisms → cellular organisms → Bacteria | 15081 | Open in IMG/M |
| 3300031962|Ga0307479_10012344 | All Organisms → cellular organisms → Bacteria | 7987 | Open in IMG/M |
| 3300031962|Ga0307479_11580561 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 611 | Open in IMG/M |
| 3300032180|Ga0307471_101655024 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 795 | Open in IMG/M |
| 3300032783|Ga0335079_10003255 | All Organisms → cellular organisms → Bacteria | 18757 | Open in IMG/M |
| 3300032805|Ga0335078_12597438 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
| 3300033158|Ga0335077_10186055 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2348 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 51.40% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 10.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.06% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 9.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.70% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.91% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.12% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.68% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.68% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.56% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001154 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002907 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12636J13339_10006464 | 3300001154 | Forest Soil | MTCQPEGGCWCAELPHVPMPANAEGCLCRPCLRAKIESLQNSEKRKEA* |
| JGI12635J15846_100396283 | 3300001593 | Forest Soil | MTCKPEGGCWCAELPKIPMPADAKGCLCRNCLLAKIEALQNPIKSKEA* |
| JGI12635J15846_101233202 | 3300001593 | Forest Soil | MSCLPEGGCWCAELPHIPMPADAEGCLCRNCLRAKIEALQKTGKRNEA* |
| JGI25613J43889_100073343 | 3300002907 | Grasslands Soil | MTCQPEGGCWCAELPHVPMPAGDEGCLCRNCLLAKIEALQNPAKTKEA* |
| JGI25617J43924_100270832 | 3300002914 | Grasslands Soil | MTCQPEGGCWCAELPHVPMPAVAKGCLCRNCLRATIEALQNSEKIKEA* |
| JGI25617J43924_100313512 | 3300002914 | Grasslands Soil | MTCQPEGGCWCAELPHVPMPADAEGCLCRNCLLAKIEALQNPGKRKEA* |
| JGI25617J43924_100475933 | 3300002914 | Grasslands Soil | MTCQPEGGCWCAELPHVPMPADAEGCLCRNCLLAKIEALQKSGKGKEA* |
| JGI25617J43924_100501642 | 3300002914 | Grasslands Soil | MTCQQEAGCWCAELPHVXMPADAEGCLCRDCLLAKIEALQNPVKTKEA* |
| JGI25616J43925_100130923 | 3300002917 | Grasslands Soil | MTCQPEGGCWCAELPHVPMPADAEGCLCRNCLRAKIEALQNPGKRKEA* |
| Ga0066680_104025241 | 3300005174 | Soil | GGCWCAEFPSVPMPADAKECLCRNCLLAKIAALQNPAKIKEA* |
| Ga0066679_100472892 | 3300005176 | Soil | MTCKQEAGCWCAELPHVPMQAEGEGCLCRNCLLAKIEALQNPSKRKEA* |
| Ga0066679_103215721 | 3300005176 | Soil | MTCKREAGCWCAELPHVPMPAEAEGCLCRDCLLAKIEALQNPGKRKEA* |
| Ga0066689_102298642 | 3300005447 | Soil | MTCKQESGCWCAELPHVPMPADAEGCLCRNCLLAKIEALQNPGKRKEA* |
| Ga0066692_100176551 | 3300005555 | Soil | MTCKQESGCWCAELPHIPMPAGDEGCLCRDCLLARIAALQNPAKTKEV* |
| Ga0066692_106090962 | 3300005555 | Soil | MTCQPEGGCWCAELPHVQIPAGAKACLCSNCLRAKIEALRNPDKQKEA* |
| Ga0066691_101561432 | 3300005586 | Soil | MTCKQESGCWCAELPHVPMPADDEGCLCRNCLLAKIEALQKPANSKEA* |
| Ga0066706_104874571 | 3300005598 | Soil | MTCKPEGGCWCAELPHVPMPIGAEVCLCRNCLRAKIEALQNPGKRKEA* |
| Ga0066656_109511831 | 3300006034 | Soil | MTCQPEGGCWCAELPHVPMPTDAQGCLCRNCLRAKIEA |
| Ga0075028_1008889052 | 3300006050 | Watersheds | MTCQQEAGCWCAELPKIPMPANDEGCLCRSCLLAKIEALQRAAKS |
| Ga0075029_1000241262 | 3300006052 | Watersheds | MTCQQEAGCWCAELPKIPMPANDEGCLCRSCLLAKIEALQNPAKTKEA* |
| Ga0075030_1014254041 | 3300006162 | Watersheds | AAMTCQQDAGCWCAELPKIPMPANDEGCLCRSCLLAKIQALQNPAKTKEA* |
| Ga0099791_101543061 | 3300007255 | Vadose Zone Soil | MTCQQEGGCWCAELPHVPMPNGDEECLCRNCLLAKIEALKNPDKRKET* |
| Ga0099791_103072662 | 3300007255 | Vadose Zone Soil | MICKQEAGCWCAELPHVPMPADDEGCLCRNCLLAKIEAMQKSAKG |
| Ga0099793_100766522 | 3300007258 | Vadose Zone Soil | MTCQPEGGCWCSELPKIPMPADAEGCLCRNCLLAKIEALQNPGKRKEA* |
| Ga0099794_102033212 | 3300007265 | Vadose Zone Soil | MTCQPECGCWCAELPHVPMPADAEGCLCRNCLLAKIEALQKSGKAKEA* |
| Ga0099795_104319751 | 3300007788 | Vadose Zone Soil | AGCWCAELPHVPMPAGDEGCLCRRCLLAKIEALQKSGKIKQA* |
| Ga0066710_1000002579 | 3300009012 | Grasslands Soil | MTCQPEGGCWCAELPHVPMPTDAQGCLCRNCLRAKIEALENPGKRKEA |
| Ga0099829_101052322 | 3300009038 | Vadose Zone Soil | MTCQPEGGCWCAELPKVPMPTDAEGCLCRCCLRAKIEGLQNAGKRKEA* |
| Ga0099829_112150841 | 3300009038 | Vadose Zone Soil | MTCQPEGGCWCAELPHVPMPADAEGCLCRNCLLAKIEALQKSGKVKEA* |
| Ga0099829_114781742 | 3300009038 | Vadose Zone Soil | MTCQPEGGCWCAELPRIPMPDDAKGCLCRNCLLAKIEALQNPRKRKEA* |
| Ga0099829_115723922 | 3300009038 | Vadose Zone Soil | GCWCAELPPVVPMPPDAEGCLCRNCLLAKIEALQNSAKTKEA* |
| Ga0099830_100519012 | 3300009088 | Vadose Zone Soil | MTCQQESGCWCAELPHVPMLDDAEGCLCRNCLLAKIEALQNPAKAKEA* |
| Ga0099830_106315791 | 3300009088 | Vadose Zone Soil | MTCKQEGGCWCAELPHIPMPADSEGCLCRNCLLAK |
| Ga0099828_101438373 | 3300009089 | Vadose Zone Soil | MTCQPEGGCWCAELPHVPMPADAEGCLCRNCLRAKIEALQNSEKIKEA* |
| Ga0099828_102355323 | 3300009089 | Vadose Zone Soil | MTCKQESGCWCAELPHVPMPADDEGCLCRNCLLAKIEALQNPDKRKEA* |
| Ga0099828_112813742 | 3300009089 | Vadose Zone Soil | AAMTCQPEGGCWCAELPHVQIPAGAKACLCSNCLRAKIEALRNLDKQKEA* |
| Ga0099827_114425392 | 3300009090 | Vadose Zone Soil | CWCAELPHVVPMPADDEGCLCRNCLLAKIEALQNPAKSKEA* |
| Ga0099827_117863781 | 3300009090 | Vadose Zone Soil | MTCKQESGCWCAELPHIPMPAGDEGCLCRDCLLARIAALQNPAKTKEA* |
| Ga0066709_1004082132 | 3300009137 | Grasslands Soil | MTCKQESGCWCAELPHVPMPADVEGCLCRNCLLAKIEALQNPGKRKEA* |
| Ga0099792_110359192 | 3300009143 | Vadose Zone Soil | CGAAMTCKQESGCWCAELPHVAMPADAEGCRCRNCLLAKIEALQNPGKRKEA* |
| Ga0150983_159122581 | 3300011120 | Forest Soil | MICQPEGGCWCAELPRAPMPADAKGCLCSNCLRAKIESLQNSEKRKEA |
| Ga0137392_108499812 | 3300011269 | Vadose Zone Soil | MTCQPEGGCWCAELPHVPMPADDEGCLTRISLPAKIGSYQNPGKRQE |
| Ga0137392_110702651 | 3300011269 | Vadose Zone Soil | MTCKQEGGCWCAELPHIPMPADSEGCLCRNCLLAKIEALQNPAKRNEA* |
| Ga0137392_113961182 | 3300011269 | Vadose Zone Soil | GCWCAELPHVPMPTGDEGCLCRNCLLAKIEALKNPGKTKEA* |
| Ga0137391_103765652 | 3300011270 | Vadose Zone Soil | MTCQPEGGCWCAELPHVPMPADAEGCLCRNCLLAKIEALQKSGKVEEA* |
| Ga0137391_105064523 | 3300011270 | Vadose Zone Soil | MTCKPEAGCWCAELPHVPMPADAEGCLCRNCLLAKIEALQK |
| Ga0137391_107164123 | 3300011270 | Vadose Zone Soil | MTCKQESGCWCAELPHVPMPVADDGCLCRDCLLAKIEALQKAKTKEA* |
| Ga0137391_109199001 | 3300011270 | Vadose Zone Soil | TCQPEGGCWCAELPHVPMPADSEACLCQNCLRAKIEALQNPSNRKEA* |
| Ga0137393_104872462 | 3300011271 | Vadose Zone Soil | MTCQPEGGCWCAELPHVPMPADAESCLCRNCLRAKIEAFQNPGKRKEA* |
| Ga0137393_107932822 | 3300011271 | Vadose Zone Soil | MTCQQEAGCWCAELPHVPMPADDGGCLCRNCLLAKIEAMQKSGKGKEA* |
| Ga0137389_102393403 | 3300012096 | Vadose Zone Soil | MTCQPEGGCWCAELPKIPMPADAEGCLCRNCLRAKIEALQNSEKIKEA* |
| Ga0137389_105884362 | 3300012096 | Vadose Zone Soil | MTCKQEGGCWCAELPHVPMPADEEECLCRNCLLAKITALQNPIKSKEA* |
| Ga0137389_108990312 | 3300012096 | Vadose Zone Soil | MTCKPEGGCWCTELPKIPMPADAEGCLCRNCLLAKIEALQNPGKAKEA* |
| Ga0137388_101479832 | 3300012189 | Vadose Zone Soil | MTCKQESGCWCAELPHVPMPAETEGCLCRNCLLAKIEALHNHAKRKEA* |
| Ga0137388_101858741 | 3300012189 | Vadose Zone Soil | MTCKQEGGCWCAELPHVPMPADEEECLCRNCLLAKIEALQKSGERKEA* |
| Ga0137388_102785753 | 3300012189 | Vadose Zone Soil | AAMTCQQEAGCWCAELPHVPMSAGDEGCLCRNCLLAKIEALKNSAKTKEA* |
| Ga0137363_100033263 | 3300012202 | Vadose Zone Soil | MTCKPEAGCWCAELPHVPMPADDEGCLCRNCLLAKIEALQKSGERKEA* |
| Ga0137363_100099753 | 3300012202 | Vadose Zone Soil | MTCKQEAGCWCAELPHVPMPAEAEGCLCRNCLLAKIEALQNPGKRKEA* |
| Ga0137363_100184814 | 3300012202 | Vadose Zone Soil | MTCQQEAGCWCAELPHVPMPTGEEGCLCRNCLLAKIEALKNPCKSKEA* |
| Ga0137363_100551293 | 3300012202 | Vadose Zone Soil | MTCQPEGGCWCAELPHVPMPADAKGCLCRNCLLAKIEALQNPLKAKEA* |
| Ga0137363_107436392 | 3300012202 | Vadose Zone Soil | MTCQPEGGCWCAELPHVQKPAGAKACLCSNCLRAKIEALRNPDKQKEA* |
| Ga0137363_114527651 | 3300012202 | Vadose Zone Soil | MTCKQESGCWCAELPHVPMPAETEGCLCRNCLLAKIEA |
| Ga0137399_103031333 | 3300012203 | Vadose Zone Soil | EAGCWCAELPHVPMPADDEGCLCRNCLLAKIEALQKSGKTKEA* |
| Ga0137362_100197573 | 3300012205 | Vadose Zone Soil | MTCQQEAGCWCAELPHVPMPAGDEGCLCRNCLLAKIEALKNSAKTKEA* |
| Ga0137380_106467581 | 3300012206 | Vadose Zone Soil | AQCGAAMTCQPEGGCWCAELPHVQIPAGAKACLCSNCLRAKIEALRNLDKQKEA* |
| Ga0137381_100849392 | 3300012207 | Vadose Zone Soil | MTCRPEGGCWCAELPRVPMPADAMGCLCRDCLLAKIAALQKSGKTKEA* |
| Ga0137381_112090272 | 3300012207 | Vadose Zone Soil | AELPHVQIPAGAKACLCSNCLRAKIEALRNPDKQKEA* |
| Ga0137379_105720731 | 3300012209 | Vadose Zone Soil | MTCQQEAGCWCAELPRVPMPTDAEGCLCRDCLLAKIEALQNPVKTKEA* |
| Ga0137379_106958452 | 3300012209 | Vadose Zone Soil | EGGCWCAELPRVPMPADAMGCLCRDCLLAKIAALQKSGKTKEA* |
| Ga0137379_113987702 | 3300012209 | Vadose Zone Soil | EGGCWCAELPRVPMPADAMGCLCRDCLLAKIAGLQKSRKTKEA* |
| Ga0137370_100007074 | 3300012285 | Vadose Zone Soil | MTCKQESGCWCAELPHVPMPADAEGCLCRNCLLAKIEALQNPGKGKEA* |
| Ga0137387_110249082 | 3300012349 | Vadose Zone Soil | EGGCWCAELPKIPMPPDATGCLCRDCLLAKIVALQKSGKTKEA* |
| Ga0137366_109725451 | 3300012354 | Vadose Zone Soil | MTCQPEGGCWCTELPHVQIPAGAKACLCSNCLRAKIEALRNPDKQK |
| Ga0137384_111890582 | 3300012357 | Vadose Zone Soil | CQPEGGCWCAELPHVQIPAGAKACLCSNCLRARIEALRNPDKQKEA* |
| Ga0137360_105961362 | 3300012361 | Vadose Zone Soil | MTCKQEAGCWCAELPHVPMPADDEGCLCRNCLLAKIEALQKSGERKEA* |
| Ga0137360_106401592 | 3300012361 | Vadose Zone Soil | MTCKQESGCWCAELPHVPMPADAEGCRCRNCLLSKIEALQNPGKR |
| Ga0137361_102343021 | 3300012362 | Vadose Zone Soil | MICQKEPGCWCAELPHLPMLAEWQSSGCLCRACLLEKIK |
| Ga0137390_102115261 | 3300012363 | Vadose Zone Soil | MTCKPEGGCWCAELPHVPMPADAEGCLCRNCLLAKIEALQNPGKRK |
| Ga0137358_100364763 | 3300012582 | Vadose Zone Soil | MTCQPEGGCWCAELPHVPMPTDAEGCLCRNCLLAKIEALQNPGKTKEA* |
| Ga0137358_105527042 | 3300012582 | Vadose Zone Soil | AQCGAAMTCKPEAGCWCAELPHVPMPADDEGCLCRNCLLAKIEALEKSGERKEA* |
| Ga0137398_100192313 | 3300012683 | Vadose Zone Soil | MTCKQESGCWCAELPHVAMPADAEGCRCRNCLLAKIEALQNPGKRKEA* |
| Ga0137398_100619283 | 3300012683 | Vadose Zone Soil | MTCQQEAGCWCAELPHVPMPAGDEGCLCRNCLLAKIEALKNLA |
| Ga0137398_102297742 | 3300012683 | Vadose Zone Soil | AQCGAAMTCLQEAGCWCAELPKIPMPANDEGCLCRSCLMAKIEALQRVAKSREA* |
| Ga0137398_108238421 | 3300012683 | Vadose Zone Soil | AGCWCAELPHVPMPAGDEGCLCRNCLLAKIEALKNLAKTKEA* |
| Ga0137398_108389441 | 3300012683 | Vadose Zone Soil | MTCKQEAGCWCAELPHVPMPAGDEGCLCRNCLLAKIEGLEKSGKKREA* |
| Ga0137397_100342371 | 3300012685 | Vadose Zone Soil | GAAMTCKQEAGCWCAELPHVPMPADDEGCLCRNCLLAKIEALQNPGKTKEA* |
| Ga0137397_100568413 | 3300012685 | Vadose Zone Soil | MTCKPEAGCWCAELPHVPMPADDEGCLCRNCLLAKIEALEKSGERKEA* |
| Ga0137397_109615741 | 3300012685 | Vadose Zone Soil | GAAMTCKQEAGCWCAELPHVPMPADDEGCLCRNCLLAKIEALQKSGKTKEA* |
| Ga0137396_101786373 | 3300012918 | Vadose Zone Soil | MTCKPEGGCWCAELPKIPMPVDVEGCLCRNCLRAKIEALQNPGKTKEA* |
| Ga0137394_100231153 | 3300012922 | Vadose Zone Soil | MTCQPEGGCWCSELPKIPMPADAERCLCRNCLLAKIEALQNPGKRKEA* |
| Ga0137419_106829041 | 3300012925 | Vadose Zone Soil | QCGAAMICKQEAGCWCAELPHVPMPADDEGCLCRNCLLAKIEAMQKSAKGKEA* |
| Ga0137416_102997582 | 3300012927 | Vadose Zone Soil | MSCQPEGGCWCSELPKIPMPADAEGCLCRNCLLAKIEALQNPGKRKEA* |
| Ga0137404_106388931 | 3300012929 | Vadose Zone Soil | MTCRPEAGCWCAELPHVPMPADDEGCLCRNCLLAKIEALQKSGKTKEA* |
| Ga0137410_107252131 | 3300012944 | Vadose Zone Soil | CGAAMTCLQETGCWCAELPKIPMPANDEGCLCRSCLMAKIEALQRAAKSKEA* |
| Ga0137420_12642202 | 3300015054 | Vadose Zone Soil | CGAAMTCQQEAGCWCAELPKIPMPANDEGCLCRSCLMAKIEALQRVAKSREA* |
| Ga0137408_10617111 | 3300019789 | Vadose Zone Soil | MTCKQESGCWCAELPHVPMPADDEGCLCRNCLLAKIEALQKPANSKEA |
| Ga0193729_10001144 | 3300019887 | Soil | MTCKQESGCWCAELPHVPMPADAEGCLCRNCLLAKIEALQNPGKRKEA |
| Ga0179594_100860673 | 3300020170 | Vadose Zone Soil | MTCQPEGGCWCSELPKIPMPADAEGCLCRNCLLAKIEALQNPGKRKEA |
| Ga0179592_100029006 | 3300020199 | Vadose Zone Soil | MTCQPEGGCWCAELPKIPVPADVKGCLCRNCLLAKIEALQNPAKAKEA |
| Ga0210407_100212905 | 3300020579 | Soil | MTCQPEGGCWCAELPKIPMPADEQGCLCANCLRAKIAALQKSREREKV |
| Ga0210407_101633851 | 3300020579 | Soil | MTCKPEAGCWCAELPHVPMPADDEGCLCRNCLLARIEALQKSG |
| Ga0210407_104959842 | 3300020579 | Soil | MTCKQGPGCWCAELPHVPMPAGDEGCLCRNCLLAKIEALQNPAKSREA |
| Ga0210403_100188175 | 3300020580 | Soil | MTCQPQGGCWCAELPKIPMPADDEGCLCRNCLLAKIEALQNPGKRKEA |
| Ga0210399_101264733 | 3300020581 | Soil | MTCKPEGGCWCADLPRIPMPADATACLCRNCLVAKIAAIQKLREEKEA |
| Ga0210399_102046823 | 3300020581 | Soil | MTCLPEGGCWCAELPKIPTPADAEGCLCANCLRAKIAAIQESRKKREA |
| Ga0215015_103753731 | 3300021046 | Soil | MACQPEGGCWCAELPHVPMPADATGCLCLICLRAKIESLQNSEKQKEA |
| Ga0210404_102385882 | 3300021088 | Soil | MTCQPEGGCWCAELPHVPMPPEAEGCLCRNCLRAKIEALQNPGKKKEA |
| Ga0210406_100357963 | 3300021168 | Soil | MTCKPEGGCWCTELPKIPMPADAEGCLCRNCLLAKIEALQNPGKAKEA |
| Ga0210406_101433651 | 3300021168 | Soil | MTCQQEAGCWCAELPKIPMPANDEGCLCRDCLMAKIEALQRVAKSKEA |
| Ga0210400_10000016286 | 3300021170 | Soil | MTCKQGPGCWCAELPHVPMPADEEGCLCRNCLLAKIEGLQNSAKTKEA |
| Ga0210405_1000134910 | 3300021171 | Soil | MTCEQEAGCWCAELPHVPMPADEEGCLCRNCLLAKIEALQNPAKTKEA |
| Ga0210408_100103446 | 3300021178 | Soil | MTCEQQSGCWCAELPHIPMPADDEGCLCRNCLLAKIEALQNPAKRKEA |
| Ga0210408_106200901 | 3300021178 | Soil | MTCKQDAGCWCAELPHIPMPAGDEGCLCRNCLLAKIEALQNPAKSNEE |
| Ga0210408_113824532 | 3300021178 | Soil | MTCQQEAGCWCAELPHVPMPAEDEGCLCRNCLLAKIEALQKSGKAKET |
| Ga0210394_114754611 | 3300021420 | Soil | CGATMTCKLEGGCWCADMPRVPMSADATACLCRNCLVAKIAAIQKLREEKEA |
| Ga0210384_113660322 | 3300021432 | Soil | MTCKQDAGCWCAELPHVPMPAEDEGCLCRNCLLAKIEALQKSGERKEA |
| Ga0210402_100327403 | 3300021478 | Soil | MTCQQEPGCWCAELPHVPMPADDEGCLCRNCLLAKIEALQKSGKAKEA |
| Ga0209234_10075053 | 3300026295 | Grasslands Soil | MTCKQESGCWCAELPHVPMPADAEGCLCRNCLLAKIEALQNPGKGKEA |
| Ga0209236_13214271 | 3300026298 | Grasslands Soil | GGCWCAELPHVPMPADAKECLCRNCLLAKIAALQNPGKRKEA |
| Ga0209240_10038844 | 3300026304 | Grasslands Soil | MTCQPEGGCWCAELPHVPMPAGDEGCLCRNCLLAKIEALQNPAKTKEA |
| Ga0209240_10808562 | 3300026304 | Grasslands Soil | MTCQQEAGCWCAELPHVPMPAGDEGCLCRNCLLAKIEALKNLAKTKEA |
| Ga0209471_10892842 | 3300026318 | Soil | MTCKQEAGCWCAELPHVPMQAEGEGCLCRNCLLAKIEALQNPSKRKEA |
| Ga0209131_10180913 | 3300026320 | Grasslands Soil | MTCQPEGGCWCAELPHVPMPTDAEGCLCRNCLLAKIEALQNPGKTKEA |
| Ga0209131_11050882 | 3300026320 | Grasslands Soil | MTCKQESGCWCAELPHIPMPAGDEGCLCRDCLLARIAALQNPAKTKEV |
| Ga0209804_10075174 | 3300026335 | Soil | AMTCQPEGRCWCAKLPHVPMPAGAEGCLCRNCLAAKIEAVHNPGKTKDA |
| Ga0209648_1000074318 | 3300026551 | Grasslands Soil | MTCQPEGGCWCAELPHVPMPADAEGCLCRNCLLAKIEALQKSGKGKEA |
| Ga0209648_1000190813 | 3300026551 | Grasslands Soil | MTCQPEGGCWCAELPKIPMPADATGCLCRNCLLAKIEAMQNPAKAKEA |
| Ga0209648_100984852 | 3300026551 | Grasslands Soil | MTCKQESGCWCAELPHIPMPAGDEGCLCRNCLLARIAALQNPAKTKEA |
| Ga0209648_101003903 | 3300026551 | Grasslands Soil | MTCQPEGGCWCAELPHVPMPAVAKGCLCRNCLRATIEALQNSEKIKEA |
| Ga0209648_101764032 | 3300026551 | Grasslands Soil | MTCQPEGGCWCAELPHVPMPADAEGCLCRNCLLAKIEALQNPGKRKEA |
| Ga0179587_100056993 | 3300026557 | Vadose Zone Soil | MTCKQEAGCWCAELPHVPMPAEAEGCLCRNCLLAKIEALQNPGKRKEA |
| Ga0179587_100288654 | 3300026557 | Vadose Zone Soil | MTCQPEGGCWCSELPKIPMPADAEGCLCRNCLLAKIEALQNP |
| Ga0179587_104780371 | 3300026557 | Vadose Zone Soil | MTCKQEAGCWCAELPHVPMPADAEGCLCRNCLLAKIEALHNSAKRKEA |
| Ga0179587_109683542 | 3300026557 | Vadose Zone Soil | ESGCWCAELPHVPMPADEEGCLCRNCLLAKIEALQNPAKSKEA |
| Ga0209733_10273822 | 3300027591 | Forest Soil | MTCKPEGGCWCAELPKIPMPADAKGCLCRNCLLAKIEALQNPIKSKEA |
| Ga0209388_12166502 | 3300027655 | Vadose Zone Soil | AMSCQQDAGCWCAELPHVPMPAGDEGCLCRNCLLAKIEALKNPDKRKET |
| Ga0209588_10173141 | 3300027671 | Vadose Zone Soil | MTCQPEGGCWCAELPHVRMPIDAEGCLCRNCLLAKIDALQ |
| Ga0209588_11386592 | 3300027671 | Vadose Zone Soil | AMTCQQEGGCWCAELPHVPMPNGDEECLCRNCLLAKIEALKNLAKTKEA |
| Ga0209588_11933742 | 3300027671 | Vadose Zone Soil | MTCQPECGCWCAELPHVPMPADAEGCLCRNCLLAKIEALQKSGKAKEA |
| Ga0209118_10001884 | 3300027674 | Forest Soil | MTCQPEGGCWCAELPHVPMPANAEGCLCRPCLRAKIESLQNSEKRKEA |
| Ga0209118_10019212 | 3300027674 | Forest Soil | MSCLPEGGCWCAELPHIPMPADAEGCLCRNCLRAKIEALQKTGKRNEA |
| Ga0209689_12627422 | 3300027748 | Soil | MTCKREAGCWCAELPHVPMPAEAEGCLCRDCLLAKIEALQNPGKRKEA |
| Ga0209180_100547692 | 3300027846 | Vadose Zone Soil | MTCKQESGCWCAELPHVPMPADDEGCLCRNCLLAKIEALQNPDKRKEA |
| Ga0209180_100738663 | 3300027846 | Vadose Zone Soil | MTCQPEGGCWCAELPKVPMPTDAEGCLCRCCLRAKIEGLQNAGKRKEA |
| Ga0209180_100862054 | 3300027846 | Vadose Zone Soil | MTCQPEGGCWCAELPHVPMPADAEGCLCRNCLRAKIEALQNPGKRKEA |
| Ga0209180_102079001 | 3300027846 | Vadose Zone Soil | MTCQPEGGCWCAELPHVPMPADAEGCLCRNCLLAKIEALQKSGKVKEA |
| Ga0209701_100050593 | 3300027862 | Vadose Zone Soil | MTCQPEGGCWCAELPHVPMPADAEGCLCRNCLLAKIEALQKSGKVEEA |
| Ga0209701_100245442 | 3300027862 | Vadose Zone Soil | MTCQQESGCWCAELPHVPMLDDAEGCLCRNCLLAKIEALQNPAKAKEA |
| Ga0209701_101142341 | 3300027862 | Vadose Zone Soil | MTCQPEGGCWCAELPHVPMPADSEACLCQNCLRAKIEALQNPSN |
| Ga0209701_102339571 | 3300027862 | Vadose Zone Soil | MTCNQEIGCWCAELPHVPMPADDEGCLCRNCLLAKIEALQNPSKRRES |
| Ga0209283_105197011 | 3300027875 | Vadose Zone Soil | GGCWCAELPHVPMPADDEGCLCRNCLLAKIEALQEPSKRKEA |
| Ga0209283_108962131 | 3300027875 | Vadose Zone Soil | MTCKQESGCWCAELPHVPMPAGDEGCLCRNCLLAKIEALQNPTNRKEA |
| Ga0209698_100781912 | 3300027911 | Watersheds | MTCQQEAGCWCAELPKIPMPANDEGCLCRSCLLAKIEALQNPAKTKEA |
| Ga0209698_112608122 | 3300027911 | Watersheds | AAMTCQQDAGCWCAELPKIPMPANDEGCLCRSCLLAKIQALQNPAKTKEA |
| Ga0268266_105002991 | 3300028379 | Switchgrass Rhizosphere | TQAAGCWCAELPHVFAMPAPGGQDCLCPVCLRAKLEALKEGSPSV |
| Ga0073994_123569851 | 3300030991 | Soil | MTCQPEGGCWCAELPKIPMPADAEGCLCRNCLRAKIEALQNPGKT |
| Ga0170834_1009008622 | 3300031057 | Forest Soil | MICKQESGCWCADLPHVIPMPAADAESAGCLCRNCLLEKIKKTR |
| Ga0170823_123291192 | 3300031128 | Forest Soil | MICKQESGCWCADLPHVIPMPAADAESAGCLCRNCLLEKIK |
| Ga0170824_1243106522 | 3300031231 | Forest Soil | MICKQESGCWCADLPHVIPMPAADAESAGCLCRNCLLEKIKAAGASS |
| Ga0307476_100423052 | 3300031715 | Hardwood Forest Soil | MSCNPEGGCWCAELPHVVPMPADTQGCLCRKCLLAKIAALQNPEKTKEA |
| Ga0307469_104168042 | 3300031720 | Hardwood Forest Soil | MSCLPEGGCWCAELPKVPMPAEAEGCLCRNCLLAKIEALQKSGKRKEA |
| Ga0307477_100522103 | 3300031753 | Hardwood Forest Soil | MTCKQEPGCWCAELPHIPMPAGDEGCLCRNCLLAKIAALQNPAKTREA |
| Ga0307475_101514813 | 3300031754 | Hardwood Forest Soil | CKPEGGCWCTELPKIPMPADAEGCLCRNCLLAKIEALQNPGKAKEA |
| Ga0307475_101551583 | 3300031754 | Hardwood Forest Soil | MTCEQQSGCWCEELPHISMPADAEGCLCRNCLLAKIAALQNSAKTKEA |
| Ga0307475_109748582 | 3300031754 | Hardwood Forest Soil | EGGCWCAELPHVPMPANAEGCLCRTCLRAKIASLQSSEKQKEA |
| Ga0307475_109754482 | 3300031754 | Hardwood Forest Soil | MTCKQEAGCWCAELPHVPMPAGDEGCLCRDCLLAKIEALQNPAKTKEA |
| Ga0307475_111490332 | 3300031754 | Hardwood Forest Soil | MTCKQEAGCWCAALPHVPMPADAEGCLCRNCLLAKIEALQNAGKE |
| Ga0307475_112870111 | 3300031754 | Hardwood Forest Soil | MTCQPQGGCWCAELPKIPMPAGDEGCLCRNCLLAKIEALQNPGKRKEA |
| Ga0307475_113985621 | 3300031754 | Hardwood Forest Soil | CRPEGGCWCAELPHVPMPANAEGCLCRTCLRAKIESLQISERQKEA |
| Ga0307475_115469832 | 3300031754 | Hardwood Forest Soil | EGGCWCTELPKIPMPADAEGCLCRNCLLAKIEGLQNPGKAKQT |
| Ga0307478_113753321 | 3300031823 | Hardwood Forest Soil | MICKKEPGCWCADLPHVPMPAGDEGCLCRNCLLAKIAALQ |
| Ga0307478_114420371 | 3300031823 | Hardwood Forest Soil | MTCKQEAGCWCAELPHVPMPAGDEGCLCRDCLLAKIEALQNP |
| Ga0307479_100031087 | 3300031962 | Hardwood Forest Soil | MTCEQQSGCWCAELPPVPMPIGDEGCLCRNCLLAKIEALQNSAKSKKA |
| Ga0307479_100123442 | 3300031962 | Hardwood Forest Soil | MTCKQEAGCWCAALPHVPMPADAEGCLCRNCLLAKIEALQNAGKEKEA |
| Ga0307479_115805612 | 3300031962 | Hardwood Forest Soil | MTCHPEGGCWCAELPHVPMPANAEGCLCSACLRAKIESLQISEKQKEA |
| Ga0307471_1016550242 | 3300032180 | Hardwood Forest Soil | MNCLPEGGCWCAELPKVPMPAEAEGCLCRNCLLAKIEALQKSGKRKEA |
| Ga0335079_100032554 | 3300032783 | Soil | MICLPEGGCWCAELPHIPMPLDAKGCLCPKCLQEKIEALEKSSAKKET |
| Ga0335078_125974381 | 3300032805 | Soil | MICLPEGGCWCAEMPRVPMPTDAKGCLCHKCLQEKIEALEKS |
| Ga0335077_101860553 | 3300033158 | Soil | MICLPEGGCWCAEMPRVPMPTDAKGCLCPKCLQEKIEALEKSRETKEA |
| ⦗Top⦘ |