| Basic Information | |
|---|---|
| Family ID | F032488 |
| Family Type | Metagenome |
| Number of Sequences | 180 |
| Average Sequence Length | 39 residues |
| Representative Sequence | GMGDPMAPSEGEGNSEGGGSARRIASREAKRAGITRP |
| Number of Associated Samples | 72 |
| Number of Associated Scaffolds | 180 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 34.44 % |
| % of genes near scaffold ends (potentially truncated) | 68.33 % |
| % of genes from short scaffolds (< 2000 bps) | 78.33 % |
| Associated GOLD sequencing projects | 64 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.34 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (75.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil (28.889 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.556 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (37.778 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 20.00% β-sheet: 0.00% Coil/Unstructured: 80.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 180 Family Scaffolds |
|---|---|---|
| PF01979 | Amidohydro_1 | 2.22 |
| PF07075 | DUF1343 | 2.22 |
| PF02737 | 3HCDH_N | 2.22 |
| PF02771 | Acyl-CoA_dh_N | 1.67 |
| PF06071 | YchF-GTPase_C | 1.67 |
| PF00005 | ABC_tran | 1.67 |
| PF01668 | SmpB | 1.67 |
| PF01713 | Smr | 1.67 |
| PF12706 | Lactamase_B_2 | 1.67 |
| PF01926 | MMR_HSR1 | 1.67 |
| PF01380 | SIS | 1.67 |
| PF02662 | FlpD | 1.67 |
| PF00202 | Aminotran_3 | 1.67 |
| PF00970 | FAD_binding_6 | 1.11 |
| PF09339 | HTH_IclR | 1.11 |
| PF13193 | AMP-binding_C | 1.11 |
| PF04055 | Radical_SAM | 1.11 |
| PF09936 | Methyltrn_RNA_4 | 1.11 |
| PF04187 | Cofac_haem_bdg | 1.11 |
| PF03547 | Mem_trans | 1.11 |
| PF00465 | Fe-ADH | 1.11 |
| PF13742 | tRNA_anti_2 | 1.11 |
| PF07883 | Cupin_2 | 1.11 |
| PF08240 | ADH_N | 1.11 |
| PF01464 | SLT | 1.11 |
| PF05524 | PEP-utilisers_N | 1.11 |
| PF04879 | Molybdop_Fe4S4 | 1.11 |
| PF00266 | Aminotran_5 | 1.11 |
| PF01261 | AP_endonuc_2 | 1.11 |
| PF00701 | DHDPS | 1.11 |
| PF13421 | Band_7_1 | 0.56 |
| PF14691 | Fer4_20 | 0.56 |
| PF02545 | Maf | 0.56 |
| PF00380 | Ribosomal_S9 | 0.56 |
| PF12390 | Se-cys_synth_N | 0.56 |
| PF03054 | tRNA_Me_trans | 0.56 |
| PF06808 | DctM | 0.56 |
| PF01850 | PIN | 0.56 |
| PF04008 | Adenosine_kin | 0.56 |
| PF06792 | UPF0261 | 0.56 |
| PF01161 | PBP | 0.56 |
| PF09723 | Zn-ribbon_8 | 0.56 |
| PF12646 | DUF3783 | 0.56 |
| PF01245 | Ribosomal_L19 | 0.56 |
| PF00572 | Ribosomal_L13 | 0.56 |
| PF00291 | PALP | 0.56 |
| PF10050 | DUF2284 | 0.56 |
| PF00171 | Aldedh | 0.56 |
| PF00085 | Thioredoxin | 0.56 |
| PF03358 | FMN_red | 0.56 |
| PF01121 | CoaE | 0.56 |
| PF06245 | DUF1015 | 0.56 |
| PF13336 | AcetylCoA_hyd_C | 0.56 |
| PF13183 | Fer4_8 | 0.56 |
| PF01746 | tRNA_m1G_MT | 0.56 |
| PF01451 | LMWPc | 0.56 |
| PF13549 | ATP-grasp_5 | 0.56 |
| PF07238 | PilZ | 0.56 |
| PF08349 | DUF1722 | 0.56 |
| PF03446 | NAD_binding_2 | 0.56 |
| PF01653 | DNA_ligase_aden | 0.56 |
| PF09861 | Lar_N | 0.56 |
| PF00384 | Molybdopterin | 0.56 |
| PF02353 | CMAS | 0.56 |
| PF01855 | POR_N | 0.56 |
| PF02769 | AIRS_C | 0.56 |
| PF13237 | Fer4_10 | 0.56 |
| PF00300 | His_Phos_1 | 0.56 |
| PF00459 | Inositol_P | 0.56 |
| PF00226 | DnaJ | 0.56 |
| PF00072 | Response_reg | 0.56 |
| PF16697 | Yop-YscD_cpl | 0.56 |
| PF01882 | DUF58 | 0.56 |
| PF00365 | PFK | 0.56 |
| PF01963 | TraB_PrgY_gumN | 0.56 |
| PF02954 | HTH_8 | 0.56 |
| PF00528 | BPD_transp_1 | 0.56 |
| PF13361 | UvrD_C | 0.56 |
| PF13304 | AAA_21 | 0.56 |
| PF13607 | Succ_CoA_lig | 0.56 |
| PF12849 | PBP_like_2 | 0.56 |
| PF00753 | Lactamase_B | 0.56 |
| PF04073 | tRNA_edit | 0.56 |
| PF07690 | MFS_1 | 0.56 |
| PF00106 | adh_short | 0.56 |
| PF05402 | PqqD | 0.56 |
| PF03449 | GreA_GreB_N | 0.56 |
| PF02538 | Hydantoinase_B | 0.56 |
| PF01042 | Ribonuc_L-PSP | 0.56 |
| PF00892 | EamA | 0.56 |
| PF01609 | DDE_Tnp_1 | 0.56 |
| PF04191 | PEMT | 0.56 |
| PF00589 | Phage_integrase | 0.56 |
| PF06271 | RDD | 0.56 |
| PF05167 | DUF711 | 0.56 |
| PF04015 | DUF362 | 0.56 |
| PF00482 | T2SSF | 0.56 |
| PF10282 | Lactonase | 0.56 |
| PF02881 | SRP54_N | 0.56 |
| PF00069 | Pkinase | 0.56 |
| PF05973 | Gp49 | 0.56 |
| PF02913 | FAD-oxidase_C | 0.56 |
| PF00278 | Orn_DAP_Arg_deC | 0.56 |
| COG ID | Name | Functional Category | % Frequency in 180 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 2.22 |
| COG2084 | 3-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenase | Lipid transport and metabolism [I] | 2.22 |
| COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 2.22 |
| COG1748 | Saccharopine dehydrogenase, NADP-dependent | Amino acid transport and metabolism [E] | 2.22 |
| COG0329 | 4-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyase | Cell wall/membrane/envelope biogenesis [M] | 2.22 |
| COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 2.22 |
| COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 2.22 |
| COG0287 | Prephenate dehydrogenase | Amino acid transport and metabolism [E] | 2.22 |
| COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 2.22 |
| COG3876 | Exo-beta-N-acetylmuramidase YbbC/NamZ, DUF1343 family | Cell wall/membrane/envelope biogenesis [M] | 2.22 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 1.67 |
| COG0691 | tmRNA-binding protein | Posttranslational modification, protein turnover, chaperones [O] | 1.67 |
| COG0012 | Ribosome-binding ATPase YchF, GTP1/OBG family | Translation, ribosomal structure and biogenesis [J] | 1.67 |
| COG1908 | Coenzyme F420-reducing hydrogenase, delta subunit | Energy production and conversion [C] | 1.67 |
| COG3016 | Putative heme-binding protein PhuW | General function prediction only [R] | 1.11 |
| COG1454 | Alcohol dehydrogenase, class IV | Energy production and conversion [C] | 1.11 |
| COG0679 | Predicted permease, AEC (auxin efflux carrier) family | General function prediction only [R] | 1.11 |
| COG1979 | Alcohol dehydrogenase YqhD, Fe-dependent ADH family | Energy production and conversion [C] | 1.11 |
| COG0371 | Glycerol dehydrogenase or related enzyme, iron-containing ADH family | Energy production and conversion [C] | 1.11 |
| COG0337 | 3-dehydroquinate synthetase | Amino acid transport and metabolism [E] | 1.11 |
| COG0146 | N-methylhydantoinase B/oxoprolinase/acetone carboxylase, alpha subunit | Amino acid transport and metabolism [E] | 1.11 |
| COG4231 | TPP-dependent indolepyruvate ferredoxin oxidoreductase, alpha subunit | Energy production and conversion [C] | 0.56 |
| COG1714 | Uncharacterized membrane protein YckC, RDD family | Function unknown [S] | 0.56 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.56 |
| COG5441 | ATP-binding helicase-inhibiting domain, Tm-1/UPF0261 family | Defense mechanisms [V] | 0.56 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.56 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.56 |
| COG2227 | 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase | Coenzyme transport and metabolism [H] | 0.56 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.56 |
| COG2230 | Cyclopropane fatty-acyl-phospholipid synthase and related methyltransferases | Lipid transport and metabolism [I] | 0.56 |
| COG4679 | Phage-related protein gp49, toxin component of the Tad-Ata toxin-antitoxin system | Defense mechanisms [V] | 0.56 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.56 |
| COG2848 | Uncharacterized conserved protein, UPF0210 family | Cell cycle control, cell division, chromosome partitioning [D] | 0.56 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.56 |
| COG4198 | Uncharacterized conserved protein, DUF1015 family | Function unknown [S] | 0.56 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.56 |
| COG3657 | Putative component of the toxin-antitoxin plasmid stabilization module | Defense mechanisms [V] | 0.56 |
| COG3272 | Uncharacterized conserved protein YbgA, DUF1722 family | Function unknown [S] | 0.56 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.56 |
| COG0424 | 7-methyl-GTP pyrophosphatase and related NTP pyrophosphatases, Maf/HAM1 superfamily | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.56 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.56 |
| COG0019 | Diaminopimelate decarboxylase | Amino acid transport and metabolism [E] | 0.56 |
| COG0102 | Ribosomal protein L13 | Translation, ribosomal structure and biogenesis [J] | 0.56 |
| COG0103 | Ribosomal protein S9 | Translation, ribosomal structure and biogenesis [J] | 0.56 |
| COG0205 | 6-phosphofructokinase | Carbohydrate transport and metabolism [G] | 0.56 |
| COG0237 | Dephospho-CoA kinase | Coenzyme transport and metabolism [H] | 0.56 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.56 |
| COG0272 | NAD-dependent DNA ligase | Replication, recombination and repair [L] | 0.56 |
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.56 |
| COG0335 | Ribosomal protein L19 | Translation, ribosomal structure and biogenesis [J] | 0.56 |
| COG2006 | Uncharacterized conserved protein, DUF362 family | Function unknown [S] | 0.56 |
| COG0482 | tRNA U34 2-thiouridine synthase MnmA/TrmU, contains the PP-loop ATPase domain | Translation, ribosomal structure and biogenesis [J] | 0.56 |
| COG0674 | Pyruvate:ferredoxin oxidoreductase or related 2-oxoacid:ferredoxin oxidoreductase, alpha subunit | Energy production and conversion [C] | 0.56 |
| COG0782 | Transcription elongation factor, GreA/GreB family | Transcription [K] | 0.56 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.56 |
| COG1166 | Arginine decarboxylase (spermidine biosynthesis) | Amino acid transport and metabolism [E] | 0.56 |
| COG1721 | Uncharacterized conserved protein, DUF58 family, contains vWF domain | Function unknown [S] | 0.56 |
| COG1839 | Adenosine/AMP kinase | Nucleotide transport and metabolism [F] | 0.56 |
| COG1881 | Uncharacterized conserved protein, phosphatidylethanolamine-binding protein (PEBP) family | General function prediction only [R] | 0.56 |
| COG1916 | Pheromone shutdown protein TraB, contains GTxH motif (function unknown) | Function unknown [S] | 0.56 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 75.00 % |
| Unclassified | root | N/A | 25.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000231|TB_LI09_4DRAFT_10002197 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → delta proteobacterium NaphS2 | 9432 | Open in IMG/M |
| 3300000231|TB_LI09_4DRAFT_10002996 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → delta proteobacterium NaphS2 | 8217 | Open in IMG/M |
| 3300000231|TB_LI09_4DRAFT_10007664 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → delta proteobacterium NaphS2 | 5140 | Open in IMG/M |
| 3300000231|TB_LI09_4DRAFT_10009472 | All Organisms → cellular organisms → Bacteria | 4595 | Open in IMG/M |
| 3300000231|TB_LI09_4DRAFT_10105267 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 1022 | Open in IMG/M |
| 3300000231|TB_LI09_4DRAFT_10163771 | Not Available | 743 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_108233766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 558 | Open in IMG/M |
| 3300001371|BBDRAFT_10418547 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300001371|BBDRAFT_10444401 | Not Available | 571 | Open in IMG/M |
| 3300003541|JGI20214J51650_11090757 | Not Available | 556 | Open in IMG/M |
| 3300003858|Ga0031656_10011972 | All Organisms → cellular organisms → Bacteria | 3631 | Open in IMG/M |
| 3300003858|Ga0031656_10068995 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 1350 | Open in IMG/M |
| 3300003858|Ga0031656_10206451 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 673 | Open in IMG/M |
| 3300003859|Ga0031653_10078929 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 869 | Open in IMG/M |
| 3300004048|Ga0055494_10161208 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 523 | Open in IMG/M |
| 3300004072|Ga0055512_10158643 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 500 | Open in IMG/M |
| 3300004146|Ga0055495_10010388 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatiglans → Desulfatiglans anilini | 1434 | Open in IMG/M |
| 3300005254|Ga0068714_10131690 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1162 | Open in IMG/M |
| 3300005832|Ga0074469_10047728 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 4652 | Open in IMG/M |
| 3300005832|Ga0074469_10185021 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 85293 | Open in IMG/M |
| 3300005832|Ga0074469_10283077 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 59595 | Open in IMG/M |
| 3300005832|Ga0074469_10554715 | All Organisms → cellular organisms → Bacteria | 1998 | Open in IMG/M |
| 3300005832|Ga0074469_10878184 | All Organisms → cellular organisms → Bacteria | 2517 | Open in IMG/M |
| 3300005832|Ga0074469_11101413 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5963 | Open in IMG/M |
| 3300005832|Ga0074469_11160845 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatiglans → Desulfatiglans anilini | 5649 | Open in IMG/M |
| 3300006224|Ga0079037_100000789 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 15338 | Open in IMG/M |
| 3300006224|Ga0079037_100009606 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 6196 | Open in IMG/M |
| 3300006224|Ga0079037_100031117 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfosarcina → Desulfosarcina variabilis | 3947 | Open in IMG/M |
| 3300006224|Ga0079037_100056614 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → delta proteobacterium NaphS2 | 3098 | Open in IMG/M |
| 3300006224|Ga0079037_100191038 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1830 | Open in IMG/M |
| 3300006224|Ga0079037_100303934 | All Organisms → cellular organisms → Bacteria | 1480 | Open in IMG/M |
| 3300006224|Ga0079037_100410119 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatiglans → Desulfatiglans anilini | 1284 | Open in IMG/M |
| 3300006224|Ga0079037_100545866 | All Organisms → cellular organisms → Bacteria | 1118 | Open in IMG/M |
| 3300006224|Ga0079037_100618905 | Not Available | 1051 | Open in IMG/M |
| 3300006224|Ga0079037_100637291 | All Organisms → cellular organisms → Bacteria | 1036 | Open in IMG/M |
| 3300006224|Ga0079037_100704133 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 986 | Open in IMG/M |
| 3300006224|Ga0079037_100759059 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 950 | Open in IMG/M |
| 3300006224|Ga0079037_100843342 | All Organisms → cellular organisms → Bacteria | 901 | Open in IMG/M |
| 3300006224|Ga0079037_100898259 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
| 3300006224|Ga0079037_100974384 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
| 3300006224|Ga0079037_101027027 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 816 | Open in IMG/M |
| 3300006224|Ga0079037_101219022 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300006224|Ga0079037_101295067 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 725 | Open in IMG/M |
| 3300006224|Ga0079037_101371313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium SG8_13 | 704 | Open in IMG/M |
| 3300006224|Ga0079037_101390191 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 699 | Open in IMG/M |
| 3300006224|Ga0079037_101398295 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300006224|Ga0079037_101434694 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300006224|Ga0079037_101615273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 647 | Open in IMG/M |
| 3300006224|Ga0079037_101630092 | Not Available | 644 | Open in IMG/M |
| 3300006224|Ga0079037_101813199 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 609 | Open in IMG/M |
| 3300006224|Ga0079037_101854604 | Not Available | 602 | Open in IMG/M |
| 3300006224|Ga0079037_101915290 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300006224|Ga0079037_101926910 | Not Available | 591 | Open in IMG/M |
| 3300006224|Ga0079037_102203420 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 550 | Open in IMG/M |
| 3300006224|Ga0079037_102372289 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 529 | Open in IMG/M |
| 3300006224|Ga0079037_102398489 | Not Available | 526 | Open in IMG/M |
| 3300006224|Ga0079037_102441236 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 521 | Open in IMG/M |
| 3300006224|Ga0079037_102476331 | Not Available | 517 | Open in IMG/M |
| 3300006930|Ga0079303_10010117 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2807 | Open in IMG/M |
| 3300006930|Ga0079303_10024748 | All Organisms → cellular organisms → Bacteria | 1967 | Open in IMG/M |
| 3300006930|Ga0079303_10038775 | All Organisms → cellular organisms → Bacteria | 1639 | Open in IMG/M |
| 3300006930|Ga0079303_10087714 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1158 | Open in IMG/M |
| 3300006930|Ga0079303_10159278 | Not Available | 886 | Open in IMG/M |
| 3300006930|Ga0079303_10348774 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 620 | Open in IMG/M |
| 3300006930|Ga0079303_10358773 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 612 | Open in IMG/M |
| 3300006930|Ga0079303_10398747 | Not Available | 583 | Open in IMG/M |
| 3300007072|Ga0073932_1002810 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 25496 | Open in IMG/M |
| 3300007072|Ga0073932_1004518 | All Organisms → cellular organisms → Bacteria | 16375 | Open in IMG/M |
| 3300009078|Ga0105106_10027625 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 4191 | Open in IMG/M |
| 3300009078|Ga0105106_10775172 | Not Available | 684 | Open in IMG/M |
| 3300009082|Ga0105099_10215113 | Not Available | 1104 | Open in IMG/M |
| 3300009091|Ga0102851_10496259 | Not Available | 1254 | Open in IMG/M |
| 3300009091|Ga0102851_12451767 | Not Available | 596 | Open in IMG/M |
| 3300009111|Ga0115026_10048886 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2324 | Open in IMG/M |
| 3300009111|Ga0115026_10368816 | Not Available | 1030 | Open in IMG/M |
| 3300009131|Ga0115027_10254544 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1154 | Open in IMG/M |
| 3300009131|Ga0115027_10714742 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 753 | Open in IMG/M |
| 3300009153|Ga0105094_10106677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1583 | Open in IMG/M |
| 3300009166|Ga0105100_10045237 | All Organisms → cellular organisms → Bacteria | 2554 | Open in IMG/M |
| 3300009166|Ga0105100_10494206 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfosarcina → Desulfosarcina ovata | 745 | Open in IMG/M |
| 3300009166|Ga0105100_10494250 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 745 | Open in IMG/M |
| 3300009167|Ga0113563_10038769 | All Organisms → cellular organisms → Bacteria | 3898 | Open in IMG/M |
| 3300009167|Ga0113563_11081259 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 928 | Open in IMG/M |
| 3300009179|Ga0115028_10034920 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales | 2384 | Open in IMG/M |
| 3300009179|Ga0115028_10076061 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium | 1811 | Open in IMG/M |
| 3300009179|Ga0115028_10080059 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1778 | Open in IMG/M |
| 3300009179|Ga0115028_11156201 | Not Available | 634 | Open in IMG/M |
| 3300010413|Ga0136851_10469620 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales | 1258 | Open in IMG/M |
| 3300011340|Ga0151652_12040042 | All Organisms → cellular organisms → Bacteria | 1072 | Open in IMG/M |
| 3300014313|Ga0075347_1028829 | All Organisms → cellular organisms → Bacteria | 1072 | Open in IMG/M |
| 3300014315|Ga0075350_1029111 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1098 | Open in IMG/M |
| 3300014319|Ga0075348_1082189 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 788 | Open in IMG/M |
| 3300018068|Ga0184636_1118380 | Not Available | 917 | Open in IMG/M |
| 3300018070|Ga0184631_10150354 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
| 3300025950|Ga0210134_1004150 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales | 2157 | Open in IMG/M |
| 3300025950|Ga0210134_1015905 | Not Available | 1059 | Open in IMG/M |
| 3300025958|Ga0210069_1011954 | All Organisms → cellular organisms → Bacteria | 1159 | Open in IMG/M |
| 3300025968|Ga0210103_1010501 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1646 | Open in IMG/M |
| 3300026477|Ga0256807_1061680 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 638 | Open in IMG/M |
| 3300026501|Ga0256806_1000321 | All Organisms → cellular organisms → Bacteria | 4954 | Open in IMG/M |
| 3300026501|Ga0256806_1001553 | All Organisms → cellular organisms → Bacteria | 2970 | Open in IMG/M |
| 3300027715|Ga0208665_10112905 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
| 3300027721|Ga0209492_1155671 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 796 | Open in IMG/M |
| 3300027811|Ga0256868_10069709 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales | 1591 | Open in IMG/M |
| 3300027871|Ga0209397_10111833 | All Organisms → cellular organisms → Bacteria | 1162 | Open in IMG/M |
| 3300027871|Ga0209397_10335175 | Not Available | 730 | Open in IMG/M |
| 3300027877|Ga0209293_10079977 | All Organisms → cellular organisms → Bacteria | 1431 | Open in IMG/M |
| 3300027877|Ga0209293_10252047 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 884 | Open in IMG/M |
| 3300027890|Ga0209496_10551478 | Not Available | 618 | Open in IMG/M |
| 3300027899|Ga0209668_10478964 | Not Available | 823 | Open in IMG/M |
| 3300027900|Ga0209253_10091558 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2497 | Open in IMG/M |
| 3300027900|Ga0209253_10228713 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1472 | Open in IMG/M |
| 3300030613|Ga0299915_10164609 | Not Available | 1584 | Open in IMG/M |
| 3300031834|Ga0315290_10802307 | Not Available | 805 | Open in IMG/M |
| 3300031873|Ga0315297_11601800 | Not Available | 523 | Open in IMG/M |
| 3300032143|Ga0315292_10414289 | Not Available | 1132 | Open in IMG/M |
| 3300032143|Ga0315292_11608580 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300032156|Ga0315295_10500404 | Not Available | 1235 | Open in IMG/M |
| 3300032163|Ga0315281_11382972 | Not Available | 694 | Open in IMG/M |
| 3300032164|Ga0315283_12482252 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 502 | Open in IMG/M |
| 3300032177|Ga0315276_10385462 | All Organisms → cellular organisms → Bacteria | 1499 | Open in IMG/M |
| 3300032177|Ga0315276_10834101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 985 | Open in IMG/M |
| 3300032177|Ga0315276_11603781 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales | 674 | Open in IMG/M |
| 3300032342|Ga0315286_11171777 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
| 3300032397|Ga0315287_12172298 | Not Available | 606 | Open in IMG/M |
| 3300032516|Ga0315273_10173594 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 2953 | Open in IMG/M |
| 3300032516|Ga0315273_10719815 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1309 | Open in IMG/M |
| 3300033406|Ga0316604_10056629 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfosarcina → Desulfosarcina variabilis | 2016 | Open in IMG/M |
| 3300033406|Ga0316604_10153243 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1233 | Open in IMG/M |
| 3300033406|Ga0316604_10167597 | All Organisms → cellular organisms → Bacteria | 1178 | Open in IMG/M |
| 3300033406|Ga0316604_10697281 | Not Available | 558 | Open in IMG/M |
| 3300033408|Ga0316605_10051511 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2920 | Open in IMG/M |
| 3300033408|Ga0316605_10172949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1784 | Open in IMG/M |
| 3300033408|Ga0316605_10536553 | All Organisms → cellular organisms → Bacteria | 1083 | Open in IMG/M |
| 3300033408|Ga0316605_11137172 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 753 | Open in IMG/M |
| 3300033413|Ga0316603_10248425 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1544 | Open in IMG/M |
| 3300033413|Ga0316603_10463410 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 1157 | Open in IMG/M |
| 3300033413|Ga0316603_10641432 | Not Available | 988 | Open in IMG/M |
| 3300033413|Ga0316603_11698066 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300033413|Ga0316603_12339616 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 503 | Open in IMG/M |
| 3300033414|Ga0316619_10158645 | All Organisms → cellular organisms → Bacteria | 1568 | Open in IMG/M |
| 3300033414|Ga0316619_10306801 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatiglans → Desulfatiglans anilini | 1213 | Open in IMG/M |
| 3300033414|Ga0316619_10537798 | Not Available | 959 | Open in IMG/M |
| 3300033414|Ga0316619_11383891 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 627 | Open in IMG/M |
| 3300033416|Ga0316622_101249328 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
| 3300033416|Ga0316622_101321940 | Not Available | 843 | Open in IMG/M |
| 3300033418|Ga0316625_101877607 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 584 | Open in IMG/M |
| 3300033419|Ga0316601_100000517 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 16761 | Open in IMG/M |
| 3300033419|Ga0316601_100662989 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1020 | Open in IMG/M |
| 3300033419|Ga0316601_101060548 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 810 | Open in IMG/M |
| 3300033419|Ga0316601_101245884 | Not Available | 746 | Open in IMG/M |
| 3300033433|Ga0326726_12269171 | Not Available | 527 | Open in IMG/M |
| 3300033434|Ga0316613_10099788 | All Organisms → cellular organisms → Bacteria | 1767 | Open in IMG/M |
| 3300033480|Ga0316620_10039077 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3118 | Open in IMG/M |
| 3300033480|Ga0316620_10902553 | Not Available | 854 | Open in IMG/M |
| 3300033480|Ga0316620_10950230 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 833 | Open in IMG/M |
| 3300033481|Ga0316600_11006239 | Not Available | 590 | Open in IMG/M |
| 3300033483|Ga0316629_10011849 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfosarcina → Desulfosarcina variabilis | 3338 | Open in IMG/M |
| 3300033485|Ga0316626_10570579 | All Organisms → cellular organisms → Bacteria | 972 | Open in IMG/M |
| 3300033487|Ga0316630_10023447 | All Organisms → cellular organisms → Bacteria | 3408 | Open in IMG/M |
| 3300033487|Ga0316630_10116206 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1826 | Open in IMG/M |
| 3300033487|Ga0316630_10171473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 1561 | Open in IMG/M |
| 3300033487|Ga0316630_10363281 | Not Available | 1141 | Open in IMG/M |
| 3300033487|Ga0316630_10919860 | Not Available | 759 | Open in IMG/M |
| 3300033493|Ga0316631_10073146 | All Organisms → cellular organisms → Bacteria | 1161 | Open in IMG/M |
| 3300033493|Ga0316631_10181247 | Not Available | 800 | Open in IMG/M |
| 3300033493|Ga0316631_10206752 | Not Available | 756 | Open in IMG/M |
| 3300033513|Ga0316628_100138457 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2824 | Open in IMG/M |
| 3300033513|Ga0316628_100199134 | All Organisms → cellular organisms → Bacteria | 2404 | Open in IMG/M |
| 3300033513|Ga0316628_102328916 | Not Available | 709 | Open in IMG/M |
| 3300033513|Ga0316628_102425123 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Desulfomonile → Desulfomonile tiedjei → Desulfomonile tiedjei DSM 6799 | 693 | Open in IMG/M |
| 3300033513|Ga0316628_103907466 | Not Available | 533 | Open in IMG/M |
| 3300033521|Ga0316616_100033675 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3714 | Open in IMG/M |
| 3300033521|Ga0316616_100155765 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2176 | Open in IMG/M |
| 3300033521|Ga0316616_101052445 | All Organisms → cellular organisms → Bacteria | 1020 | Open in IMG/M |
| 3300033521|Ga0316616_101541447 | Not Available | 863 | Open in IMG/M |
| 3300033521|Ga0316616_102848864 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC10 → unclassified candidate division NC10 → candidate division NC10 bacterium RBG_16_65_8 | 651 | Open in IMG/M |
| 3300033557|Ga0316617_100105119 | Not Available | 2006 | Open in IMG/M |
| 3300033557|Ga0316617_101178126 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 759 | Open in IMG/M |
| 3300033557|Ga0316617_102026384 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium ADurb.BinA179 | 591 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 28.89% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 20.56% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 7.78% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 7.22% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 5.00% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 4.44% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 3.89% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 3.89% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 3.89% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Cave Water → Groundwater | 3.33% |
| Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment | 1.67% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.67% |
| Marine Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine Estuarine | 1.11% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 1.11% |
| Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 1.11% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.11% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.11% |
| Wetland | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Wetland | 0.56% |
| Mangrove Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment | 0.56% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.56% |
| Enrichment Culture | Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Enrichment Culture | 0.56% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000231 | Groundwater microbial communities from subsurface biofilms in sulfidic aquifier in Frasassi Gorge, Italy, sample from two redox zones- LI09_4 | Environmental | Open in IMG/M |
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300001371 | Baker-B-sed | Environmental | Open in IMG/M |
| 3300003541 | Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 Bulk | Environmental | Open in IMG/M |
| 3300003858 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI | Environmental | Open in IMG/M |
| 3300003859 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR | Environmental | Open in IMG/M |
| 3300004048 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleA_D2 | Environmental | Open in IMG/M |
| 3300004072 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_TuleA_D2 | Environmental | Open in IMG/M |
| 3300004146 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleB_D2 | Environmental | Open in IMG/M |
| 3300005254 | Enrichment culture microbial communities from rom New York Harbor, USA that are MTBE-degrading - MTBE-NYH (New York Harbor Sulfidogenic) MetaG | Engineered | Open in IMG/M |
| 3300005832 | Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.41_BBB | Environmental | Open in IMG/M |
| 3300006224 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300006930 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWC | Environmental | Open in IMG/M |
| 3300007072 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Dewar Creek DC9 2012 metaG | Environmental | Open in IMG/M |
| 3300009078 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300009111 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 | Environmental | Open in IMG/M |
| 3300009131 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 | Environmental | Open in IMG/M |
| 3300009153 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
| 3300009166 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
| 3300009179 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 | Environmental | Open in IMG/M |
| 3300010413 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_9 | Environmental | Open in IMG/M |
| 3300011340 | Combined Assembly of Wetland Metatranscriptomes | Environmental | Open in IMG/M |
| 3300014313 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLC_D1 | Environmental | Open in IMG/M |
| 3300014315 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleC_D1 | Environmental | Open in IMG/M |
| 3300014319 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleA_D1 | Environmental | Open in IMG/M |
| 3300018068 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_b2 | Environmental | Open in IMG/M |
| 3300018070 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_b1 | Environmental | Open in IMG/M |
| 3300025950 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025958 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025968 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026477 | Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 10-16 PR5 | Environmental | Open in IMG/M |
| 3300026501 | Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 10-16 PR4 | Environmental | Open in IMG/M |
| 3300027715 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWC (SPAdes) | Environmental | Open in IMG/M |
| 3300027721 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027811 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT92D227 HiSeq | Environmental | Open in IMG/M |
| 3300027871 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027877 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027890 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
| 3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
| 3300030613 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT92D227 | Environmental | Open in IMG/M |
| 3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
| 3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
| 3300032143 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0 | Environmental | Open in IMG/M |
| 3300032156 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0 | Environmental | Open in IMG/M |
| 3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
| 3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
| 3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
| 3300032342 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0 | Environmental | Open in IMG/M |
| 3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
| 3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
| 3300033406 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_CT | Environmental | Open in IMG/M |
| 3300033408 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT | Environmental | Open in IMG/M |
| 3300033413 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCT | Environmental | Open in IMG/M |
| 3300033414 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_B | Environmental | Open in IMG/M |
| 3300033416 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033419 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033434 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_CT_b | Environmental | Open in IMG/M |
| 3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
| 3300033481 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_CT | Environmental | Open in IMG/M |
| 3300033483 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033485 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D5_A | Environmental | Open in IMG/M |
| 3300033487 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_A | Environmental | Open in IMG/M |
| 3300033493 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D3_A | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
| 3300033557 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| TB_LI09_4DRAFT_1000219710 | 3300000231 | Groundwater | MGDPMAPSEREGNSEGGGSARRIASREAKRAGITRP* |
| TB_LI09_4DRAFT_100029967 | 3300000231 | Groundwater | MGDLMAPSGCEGNSEGGGSARRIASREAKRAGITRP* |
| TB_LI09_4DRAFT_100076645 | 3300000231 | Groundwater | MGDPMAPSEREGNSEGGGSARRIASREAKRAGITRS* |
| TB_LI09_4DRAFT_100094722 | 3300000231 | Groundwater | MGDSMAPSEREGNSEGGGSARRIASREAKRAGITRQ* |
| TB_LI09_4DRAFT_101052672 | 3300000231 | Groundwater | MGDPMAPSEREGNSEGGGSARRIASRKAKRAGITRP* |
| TB_LI09_4DRAFT_101637711 | 3300000231 | Groundwater | MGDPMAPSEGEGNSEGGGSARRTASREAKRAGITRP* |
| JGIcombinedJ13530_1082337662 | 3300001213 | Wetland | MGDLMAPSAREGKSEEGGGARRIASRQAKRAGITR |
| BBDRAFT_104185472 | 3300001371 | Marine Estuarine | MGDPMAPSDSEGNSEGGSRARWVASLEAKRAGITRP* |
| BBDRAFT_104444011 | 3300001371 | Marine Estuarine | MGDPMAPSECAGNSEGGGPARRVASRQAKRAGITRP* |
| JGI20214J51650_110907571 | 3300003541 | Wetland | FLISWSYGMGDPMAPSEREGNSEGGGTARRFASRQAKRAGITRP* |
| Ga0031656_100119721 | 3300003858 | Freshwater Lake Sediment | FLISWSYGMGDPMAPSEREGNSEGGGCARRIASRQAKRAGITRP* |
| Ga0031656_100689953 | 3300003858 | Freshwater Lake Sediment | FLISWSYGMGDPMAPSEGEGNSEGGGSARRIASCEAKRAGITRP* |
| Ga0031656_102064511 | 3300003858 | Freshwater Lake Sediment | SWSYGMGDPMAPSEREGNREGGGSARRIASRKAKRAGITRP* |
| Ga0031653_100789292 | 3300003859 | Freshwater Lake Sediment | ISWSYGMGDPMAPSEREGNSEGGGTARRFASRQAKRAGITRP* |
| Ga0055494_101612082 | 3300004048 | Natural And Restored Wetlands | AFLISWSYGMGDPMAPSESEGNSEGGGCARRIASRQAKRAGITRP* |
| Ga0055512_101586432 | 3300004072 | Natural And Restored Wetlands | WSYGMGDPMAPSEREGNSEGGGTARRFASREATRAGVTRP* |
| Ga0055495_100103881 | 3300004146 | Natural And Restored Wetlands | LISWSYGMGDPMAPSEREGNSEGGGRARRIASRQVKRAGITRP* |
| Ga0068714_101316901 | 3300005254 | Enrichment Culture | WSYGMGDPMAPSEREGNSEGGGTARRFASREAKRAGITRP* |
| Ga0074469_100477285 | 3300005832 | Sediment (Intertidal) | MGDPMAPSDSEGNSEGGGRARWFASREAKRAGITRP* |
| Ga0074469_1018502112 | 3300005832 | Sediment (Intertidal) | MGDPMVPSEREGNSEGGGRARRIASREAKRAGITRP* |
| Ga0074469_1028307743 | 3300005832 | Sediment (Intertidal) | MEGPMAPSDSEGNSEGGGRARWVASREAKRAGITRP* |
| Ga0074469_105547153 | 3300005832 | Sediment (Intertidal) | SWSYGMGDPMAPSDSEGNSEGKGRARWFASRQAKRAGITRP* |
| Ga0074469_108781841 | 3300005832 | Sediment (Intertidal) | LISSSYGMGDPMAPSDSEGNSEGGGRARRIASRQAKRAGITRA* |
| Ga0074469_111014134 | 3300005832 | Sediment (Intertidal) | MGDPMAPSGSEGNSEGGGRARWFASRKAKRAGITRL* |
| Ga0074469_111608459 | 3300005832 | Sediment (Intertidal) | REAFLISWSYGMGDPMAPSDSEGGGRARRVASREAKRAGITRP* |
| Ga0079037_1000007893 | 3300006224 | Freshwater Wetlands | MGNPMAPSGGEGNSEGGGRARRFASRQAKRAGITRP* |
| Ga0079037_1000096066 | 3300006224 | Freshwater Wetlands | MGDPMAPSGSEGNSEGGGSARRIASLLARRAGLTRP* |
| Ga0079037_1000311176 | 3300006224 | Freshwater Wetlands | FLISWSYGMGDPMAPSEGEGNSEGGGSARRIASREATRAGITRP* |
| Ga0079037_1000566145 | 3300006224 | Freshwater Wetlands | MGDPMALSEGEGNSEGGGSARRIASRQAKRAGLTRP* |
| Ga0079037_1001910381 | 3300006224 | Freshwater Wetlands | GMGDPMAPSEGEGNSEGGGSARRIASREAKRAGITRP* |
| Ga0079037_1003039341 | 3300006224 | Freshwater Wetlands | AFLISWSYGMGDPMAPSEREGNSEGGGSACRIVSRQAKRAGITRP* |
| Ga0079037_1004101192 | 3300006224 | Freshwater Wetlands | MGDPMALSGSEGNSEGGGSARWFASRKAKRAGITRA* |
| Ga0079037_1005458662 | 3300006224 | Freshwater Wetlands | MGDPMAPSEGEGNSEGGGSARRFASREAKRAGITRP* |
| Ga0079037_1006189051 | 3300006224 | Freshwater Wetlands | MGDPMAPSEREGNSEGGGSARRIASRQAKRAGLTRP* |
| Ga0079037_1006372911 | 3300006224 | Freshwater Wetlands | MGDPMAPSEGEGHSEGGGSARRIASLLAKRAGLTRP* |
| Ga0079037_1007041332 | 3300006224 | Freshwater Wetlands | MGDPMAPSEGEGNSEGGGIAREVASRKAKRAGITRP* |
| Ga0079037_1007590592 | 3300006224 | Freshwater Wetlands | MGDPMAPSEGEGNSEGGGSARRFASLEAKRAGTTRP* |
| Ga0079037_1008433422 | 3300006224 | Freshwater Wetlands | MGDPMAPSEGEGNSEGGGGARWFASREAKRAGITRP* |
| Ga0079037_1008982592 | 3300006224 | Freshwater Wetlands | MGDPMAPSEREGNSEGGGTARRFASHQAKRAGITRP* |
| Ga0079037_1009743841 | 3300006224 | Freshwater Wetlands | MGDPMAPSDSEGNSEGGGTARWFASREAKRAGITRS* |
| Ga0079037_1010270272 | 3300006224 | Freshwater Wetlands | MGDPMAPSDREGNSEGGGTARWFASRKAKRAGITRP* |
| Ga0079037_1012190222 | 3300006224 | Freshwater Wetlands | FLISWSYGMGDPMAPSVSEGNSEGGGTARWFASREAKRAGITRP* |
| Ga0079037_1012950672 | 3300006224 | Freshwater Wetlands | MGDPMAPSDSEGNSEGGGSARRFASRKARRAGITRP* |
| Ga0079037_1013713132 | 3300006224 | Freshwater Wetlands | MGDPMAPSASEGNSEGGGTARRIASRQAKQAGITRP* |
| Ga0079037_1013901912 | 3300006224 | Freshwater Wetlands | MGDPMAPSEDEGNSEGGGSARWFASREAKRAGITRR* |
| Ga0079037_1013982952 | 3300006224 | Freshwater Wetlands | MGDPMAPSEGEGNSEGGGSARWFASRQAKRAGITRP* |
| Ga0079037_1014346942 | 3300006224 | Freshwater Wetlands | MGDPMAPSDSEGNSEGGGTARRFASRQAKRAGITRP* |
| Ga0079037_1016152732 | 3300006224 | Freshwater Wetlands | YGMGDPMAPSEGEGNSEGGGTARRFASHKAKRAGITRP* |
| Ga0079037_1016300923 | 3300006224 | Freshwater Wetlands | MGDPMAPSVSEGNSEGGGSARWVASREVKRAGITRP* |
| Ga0079037_1018131991 | 3300006224 | Freshwater Wetlands | SWSYGMGDPMAPSGSEGNSEGGGTARQMANRKAKQAGITRS* |
| Ga0079037_1018546042 | 3300006224 | Freshwater Wetlands | MGDPMAPSEREGNSEGGGSARRREPRGEAAGITRP* |
| Ga0079037_1019152902 | 3300006224 | Freshwater Wetlands | MGDPMAPSEGEGNSEGGGAARRFASRPAKRAGITRP* |
| Ga0079037_1019269101 | 3300006224 | Freshwater Wetlands | LISWSYGMGDPMAPSEGEGNSEGGGVPAAASRQAKRAGITRP* |
| Ga0079037_1022034201 | 3300006224 | Freshwater Wetlands | WSYGMGDPMAPSEGEGNSEGGGSARRIASREAKRAGLTRP* |
| Ga0079037_1023722892 | 3300006224 | Freshwater Wetlands | MGDPMAPSEGEGNSEGGGSARRIASRAAKRAGITRP* |
| Ga0079037_1023984892 | 3300006224 | Freshwater Wetlands | MGDPMAPSDSEGNSEGGGSARWFASREAKRAGITRP* |
| Ga0079037_1024412362 | 3300006224 | Freshwater Wetlands | MGDPMAPSEREGNSEGGGTARRIASREAKRAGITRP* |
| Ga0079037_1024763312 | 3300006224 | Freshwater Wetlands | MGDPMAPSEGEGNSEGGGSARRIASLLAKRAGITRP* |
| Ga0079303_100101172 | 3300006930 | Deep Subsurface | MGDPMAPSDSEGNSEGGGTARWFASREATRAGITRP* |
| Ga0079303_100247484 | 3300006930 | Deep Subsurface | GDPMAPSEGEGNSEGGGTARRIASREAKRAGITRP* |
| Ga0079303_100387753 | 3300006930 | Deep Subsurface | MGDPMAPSEREGNSEGGALPAEVASRNATRAGITRP* |
| Ga0079303_100877141 | 3300006930 | Deep Subsurface | LISWSYGMGDPMAPSEGEGNSEGGGTARRFASHKAKRAGITRP* |
| Ga0079303_101592782 | 3300006930 | Deep Subsurface | MGDPMAPSDGEGNSEGGGTARWFASREAERAGITRS* |
| Ga0079303_103487741 | 3300006930 | Deep Subsurface | SYGMGDPMAPSEGEGNSEGGGGARWFASREAKRAGITRP* |
| Ga0079303_103587731 | 3300006930 | Deep Subsurface | RSYGMGDPMAPSEREGNSEGGGTARRIASRQAKRAGITRP* |
| Ga0079303_103987472 | 3300006930 | Deep Subsurface | MGDPMAPSVSEGNSEGGGTARWFASREAKRAGITRP* |
| Ga0073932_100281015 | 3300007072 | Hot Spring Sediment | MGDPMAPSEREGNSEGGGTARRSREPAGEAAGITRP* |
| Ga0073932_100451810 | 3300007072 | Hot Spring Sediment | MGDPMAPSEREGNSEGGGRARRFASREAKRAGITRS* |
| Ga0105106_100276252 | 3300009078 | Freshwater Sediment | MGDPMAPSEGEGNSEGGGTARRIASHLAKRAGITRP* |
| Ga0105106_107751721 | 3300009078 | Freshwater Sediment | GDPRAPSEGEGNSEGGGSARRIASREAKRAGITPP* |
| Ga0105099_102151131 | 3300009082 | Freshwater Sediment | FLISWSYGMGDPMAPSGSEGNSEGGGTARRFASREARRAGITRL* |
| Ga0102851_104962591 | 3300009091 | Freshwater Wetlands | LISWSYGMGDPMAPSGSEGNSERGGTARRFASREARRAGITRL* |
| Ga0102851_124517671 | 3300009091 | Freshwater Wetlands | AFLISGSYGMGDPMAPSEREGNSEGEGTARWFASRQAKRAGITRP* |
| Ga0115026_100488861 | 3300009111 | Wetland | MGDPMAPSESEGNSEGGGTARWFASRQAKRAGITRP* |
| Ga0115026_103688161 | 3300009111 | Wetland | SYGMGDPMAPSGSEGNSEGGGTARRFASREARRAGITRL* |
| Ga0115027_102545442 | 3300009131 | Wetland | SYGMGDPMAPSEGEGNSEGGGRARWFASREAKRAGITRP* |
| Ga0115027_107147421 | 3300009131 | Wetland | YGMGDPMAPSEREGNSEGGGAARRIASRHAKRAGITRP* |
| Ga0105094_101066771 | 3300009153 | Freshwater Sediment | GMGDPMALSEREGNSEGGGSARRIASLLAKRAGITRP* |
| Ga0105100_100452371 | 3300009166 | Freshwater Sediment | LISWSYGMGDPMAPSEREGNSEGGGSARRIASREAKRAGITRP* |
| Ga0105100_104942061 | 3300009166 | Freshwater Sediment | FLISWSYGMGDPMAPSEREGNSEGGGSARRIASRQAKRAGITRP* |
| Ga0105100_104942502 | 3300009166 | Freshwater Sediment | GMGDPMAPSEREGNSEGGGSARRIASRQAKRAGITRP* |
| Ga0113563_100387691 | 3300009167 | Freshwater Wetlands | MGDPMAPSEGEGNSEGGGSARRIASRLAKRAGLTRP* |
| Ga0113563_110812591 | 3300009167 | Freshwater Wetlands | ISWSYGMGDPMAPSGSEGNSEGGGTARQMANRKAKQAGITRS* |
| Ga0115028_100349201 | 3300009179 | Wetland | AFLISWSYGMGDPMAPSEGEGNSEGGGSARWFASRQAKRAGITRP* |
| Ga0115028_100760613 | 3300009179 | Wetland | SWSYGMGDPMAPSEREGNSEGGGTARRFASRQAKRAGITRP* |
| Ga0115028_100800593 | 3300009179 | Wetland | AFLISWSYGMGDPMAPSEREGNSEGGGAARQIASRQAKRAGITRP* |
| Ga0115028_111562012 | 3300009179 | Wetland | GDPMAPSEGEGNSEGGGRARRFASRQAKRAGITRP* |
| Ga0136851_104696201 | 3300010413 | Mangrove Sediment | SWSYGMGDPMAPGASEGNSEGGGRARRVASREAKRAGITRP* |
| Ga0151652_120400422 | 3300011340 | Wetland | MGDPMAPSESEGNSEGGGTARPIASREAKRAGITRP* |
| Ga0075347_10288292 | 3300014313 | Natural And Restored Wetlands | MGDPMAPSEREGNSEGGGRARWFASREAKRAGITRP* |
| Ga0075350_10291112 | 3300014315 | Natural And Restored Wetlands | FLISWSYGMGDPMAPSDSEGNSQGGGRARRFASRQAKRAGITRP* |
| Ga0075348_10821892 | 3300014319 | Natural And Restored Wetlands | WSYGMGDSIAPSVSEGNSEGGGRARRLASRQVKRAGITRL* |
| Ga0184636_11183802 | 3300018068 | Groundwater Sediment | GDPMAPSEGEGNSEGGGSARRIASREAKRAGITRP |
| Ga0184631_101503541 | 3300018070 | Groundwater Sediment | GMGDPMAPSEGEGNSEGGGSARRIANLQAKRAGITRP |
| Ga0210134_10041501 | 3300025950 | Natural And Restored Wetlands | FLISRGYGMGDPMATSGSEGNSEGGGSARWFASREAKRAGITRP |
| Ga0210134_10159051 | 3300025950 | Natural And Restored Wetlands | MGDPMAPSVSEGNSEGGGRARRLASRQVKRAGITR |
| Ga0210069_10119541 | 3300025958 | Natural And Restored Wetlands | MGDPMAPSESEGNSEGGGRARRIASREAKRAGITRP |
| Ga0210103_10105013 | 3300025968 | Natural And Restored Wetlands | LISWSYGMGDPMAPSDSEGNSEGGGRARWVASLEAKRAGITRP |
| Ga0256807_10616802 | 3300026477 | Sediment | YGMGDPMAPSEREGNSEVGGTARRFASRKAKRAGITRP |
| Ga0256806_10003213 | 3300026501 | Sediment | MGDPMAPSEGEGNSEGGGTARRIASRQTKRAGITRP |
| Ga0256806_10015533 | 3300026501 | Sediment | MGDPMAPSEREGNSEGGGSARRFASRQAKRAGLTRP |
| Ga0208665_101129052 | 3300027715 | Deep Subsurface | LISWSYGMGDPMAPSECEGNSEGGGSARRIASRKAKRAGITRP |
| Ga0209492_11556711 | 3300027721 | Freshwater Sediment | MGDPMAPSEGEGNSEGGGTARRIASHLAKRAGITR |
| Ga0256868_100697093 | 3300027811 | Soil | MGDPMAPSEREGNSEGGGSARRIASLLAKRAGITRP |
| Ga0209397_101118331 | 3300027871 | Wetland | ISWSYGMGDPMAPSEGEGNSEGGGSARRIASREATRAGITRP |
| Ga0209397_103351752 | 3300027871 | Wetland | MGDPMAPSEGEGNSEGGGSARRIASREAKQAGITRP |
| Ga0209293_100799772 | 3300027877 | Wetland | SYGMGDPMAPSECEGNSEGGGSARRIASRKAKGAGITRP |
| Ga0209293_102520472 | 3300027877 | Wetland | MGDPMAPSVSEGNSEGGGRARGIASPQAKRAGITRPQLLEMSR |
| Ga0209496_105514781 | 3300027890 | Wetland | GDPMAPSEGEGNSEGGGRARRFASRQAKRAGITRP |
| Ga0209668_104789642 | 3300027899 | Freshwater Lake Sediment | LISWSYGMGDPMAPSVCEGNSEGGGSARRIASREAKQAGITRP |
| Ga0209253_100915581 | 3300027900 | Freshwater Lake Sediment | SYGMGDPMAPSEREGNSEGGGSARRIASREAKRAGITRP |
| Ga0209253_102287132 | 3300027900 | Freshwater Lake Sediment | AFLISWSYGMGDPMAPSEREGNSEGGGTARRFASRQAKRAGITRP |
| Ga0299915_101646091 | 3300030613 | Soil | SYGMGDPMAPSEGEGNSEGGGSARRTASREAQRAGITRP |
| Ga0315290_108023072 | 3300031834 | Sediment | YGMGDPMAPSEGEGNSEGGGSARRIASREAKRAGITRP |
| Ga0315297_116018001 | 3300031873 | Sediment | MGDPMAPSEREGNSEGGGSARRIASREAKRAGITRP |
| Ga0315292_104142892 | 3300032143 | Sediment | LISWSYGMGDPMAPSEREGNSEGGGSARRIASCEAKRAGITRP |
| Ga0315292_116085801 | 3300032143 | Sediment | LISWSYGMGDPMAPSEREGNSEGGGSARRIASRKAKRAGITRP |
| Ga0315295_105004042 | 3300032156 | Sediment | MGDPMAPSEREGNSEGGGSARRIASRQAKRAGITRP |
| Ga0315281_113829721 | 3300032163 | Sediment | MGDPMAPSEREGNSEGGGSARRIASREAKRAGITRPY |
| Ga0315283_124822522 | 3300032164 | Sediment | YGMGDPMAPSEREGNSEGGGSARRIASRKAKRAGITRP |
| Ga0315276_103854621 | 3300032177 | Sediment | MGDPMAPSEGEGNSEGGGSARRIASREAKRAGITRP |
| Ga0315276_108341011 | 3300032177 | Sediment | MGDPMAPSEREGNSEGEGSARRIASRQAKRAGITRP |
| Ga0315276_116037811 | 3300032177 | Sediment | YGMGDPMAPSEREGNSEGGGSARRIASRQAKRAGITRP |
| Ga0315286_111717771 | 3300032342 | Sediment | SYGMGDPRAPSEGEGNSEGGGSARRIASRKAKRAGITRP |
| Ga0315287_121722981 | 3300032397 | Sediment | MGDPMAPSGREGNSEGGGSARRFASREAKRAGITRP |
| Ga0315273_101735944 | 3300032516 | Sediment | WSYGMGDPMAPSEREGNSEGGGSARRIASREAKRAGITRP |
| Ga0315273_107198153 | 3300032516 | Sediment | WSYGMGDPMAPSEGEGNSEGGDSARRIASREAKRAGITRP |
| Ga0316604_100566294 | 3300033406 | Soil | MGDPMAPSEGEGNSEGGGSARRIASREATRAGITRP |
| Ga0316604_101532431 | 3300033406 | Soil | LISWSYGMGDPMAPSEAEGNSEGGGTARRIASRQARRAGITRP |
| Ga0316604_101675971 | 3300033406 | Soil | TGDPMAPSECEGNSEGGGTARRIASRKAKRAGITRP |
| Ga0316604_106972812 | 3300033406 | Soil | EMGDPMAPSECEGNSEGGGSARRIASRQATRAGITRP |
| Ga0316605_100515112 | 3300033408 | Soil | MGDPMAPSEGEGNSEGGGTARRIASLQAKRAGITRP |
| Ga0316605_101729492 | 3300033408 | Soil | MGDPMAPSEGEGNSEGGGSARWFASRQAKRAGITRP |
| Ga0316605_105365531 | 3300033408 | Soil | MGDPMAPSEGEGNSEGGGTARRFASRDAKRAGITRP |
| Ga0316605_111371721 | 3300033408 | Soil | MGDPMAPSEGEGNSEGGGYARRIAGRQAKRAGITRPQLLEM |
| Ga0316603_102484252 | 3300033413 | Soil | ISGRYGMGDPMAPSECEGNSEGGGTARRIASRKAKRAGITRP |
| Ga0316603_104634102 | 3300033413 | Soil | MGDPMAPSDSEGNSEGGGTARRIASLQAKRAGITR |
| Ga0316603_106414321 | 3300033413 | Soil | SSYGMEDPMAPSEGEGNSEGGGAARRIASREAKRAGITRP |
| Ga0316603_116980662 | 3300033413 | Soil | WSYGMGDPMAPSGGEGNSEGGGSARRIASREAKRAGITRP |
| Ga0316603_123396162 | 3300033413 | Soil | MGDPMAPSEGEGNSEGGGGARWFASREAKRAGITRP |
| Ga0316619_101586452 | 3300033414 | Soil | SFQWSYGMGDPMAPSEGEGNSEGGGSARRIASREAKRAGLTRP |
| Ga0316619_103068011 | 3300033414 | Soil | YGMGDPMAPSEGEGNSEGGGSARRIASRKAKRAGLTRP |
| Ga0316619_105377982 | 3300033414 | Soil | LISWSYGMGDPMAPSEGEGNSEGGGTARRFASREAKRAGITRP |
| Ga0316619_113838911 | 3300033414 | Soil | QWSYGMGDPMAPSEREGNSEGGGRARWFASRQAKRAGITRP |
| Ga0316622_1012493281 | 3300033416 | Soil | SWSYGTGDPMAPSEGEGNSEGGGTARRIASREAKRAGITRP |
| Ga0316622_1013219401 | 3300033416 | Soil | SYGMGDPMAPSEREGNSEGGGTARRFASRQAKRAGITRP |
| Ga0316625_1018776071 | 3300033418 | Soil | MGDPMAPSEGEGNSEGGGTARRFASHKAKRAGITRP |
| Ga0316601_1000005171 | 3300033419 | Soil | YGMGDPMAASEREGNSEGGGTARRIASCQAKRAGITRP |
| Ga0316601_1006629891 | 3300033419 | Soil | SYGMGDPMAPSEGEGNSEGGGSARRIASREAKRAGLTRP |
| Ga0316601_1010605481 | 3300033419 | Soil | WSYGMGDPMAPSESEGNSEGGGTARWFASRQAKRAGITRP |
| Ga0316601_1012458842 | 3300033419 | Soil | WSYGMGDPMAPSEGEGNSEGGGTARRFASHKAKRAGITRP |
| Ga0326726_122691712 | 3300033433 | Peat Soil | SYGMGDPMAPSESEGGGRARRIASRKAKRAGITRP |
| Ga0316613_100997883 | 3300033434 | Soil | GMGDPMAPSEGEGNSEGGGSARRIASREAKRAGITRP |
| Ga0316620_100390776 | 3300033480 | Soil | MGDPMAPSDSEGNSEGGGSARRIASRKAKRAGITRP |
| Ga0316620_109025532 | 3300033480 | Soil | SYGTGDPMAPSECEGNREGGGTARRIASRKAKRAGITRP |
| Ga0316620_109502303 | 3300033480 | Soil | MGDPMAPSGSEGNSEGGGTARRIASRQAKRAGITR |
| Ga0316600_110062391 | 3300033481 | Soil | AFLISWSYGMGDPMAPSEREGNSEGGGRARRIASREAKRAGITRP |
| Ga0316629_100118491 | 3300033483 | Soil | GMGDPMAPSEGEGNSEGGGSARRIASREATRAGITRP |
| Ga0316626_105705791 | 3300033485 | Soil | LISWSYGMGDPMAPSGSEGNSEGGGTARRFASRKATRVGITRP |
| Ga0316630_100234474 | 3300033487 | Soil | SYGMGDPMAASEREGNSEGGGTARRIASCQAKRAGITRP |
| Ga0316630_101162062 | 3300033487 | Soil | MGDPMAPSEGEGNSEGGGRARWFASREAKRAGITRP |
| Ga0316630_101714732 | 3300033487 | Soil | SWSYGMGDPMAPSEREGNSEGGGTARWFASRQAKRAGITRP |
| Ga0316630_103632812 | 3300033487 | Soil | LISWSYGMGDPMAPSDSEGNSEGGGRARRIASREAKRAGITRP |
| Ga0316630_109198602 | 3300033487 | Soil | SYGMGDPMAPSEGEGNSEGGGSARRIASRKAKRAGITRP |
| Ga0316631_100731462 | 3300033493 | Soil | GMGDPMAPSEGEGNSEGGGSARRTASRKAKRAGITRP |
| Ga0316631_101812472 | 3300033493 | Soil | MGDPMAPSVSEGNSEGGGSARWVASREAKRAGITRPQLLEM |
| Ga0316631_102067521 | 3300033493 | Soil | LISGSYGMGDPMAPSEREGNSEGGGRARRIASREAKRAGITRP |
| Ga0316628_1001384572 | 3300033513 | Soil | MGDPMAPSEGEGNSEGGGSARRFASLEAKRAGTTRP |
| Ga0316628_1001991341 | 3300033513 | Soil | MGDPMAPSECEGNSEGGGTARRIASRQAKWAGITR |
| Ga0316628_1023289162 | 3300033513 | Soil | YGMGDPMAPSACEGNSEGGGTARRFASREAKRAGITRP |
| Ga0316628_1024251232 | 3300033513 | Soil | SWSYGVGDPMAPSDSEGNSEGGGSARRIASRAAKRAGLTRP |
| Ga0316628_1039074662 | 3300033513 | Soil | YGMGDPMAPSEGEGNSEGGGSARWFASRKAKRAGITRA |
| Ga0316616_1000336754 | 3300033521 | Soil | MGDPMAPSECEGNSEGGGSARRIASREAKRAGITRP |
| Ga0316616_1001557652 | 3300033521 | Soil | MGDPMALSGSEGNSEGGGRARWFASREAKRAGITRP |
| Ga0316616_1010524451 | 3300033521 | Soil | MGDPMAPSVSEGNSEGGGSARRIASRKAKRAGITR |
| Ga0316616_1015414472 | 3300033521 | Soil | LISWSYGVGDPMAPSEREGNSEGGGTARRMASRQAKRAGITRP |
| Ga0316616_1028488642 | 3300033521 | Soil | LISWSYGMGDPMAPSEREGNSEGGGTAGRIASRKAKRARITRP |
| Ga0316617_1001051191 | 3300033557 | Soil | MGDPMASSEREGNSEGGGSACRIVSRQAKRAGITGP |
| Ga0316617_1011781262 | 3300033557 | Soil | LISWSYGMGDPMAPSEGEGNSEGGGSARWFASRKAKRAGITRP |
| Ga0316617_1020263842 | 3300033557 | Soil | GDPMAPSEGEGNSEGGGTARRIASREAKRAGITRP |
| ⦗Top⦘ |