| Basic Information | |
|---|---|
| Family ID | F032467 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 180 |
| Average Sequence Length | 45 residues |
| Representative Sequence | AWTNCLLLWAVRDDPVARGLLLDSLAASTALASRMLLVAV |
| Number of Associated Samples | 149 |
| Number of Associated Scaffolds | 180 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 8.33 % |
| % of genes near scaffold ends (potentially truncated) | 87.22 % |
| % of genes from short scaffolds (< 2000 bps) | 93.33 % |
| Associated GOLD sequencing projects | 143 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.39 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (86.667 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (38.889 % of family members) |
| Environment Ontology (ENVO) | Unclassified (37.222 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.556 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.41% β-sheet: 0.00% Coil/Unstructured: 45.59% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 180 Family Scaffolds |
|---|---|---|
| PF13191 | AAA_16 | 16.11 |
| PF12680 | SnoaL_2 | 4.44 |
| PF03965 | Penicillinase_R | 3.33 |
| PF06475 | Glycolipid_bind | 3.33 |
| PF09900 | DUF2127 | 3.33 |
| PF00916 | Sulfate_transp | 2.78 |
| PF00082 | Peptidase_S8 | 2.22 |
| PF00501 | AMP-binding | 1.67 |
| PF00440 | TetR_N | 1.67 |
| PF01636 | APH | 1.67 |
| PF04116 | FA_hydroxylase | 1.67 |
| PF03625 | DUF302 | 1.67 |
| PF13411 | MerR_1 | 1.67 |
| PF00248 | Aldo_ket_red | 1.11 |
| PF01230 | HIT | 1.11 |
| PF01370 | Epimerase | 1.11 |
| PF07311 | Dodecin | 1.11 |
| PF01738 | DLH | 1.11 |
| PF01471 | PG_binding_1 | 0.56 |
| PF01408 | GFO_IDH_MocA | 0.56 |
| PF00313 | CSD | 0.56 |
| PF01212 | Beta_elim_lyase | 0.56 |
| PF01638 | HxlR | 0.56 |
| PF00324 | AA_permease | 0.56 |
| PF00296 | Bac_luciferase | 0.56 |
| PF00701 | DHDPS | 0.56 |
| PF09995 | MPAB_Lcp_cat | 0.56 |
| PF01872 | RibD_C | 0.56 |
| PF00069 | Pkinase | 0.56 |
| PF02518 | HATPase_c | 0.56 |
| PF06386 | GvpL_GvpF | 0.56 |
| PF03663 | Glyco_hydro_76 | 0.56 |
| PF13676 | TIR_2 | 0.56 |
| PF14525 | AraC_binding_2 | 0.56 |
| PF10604 | Polyketide_cyc2 | 0.56 |
| PF04237 | YjbR | 0.56 |
| PF00205 | TPP_enzyme_M | 0.56 |
| PF02585 | PIG-L | 0.56 |
| PF00891 | Methyltransf_2 | 0.56 |
| PF00293 | NUDIX | 0.56 |
| PF04075 | F420H2_quin_red | 0.56 |
| PF02775 | TPP_enzyme_C | 0.56 |
| PF09278 | MerR-DNA-bind | 0.56 |
| PF04542 | Sigma70_r2 | 0.56 |
| PF01243 | Putative_PNPOx | 0.56 |
| PF01326 | PPDK_N | 0.56 |
| PF12146 | Hydrolase_4 | 0.56 |
| PF14344 | DUF4397 | 0.56 |
| PF03860 | DUF326 | 0.56 |
| PF00561 | Abhydrolase_1 | 0.56 |
| PF09180 | ProRS-C_1 | 0.56 |
| PF04286 | DUF445 | 0.56 |
| PF00392 | GntR | 0.56 |
| PF01909 | NTP_transf_2 | 0.56 |
| PF01740 | STAS | 0.56 |
| COG ID | Name | Functional Category | % Frequency in 180 Family Scaffolds |
|---|---|---|---|
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 3.33 |
| COG3554 | Uncharacterized conserved protein | Function unknown [S] | 3.33 |
| COG3682 | Transcriptional regulator, CopY/TcrY family | Transcription [K] | 3.33 |
| COG2233 | Xanthine/uracil permease | Nucleotide transport and metabolism [F] | 2.78 |
| COG2252 | Xanthine/guanine/uracil/vitamin C permease GhxP/GhxQ, nucleobase:cation symporter 2 ( NCS2) family | Nucleotide transport and metabolism [F] | 2.78 |
| COG0659 | Sulfate permease or related transporter, MFS superfamily | Inorganic ion transport and metabolism [P] | 2.78 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 2.22 |
| COG3439 | Uncharacterized conserved protein, DUF302 family | Function unknown [S] | 1.67 |
| COG3000 | Sterol desaturase/sphingolipid hydroxylase, fatty acid hydroxylase superfamily | Lipid transport and metabolism [I] | 1.67 |
| COG0329 | 4-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyase | Cell wall/membrane/envelope biogenesis [M] | 1.11 |
| COG3360 | Flavin-binding protein dodecin | General function prediction only [R] | 1.11 |
| COG1167 | DNA-binding transcriptional regulator, MocR family, contains an aminotransferase domain | Transcription [K] | 1.11 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.56 |
| COG2008 | Threonine aldolase | Amino acid transport and metabolism [E] | 0.56 |
| COG2120 | N-acetylglucosaminyl deacetylase, LmbE family | Carbohydrate transport and metabolism [G] | 0.56 |
| COG1982 | Arginine/lysine/ornithine decarboxylase | Amino acid transport and metabolism [E] | 0.56 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.56 |
| COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 0.56 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.56 |
| COG2315 | Predicted DNA-binding protein with ‘double-wing’ structural motif, MmcQ/YjbR family | Transcription [K] | 0.56 |
| COG2733 | Uncharacterized membrane-anchored protein YjiN, DUF445 family | Function unknown [S] | 0.56 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.56 |
| COG3033 | Tryptophanase | Amino acid transport and metabolism [E] | 0.56 |
| COG4399 | Uncharacterized membrane protein YheB, UPF0754 family | Function unknown [S] | 0.56 |
| COG4833 | Predicted alpha-1,6-mannanase, GH76 family | Carbohydrate transport and metabolism [G] | 0.56 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.56 |
| COG4992 | Acetylornithine/succinyldiaminopimelate/putrescine aminotransferase | Amino acid transport and metabolism [E] | 0.56 |
| COG0574 | Phosphoenolpyruvate synthase/pyruvate phosphate dikinase | Carbohydrate transport and metabolism [G] | 0.56 |
| COG0076 | Glutamate or tyrosine decarboxylase or a related PLP-dependent protein | Amino acid transport and metabolism [E] | 0.56 |
| COG0112 | Glycine/serine hydroxymethyltransferase | Amino acid transport and metabolism [E] | 0.56 |
| COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 0.56 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.56 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.56 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.56 |
| COG0442 | Prolyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.56 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.56 |
| COG0531 | Serine transporter YbeC, amino acid:H+ symporter family | Amino acid transport and metabolism [E] | 0.56 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.56 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.56 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.56 |
| COG0789 | DNA-binding transcriptional regulator, MerR family | Transcription [K] | 0.56 |
| COG0833 | Amino acid permease | Amino acid transport and metabolism [E] | 0.56 |
| COG1003 | Glycine cleavage system protein P (pyridoxal-binding), C-terminal domain | Amino acid transport and metabolism [E] | 0.56 |
| COG1104 | Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family | Amino acid transport and metabolism [E] | 0.56 |
| COG1113 | L-asparagine transporter or related permease | Amino acid transport and metabolism [E] | 0.56 |
| COG1115 | Na+/alanine symporter | Amino acid transport and metabolism [E] | 0.56 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.56 |
| COG0075 | Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG | Amino acid transport and metabolism [E] | 0.56 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 87.22 % |
| Unclassified | root | N/A | 12.78 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300003218|JGI26339J46600_10108098 | Not Available | 675 | Open in IMG/M |
| 3300003368|JGI26340J50214_10016985 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2257 | Open in IMG/M |
| 3300004092|Ga0062389_104905297 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300005355|Ga0070671_100563867 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 983 | Open in IMG/M |
| 3300005434|Ga0070709_10268012 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1236 | Open in IMG/M |
| 3300005435|Ga0070714_102450510 | Not Available | 507 | Open in IMG/M |
| 3300005436|Ga0070713_101925982 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 573 | Open in IMG/M |
| 3300005468|Ga0070707_101428434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 658 | Open in IMG/M |
| 3300005471|Ga0070698_100325750 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1467 | Open in IMG/M |
| 3300005518|Ga0070699_100585708 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1017 | Open in IMG/M |
| 3300005518|Ga0070699_101313839 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 663 | Open in IMG/M |
| 3300005541|Ga0070733_10810828 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 629 | Open in IMG/M |
| 3300005553|Ga0066695_10049849 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2485 | Open in IMG/M |
| 3300005610|Ga0070763_10909925 | Not Available | 524 | Open in IMG/M |
| 3300005614|Ga0068856_100450044 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 1308 | Open in IMG/M |
| 3300005764|Ga0066903_100111489 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3754 | Open in IMG/M |
| 3300005994|Ga0066789_10134907 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1052 | Open in IMG/M |
| 3300006028|Ga0070717_11002949 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 760 | Open in IMG/M |
| 3300006102|Ga0075015_100629483 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 630 | Open in IMG/M |
| 3300006163|Ga0070715_10145742 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces violaceusniger group → Streptomyces violaceusniger | 1155 | Open in IMG/M |
| 3300006175|Ga0070712_100766059 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 827 | Open in IMG/M |
| 3300006175|Ga0070712_100983724 | Not Available | 730 | Open in IMG/M |
| 3300006176|Ga0070765_101771209 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 579 | Open in IMG/M |
| 3300006354|Ga0075021_10771711 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 620 | Open in IMG/M |
| 3300006579|Ga0074054_12057077 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 695 | Open in IMG/M |
| 3300006605|Ga0074057_10009782 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1094 | Open in IMG/M |
| 3300009520|Ga0116214_1209065 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 735 | Open in IMG/M |
| 3300009521|Ga0116222_1077142 | Not Available | 1438 | Open in IMG/M |
| 3300009523|Ga0116221_1411266 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 589 | Open in IMG/M |
| 3300009644|Ga0116121_1273181 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 543 | Open in IMG/M |
| 3300009700|Ga0116217_10346169 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 949 | Open in IMG/M |
| 3300010043|Ga0126380_11485582 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 599 | Open in IMG/M |
| 3300010046|Ga0126384_10043777 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3047 | Open in IMG/M |
| 3300010046|Ga0126384_10713353 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 890 | Open in IMG/M |
| 3300010361|Ga0126378_10149145 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2378 | Open in IMG/M |
| 3300010361|Ga0126378_12972546 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 540 | Open in IMG/M |
| 3300010376|Ga0126381_101235533 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1080 | Open in IMG/M |
| 3300010376|Ga0126381_102071166 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 820 | Open in IMG/M |
| 3300010403|Ga0134123_12975847 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. PKU-MA01144 | 543 | Open in IMG/M |
| 3300012207|Ga0137381_10275342 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1464 | Open in IMG/M |
| 3300012971|Ga0126369_11146652 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Prauserella → Prauserella shujinwangii | 867 | Open in IMG/M |
| 3300012986|Ga0164304_11417713 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 571 | Open in IMG/M |
| 3300013764|Ga0120111_1099757 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 685 | Open in IMG/M |
| 3300014158|Ga0181521_10013457 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 7531 | Open in IMG/M |
| 3300016270|Ga0182036_10603630 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 880 | Open in IMG/M |
| 3300016341|Ga0182035_10542082 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium | 999 | Open in IMG/M |
| 3300016357|Ga0182032_10192679 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1545 | Open in IMG/M |
| 3300016404|Ga0182037_11456998 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Candidatus Dormibacteraeota → unclassified Candidatus Dormibacteraeota → Candidatus Dormibacteraeota bacterium | 606 | Open in IMG/M |
| 3300017926|Ga0187807_1318125 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 519 | Open in IMG/M |
| 3300017955|Ga0187817_11126508 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300017959|Ga0187779_10379315 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 918 | Open in IMG/M |
| 3300017961|Ga0187778_10871971 | Not Available | 617 | Open in IMG/M |
| 3300017970|Ga0187783_10892737 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300017974|Ga0187777_10967232 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 615 | Open in IMG/M |
| 3300018001|Ga0187815_10496717 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 523 | Open in IMG/M |
| 3300018009|Ga0187884_10373239 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 574 | Open in IMG/M |
| 3300018021|Ga0187882_1383855 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 533 | Open in IMG/M |
| 3300018058|Ga0187766_11113648 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 567 | Open in IMG/M |
| 3300018085|Ga0187772_10987254 | Not Available | 615 | Open in IMG/M |
| 3300019787|Ga0182031_1435871 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3373 | Open in IMG/M |
| 3300020579|Ga0210407_10217384 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1486 | Open in IMG/M |
| 3300021088|Ga0210404_10206217 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1056 | Open in IMG/M |
| 3300021178|Ga0210408_10418894 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1066 | Open in IMG/M |
| 3300021181|Ga0210388_10566794 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 994 | Open in IMG/M |
| 3300021181|Ga0210388_11435769 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 578 | Open in IMG/M |
| 3300021401|Ga0210393_10701474 | Not Available | 825 | Open in IMG/M |
| 3300021402|Ga0210385_11444242 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 526 | Open in IMG/M |
| 3300021403|Ga0210397_11013293 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 644 | Open in IMG/M |
| 3300021405|Ga0210387_10793817 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 837 | Open in IMG/M |
| 3300021405|Ga0210387_10905217 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium | 776 | Open in IMG/M |
| 3300021405|Ga0210387_11749419 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 525 | Open in IMG/M |
| 3300021407|Ga0210383_10425926 | All Organisms → cellular organisms → Bacteria | 1145 | Open in IMG/M |
| 3300021407|Ga0210383_10800065 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 807 | Open in IMG/M |
| 3300021420|Ga0210394_11020440 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300021560|Ga0126371_10288396 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1765 | Open in IMG/M |
| 3300022506|Ga0242648_1072193 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300025588|Ga0208586_1082124 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 706 | Open in IMG/M |
| 3300025915|Ga0207693_11352717 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. PKU-MA01144 | 531 | Open in IMG/M |
| 3300025981|Ga0207640_10877463 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300026475|Ga0257147_1005243 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 1592 | Open in IMG/M |
| 3300027370|Ga0209010_1085531 | Not Available | 537 | Open in IMG/M |
| 3300027604|Ga0208324_1006120 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4131 | Open in IMG/M |
| 3300027812|Ga0209656_10028541 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3333 | Open in IMG/M |
| 3300027824|Ga0209040_10406609 | Not Available | 631 | Open in IMG/M |
| 3300027854|Ga0209517_10647514 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 552 | Open in IMG/M |
| 3300027869|Ga0209579_10306945 | Not Available | 856 | Open in IMG/M |
| 3300027874|Ga0209465_10527351 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 589 | Open in IMG/M |
| 3300027895|Ga0209624_10375328 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
| 3300028742|Ga0302220_10275270 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300028819|Ga0307296_10686927 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 559 | Open in IMG/M |
| 3300028871|Ga0302230_10118523 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1050 | Open in IMG/M |
| 3300028884|Ga0307308_10366054 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 691 | Open in IMG/M |
| 3300028906|Ga0308309_11859749 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 508 | Open in IMG/M |
| 3300029911|Ga0311361_11426061 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 529 | Open in IMG/M |
| 3300029922|Ga0311363_11320807 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 595 | Open in IMG/M |
| 3300029945|Ga0311330_10877139 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 673 | Open in IMG/M |
| 3300029988|Ga0302190_10167950 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 924 | Open in IMG/M |
| 3300030013|Ga0302178_10147882 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1166 | Open in IMG/M |
| 3300030056|Ga0302181_10210154 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
| 3300030503|Ga0311370_12044134 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300030520|Ga0311372_12432679 | Not Available | 592 | Open in IMG/M |
| 3300031236|Ga0302324_100420025 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1986 | Open in IMG/M |
| 3300031236|Ga0302324_102391972 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 649 | Open in IMG/M |
| 3300031544|Ga0318534_10125672 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1474 | Open in IMG/M |
| 3300031544|Ga0318534_10166933 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1272 | Open in IMG/M |
| 3300031546|Ga0318538_10790990 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 515 | Open in IMG/M |
| 3300031549|Ga0318571_10008656 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2316 | Open in IMG/M |
| 3300031549|Ga0318571_10061516 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1146 | Open in IMG/M |
| 3300031549|Ga0318571_10339955 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 573 | Open in IMG/M |
| 3300031549|Ga0318571_10351421 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 565 | Open in IMG/M |
| 3300031564|Ga0318573_10352208 | Not Available | 790 | Open in IMG/M |
| 3300031668|Ga0318542_10186661 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1042 | Open in IMG/M |
| 3300031668|Ga0318542_10441526 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → unclassified Mycobacterium → Mycobacterium sp. IWGMT90018-18076 | 674 | Open in IMG/M |
| 3300031679|Ga0318561_10740162 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 540 | Open in IMG/M |
| 3300031680|Ga0318574_10323923 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. 846.5 | 897 | Open in IMG/M |
| 3300031680|Ga0318574_10442735 | Not Available | 760 | Open in IMG/M |
| 3300031708|Ga0310686_101220269 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 506 | Open in IMG/M |
| 3300031708|Ga0310686_110483942 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 657 | Open in IMG/M |
| 3300031713|Ga0318496_10112264 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1469 | Open in IMG/M |
| 3300031724|Ga0318500_10117406 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1226 | Open in IMG/M |
| 3300031744|Ga0306918_11242316 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 574 | Open in IMG/M |
| 3300031747|Ga0318502_10136455 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1390 | Open in IMG/M |
| 3300031747|Ga0318502_10954961 | Not Available | 522 | Open in IMG/M |
| 3300031751|Ga0318494_10472603 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → unclassified Nocardioidaceae → Nocardioidaceae bacterium | 730 | Open in IMG/M |
| 3300031769|Ga0318526_10013521 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2710 | Open in IMG/M |
| 3300031770|Ga0318521_10186341 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1193 | Open in IMG/M |
| 3300031770|Ga0318521_10635864 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 646 | Open in IMG/M |
| 3300031770|Ga0318521_10737280 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 599 | Open in IMG/M |
| 3300031771|Ga0318546_10307082 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1099 | Open in IMG/M |
| 3300031779|Ga0318566_10291244 | Not Available | 808 | Open in IMG/M |
| 3300031781|Ga0318547_11004907 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 521 | Open in IMG/M |
| 3300031782|Ga0318552_10114876 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1337 | Open in IMG/M |
| 3300031792|Ga0318529_10071264 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Kitasatospora → Kitasatospora purpeofusca | 1533 | Open in IMG/M |
| 3300031793|Ga0318548_10284122 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 813 | Open in IMG/M |
| 3300031795|Ga0318557_10353691 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 675 | Open in IMG/M |
| 3300031796|Ga0318576_10587417 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 525 | Open in IMG/M |
| 3300031798|Ga0318523_10244723 | Not Available | 896 | Open in IMG/M |
| 3300031819|Ga0318568_11060422 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 500 | Open in IMG/M |
| 3300031835|Ga0318517_10475869 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 563 | Open in IMG/M |
| 3300031846|Ga0318512_10432656 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 663 | Open in IMG/M |
| 3300031860|Ga0318495_10027418 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2473 | Open in IMG/M |
| 3300031860|Ga0318495_10048802 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1872 | Open in IMG/M |
| 3300031879|Ga0306919_10873332 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 690 | Open in IMG/M |
| 3300031910|Ga0306923_10558547 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1289 | Open in IMG/M |
| 3300031910|Ga0306923_10809011 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1034 | Open in IMG/M |
| 3300031910|Ga0306923_10900318 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → unclassified Mycobacterium → Mycobacterium sp. IWGMT90018-18076 | 969 | Open in IMG/M |
| 3300031939|Ga0308174_11416202 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 595 | Open in IMG/M |
| 3300031945|Ga0310913_10758527 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 685 | Open in IMG/M |
| 3300031945|Ga0310913_11317559 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 501 | Open in IMG/M |
| 3300031946|Ga0310910_10306169 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1251 | Open in IMG/M |
| 3300031947|Ga0310909_10393421 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1164 | Open in IMG/M |
| 3300031947|Ga0310909_11268737 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 594 | Open in IMG/M |
| 3300031947|Ga0310909_11534175 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 530 | Open in IMG/M |
| 3300032001|Ga0306922_10946110 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 892 | Open in IMG/M |
| 3300032009|Ga0318563_10533578 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300032043|Ga0318556_10622363 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 563 | Open in IMG/M |
| 3300032044|Ga0318558_10092599 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1406 | Open in IMG/M |
| 3300032054|Ga0318570_10186738 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 934 | Open in IMG/M |
| 3300032054|Ga0318570_10460448 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 580 | Open in IMG/M |
| 3300032059|Ga0318533_10519534 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium | 873 | Open in IMG/M |
| 3300032060|Ga0318505_10227602 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 876 | Open in IMG/M |
| 3300032060|Ga0318505_10528602 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 556 | Open in IMG/M |
| 3300032065|Ga0318513_10554011 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 563 | Open in IMG/M |
| 3300032066|Ga0318514_10108816 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Kitasatospora → Kitasatospora purpeofusca | 1413 | Open in IMG/M |
| 3300032076|Ga0306924_10642516 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1197 | Open in IMG/M |
| 3300032089|Ga0318525_10199103 | Not Available | 1030 | Open in IMG/M |
| 3300032094|Ga0318540_10070081 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1608 | Open in IMG/M |
| 3300032160|Ga0311301_11124040 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1019 | Open in IMG/M |
| 3300032160|Ga0311301_12100903 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300032261|Ga0306920_101099885 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1153 | Open in IMG/M |
| 3300032261|Ga0306920_104459400 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 501 | Open in IMG/M |
| 3300032770|Ga0335085_11361141 | Not Available | 746 | Open in IMG/M |
| 3300032805|Ga0335078_10710792 | Not Available | 1243 | Open in IMG/M |
| 3300032828|Ga0335080_10347984 | Not Available | 1599 | Open in IMG/M |
| 3300032828|Ga0335080_11291162 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 730 | Open in IMG/M |
| 3300032829|Ga0335070_11696508 | Not Available | 573 | Open in IMG/M |
| 3300032895|Ga0335074_10875787 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Geodermatophilus → Geodermatophilus sabuli | 820 | Open in IMG/M |
| 3300032955|Ga0335076_10864317 | Not Available | 786 | Open in IMG/M |
| 3300033004|Ga0335084_11511672 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300033158|Ga0335077_10519784 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1256 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 38.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.22% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.11% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.00% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.00% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.44% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.44% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.33% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.78% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.67% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.67% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.67% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.11% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.11% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.11% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.11% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.11% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.11% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.11% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.56% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.56% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.56% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.56% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.56% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.56% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.56% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.56% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.56% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.56% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.56% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300003218 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 | Environmental | Open in IMG/M |
| 3300003368 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006579 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006605 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009644 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300013764 | Permafrost microbial communities from Nunavut, Canada - A28_35cm_6M | Environmental | Open in IMG/M |
| 3300014158 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaG | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
| 3300018009 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40 | Environmental | Open in IMG/M |
| 3300018021 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_150 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300019787 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022506 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-26-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025588 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-3 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026475 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-A | Environmental | Open in IMG/M |
| 3300027370 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028742 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_3 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028871 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_1 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029911 | III_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300029922 | III_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029945 | I_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300029988 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_3 | Environmental | Open in IMG/M |
| 3300030013 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_3 | Environmental | Open in IMG/M |
| 3300030056 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI26339J46600_101080981 | 3300003218 | Bog Forest Soil | DLAWTNCLLLGQCDDPVARGLLLDSLAASTALTSRMLLVAV* |
| JGI26340J50214_100169854 | 3300003368 | Bog Forest Soil | MGSRNSARDLAWNNARLLWAVRDDPLARGLFLDSLAASTALGSRMLLVAV* |
| Ga0062389_1049052972 | 3300004092 | Bog Forest Soil | DLAWTNCLLLWAVRDDPIARGLFLDALAASTTLASRMLLVAV* |
| Ga0070671_1005638671 | 3300005355 | Switchgrass Rhizosphere | INSARDLAWNNCLLLWAVRDDPVARGLLADSLAGSAAVTSRLLLVAV* |
| Ga0070709_102680121 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | WNNCLLLWAVRDDPVARGLLADSLAGSAAVTSRLLLVAV* |
| Ga0070714_1024505101 | 3300005435 | Agricultural Soil | RDLAWNNCLLLWAIRDNPLARGLFLDSLAASTAAAGRLLLVAV* |
| Ga0070713_1019259822 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | TINSARDLAWNNCLLLWAVRDDPVARGLLADSLAGSAALTSRLLLVAV* |
| Ga0070707_1014284342 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | VAALTCNWTINSDWDLAWNNTRPLRAVRDDPLAHGLFLDSLAASTALTSRMLLVAV* |
| Ga0070698_1003257502 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | VAALTCNWTINSAWDLAWNNTRPLRAVRDDPLAHGLFLDSLAASTALTSRMLLVAV* |
| Ga0070699_1005857081 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | LTCNWTINNARDLAWNNARLLWAARDDPLARGLFLDSLAASTALASRMLLVAV* |
| Ga0070699_1013138392 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | ADLLGNWAINDARDLAWTNCLLLWAVRDDPIARGLFLDTLAASTALASRLLLVAV* |
| Ga0070733_108108282 | 3300005541 | Surface Soil | WNNCLLLWAVRDDPIARRLFLDTLAASTALASQMLLVAV* |
| Ga0066695_100498492 | 3300005553 | Soil | VVTLTCNWAISSARDLAWHNAGCCGQCTMIRSRGLFLHSLAASTALASRMLLVAV* |
| Ga0070763_109099252 | 3300005610 | Soil | INSARDLAWTNCLLLWAVRDNRVARGLLLDSLAASAALASRMLLVAV* |
| Ga0068856_1004500441 | 3300005614 | Corn Rhizosphere | INSARDLAWNNCLLLWAVRDDPIARGLLADSLAGSAALTSRLLLVAV* |
| Ga0066903_1001114894 | 3300005764 | Tropical Forest Soil | LAWNNCLLLWAVRDDPIARGLLADSLARSAALASRLLLVAL* |
| Ga0066789_101349072 | 3300005994 | Soil | RDLAWNNSLLLWALRDDPFERGLFLDSLAATTAAASRMLLVAV* |
| Ga0070717_110029493 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | LLGNWTINEARDLAWTNCLLLWAVRDDPIARGLFLDALAASTALASRLLLVAV* |
| Ga0075015_1006294833 | 3300006102 | Watersheds | NSARDMAWTNCLLLWAVRDDPVVRGLLLDSLAASTALASRMLLMAVT* |
| Ga0070715_101457421 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | EARDLAWTNCLLLWAVRDNPIARGLFLDTLAASTALASRLLLVAV* |
| Ga0070712_1007660592 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | VAALTCDWTINSAWDLAWNNARPLRAVRDDPPAHGLFLDSLAASTALTSRMLLVAV* |
| Ga0070712_1009837242 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | SARDLAWNNCLLLWAIRDDPVARGLFLTTLAASTALASRMLLVAL* |
| Ga0070765_1017712092 | 3300006176 | Soil | GNWTINDARDLAWTNCLLLWAVRDDPIARGLFLDALAASTTLASRMLLVAV* |
| Ga0075021_107717111 | 3300006354 | Watersheds | SINSARDMAWTNCLLLWAVRDNPVARGLLLESLAASTALASRMLLMAVT* |
| Ga0074054_120570771 | 3300006579 | Soil | RLLRAVRDDPPARGLFLDSLAASTALASRMREHS* |
| Ga0074057_100097821 | 3300006605 | Soil | NWTINSARDMAWNSARLLWAVRDDPLARGLFLDSLAASTALASRMREHS* |
| Ga0116214_12090651 | 3300009520 | Peatlands Soil | LLWAVRADPVARGLLLDSLAASTALASRMLLVAA* |
| Ga0116222_10771422 | 3300009521 | Peatlands Soil | AWTNCLLLWAVRDDPVARGLLLDSLAASTALASRMLLVAV* |
| Ga0116221_14112661 | 3300009523 | Peatlands Soil | TPNCNWTVNSARDLAWNNARLLWAVRDDPLARGLFLDSPAASTALASRMLLVAV* |
| Ga0116121_12731811 | 3300009644 | Peatland | RDLAWSNSLLLWELRDIPVARGLLLDNLAAATALASRMLLVAV* |
| Ga0116217_103461691 | 3300009700 | Peatlands Soil | LAWTNCLLLWAVRDDPIARGLFLDTLATSTALASQMLLVAV* |
| Ga0126380_114855822 | 3300010043 | Tropical Forest Soil | LAWNNCLLLWAVRSDPIARGLLADSLARSAALASRLLLVEV* |
| Ga0126384_100437771 | 3300010046 | Tropical Forest Soil | WNNCLLLGAVRDDPNASGLLAGSLARSAALASRMLLVAV* |
| Ga0126384_107133531 | 3300010046 | Tropical Forest Soil | INSARDLAWNNCLLLWAVRDDPIARGLLTDSLASSAALTSRLLLVAV* |
| Ga0126378_101491453 | 3300010361 | Tropical Forest Soil | MAWNNCLLLWAVRDDPIARGLFLAALAALAASTALASQMLLVAV* |
| Ga0126378_129725461 | 3300010361 | Tropical Forest Soil | SARDLAWNNCLLLWAVRDDPFARGLLADSLASSAAIASRLLLVAV* |
| Ga0126381_1012355332 | 3300010376 | Tropical Forest Soil | CNWTINGARDLAWNNARLLWAVRDNPLAHALLLDSLATSTAVASQMLLVAV* |
| Ga0126381_1020711661 | 3300010376 | Tropical Forest Soil | WTNCLLLWGMRDDPPARELFLGSLAASAAVASRLLLVAV* |
| Ga0134123_129758472 | 3300010403 | Terrestrial Soil | WNNCLLLWAVRDDPIARGLLADSLAGSAALTSRLLLVAV* |
| Ga0137381_102753422 | 3300012207 | Vadose Zone Soil | VEQRPAAVAVRDDPLARGLFLDSLAASTALASRMLLVAV* |
| Ga0126369_111466521 | 3300012971 | Tropical Forest Soil | SARDLAWNNCLLLWAVRDDPIARGLFLDTLATSTALASQMLLVAV* |
| Ga0164304_114177132 | 3300012986 | Soil | AAELAVDRHLAAVASLVTSWTITSAGDLAWNNALLLWALRDDPIARGLFPGTLATSTALASTMLLVAV* |
| Ga0120111_10997572 | 3300013764 | Permafrost | MSVPQPLHGNAARDLAWGNSLLLWQLRDAPFARGLFLDNLAVSVAVTSRLLLVAV* |
| Ga0181521_100134571 | 3300014158 | Bog | NSARDLAWNNSLLLWELRDIPLARQLFLDSLAATAATASRLLLVAV* |
| Ga0182036_106036302 | 3300016270 | Soil | ELAADRHLAAVANLIGNWSIAAARDLAWNNCLLLWAVRGDPVATGLLQDNLAAATALASRLLLVAV |
| Ga0182035_105420821 | 3300016341 | Soil | NCLLLWAVRDDPAATGLLQDNLAAATALAGRLLLVAV |
| Ga0182032_101926794 | 3300016357 | Soil | VANLIATWTINGARDMAWNNCLLLWAVRDDPIARGLFLGTLAASTALASQMLLVAF |
| Ga0182037_114569981 | 3300016404 | Soil | RDVAWNNSLLLWAIRDEPIPSDLFLGTLTSSTVLASRMLLVAV |
| Ga0187807_13181251 | 3300017926 | Freshwater Sediment | WNNCLLLWAVRDDPIARGLFLDTLATSTALASQMLLVAV |
| Ga0187817_111265081 | 3300017955 | Freshwater Sediment | NCLLLWAVRDDPIARGLFLDTLATSTALASQMLLVAV |
| Ga0187779_103793151 | 3300017959 | Tropical Peatland | TINSARDLAWTNSLLLWAVRDDPIARGLLADSLAASAALSSRLLLVTV |
| Ga0187778_108719711 | 3300017961 | Tropical Peatland | SARDLAWSNTLLLWAVRGDPIARGLFLDTLATSTALASQMLLVAV |
| Ga0187783_108927372 | 3300017970 | Tropical Peatland | DMAWNNCLLLWAVRDDPVARGLFLDTLAASTALASQMLLVAV |
| Ga0187777_109672322 | 3300017974 | Tropical Peatland | WDNCLLLWGMRDDPPARELFLGSLAASAAIASRLLLVAV |
| Ga0187815_104967171 | 3300018001 | Freshwater Sediment | NTARDMAWNNALLLWSLRDEAVMRGLFADGLAAAAALASRLLLVAV |
| Ga0187884_103732391 | 3300018009 | Peatland | ARLLWAVRDDPLARGLFLDSLAASTALASRMLLVAV |
| Ga0187882_13838552 | 3300018021 | Peatland | LAVDHHLSAVATLTSNWTMNSARDLAWNNSLLLWALRDDPFERGLLLDSLAATTAAASRMLLVAV |
| Ga0187766_111136481 | 3300018058 | Tropical Peatland | VLLWGMRDDPLARGLFLDSLAASAALASRLLLVAV |
| Ga0187772_109872542 | 3300018085 | Tropical Peatland | NNCLLLWAVRDDPIARGLVQDTLAASTALASQLLLVAV |
| Ga0182031_14358712 | 3300019787 | Bog | MNSARDLAWSNSLLLWELRDIPVARGSSWITWPPATALASRMLLVAV |
| Ga0210407_102173842 | 3300020579 | Soil | VAALTCNWTINSAWDLAWNNARPLRAVRDDPLAHGLFLDSLAASTALTSRMLLVAV |
| Ga0210404_102062171 | 3300021088 | Soil | LTCNWTINSAWDLAWNNARPLRAVRDDPLAHGLFLDSLAASTALTSRMLLVAV |
| Ga0210408_104188942 | 3300021178 | Soil | VAALTCNWTINSAWDPAWNNARPLRAVRDDPLAHGLFLDSLAASTALTSRMLLVAV |
| Ga0210388_105667941 | 3300021181 | Soil | RDLAWTNCLLLWAVRDDPIARELFLDALAASTTLASRMLLVAV |
| Ga0210388_114357692 | 3300021181 | Soil | NCLLLWAVRNDPVARGLFLDSLTASTALASRMLLVAV |
| Ga0210393_107014742 | 3300021401 | Soil | ARDLAWNNALLLWAVRDDPITRGLFLDTLATSTALASKMLLVAV |
| Ga0210385_114442421 | 3300021402 | Soil | IDHHLSAVATLTCNWTMNSARDLAWNNALLLWELRDVPVARGMLRENLAAATALASRLILVAV |
| Ga0210397_110132932 | 3300021403 | Soil | LAWNNALLLWAVRDDPITRGMFLDTLATSTALASRMLLVAV |
| Ga0210387_107938172 | 3300021405 | Soil | LHNARLWAVRDDLLALGLFLDSQAASTVLDGRILLVAV |
| Ga0210387_109052171 | 3300021405 | Soil | NSARDLAWTNSLLLWEVRADPLARGLLCDSLAAATAAASRMLLIAV |
| Ga0210387_117494192 | 3300021405 | Soil | IAAWSINSARDLAWTNSLLLWEVRADPLARGLLCDSLAAATAAASRMLLIAV |
| Ga0210383_104259261 | 3300021407 | Soil | TNCLLLWAVRDDRVARGLLLDGLAASAALASRLLLVAV |
| Ga0210383_108000652 | 3300021407 | Soil | IDHHLSAVATLTCNWTMNSARDLAWNNALLLWELRDVPVARGMLRDNLAAATALASRLILVAV |
| Ga0210394_110204401 | 3300021420 | Soil | AWTNCLLLWAVRDDPIARGLFLDALAASTTLASRMLLVAV |
| Ga0126371_102883961 | 3300021560 | Tropical Forest Soil | NSARDLAWTNCLLLWGMRDDPPARELFLGSLAASAAVASPLLLVAV |
| Ga0242648_10721931 | 3300022506 | Soil | NDARDLAWTNCLLLWAVRDDPIARGLFLDTLAASTALASRLVLVAV |
| Ga0208586_10821243 | 3300025588 | Arctic Peat Soil | ARDLAWTNSLLLWEVRADPLARGLLCDSLAAATAAASRMLLIAV |
| Ga0207693_113527172 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | LAWNNCLLLWAVRDDPVARGLLADSLAGSAALTSRLLLVAV |
| Ga0207640_108774631 | 3300025981 | Corn Rhizosphere | WTNTLLLWAVRDDPVASGLLLDSLAASAALASRMLLVAV |
| Ga0257147_10052433 | 3300026475 | Soil | LAWNNCLLLWAVRGDPIARGLLADSLASSAAIASRLLLVEV |
| Ga0209010_10855312 | 3300027370 | Forest Soil | AWGNSLLLWQLRDDSLVRGLFLDNLAVSVAVASRLLLVAV |
| Ga0208324_10061201 | 3300027604 | Peatlands Soil | AWNNARLLWAVRDDPLARGLFLDSLAASTALASRMLLVAV |
| Ga0209656_100285412 | 3300027812 | Bog Forest Soil | MGSRNSARDLAWNNARLLWAVRDDPLARGLFLDSLAASTALGSRMLLVAV |
| Ga0209040_104066091 | 3300027824 | Bog Forest Soil | LLLWELRDVPIARGLFLDSLATGTAMASRLLLVAM |
| Ga0209517_106475142 | 3300027854 | Peatlands Soil | LAWNNSLLLWEVRGDPVARGLLCDSLAATTAMASRLLLIAV |
| Ga0209579_103069451 | 3300027869 | Surface Soil | WTNCQLLWALRDNPIARPLFLDALAASTAMASRLLLVPV |
| Ga0209465_105273511 | 3300027874 | Tropical Forest Soil | LAWNNCLLLWAVRDDPVASRLVAGSLARSAAIASRLLLVAV |
| Ga0209624_103753282 | 3300027895 | Forest Soil | NSARDLAWNNCLLLWAVRNDPFARGLLLDSLATSTALASQMLLVAV |
| Ga0302220_102752701 | 3300028742 | Palsa | RDVAWKNCLLLWAVRHDPVARGLLLDSLAASTAMASRLLLVAV |
| Ga0307296_106869272 | 3300028819 | Soil | ARDLAWNNARLLWAVRNDPLARGLFLDSLAASTALASRMLLVAV |
| Ga0302230_101185231 | 3300028871 | Palsa | PELAVDHHLRAVATLTCNWTMNSARDLAWNNSLLLWALRDDPFERGLFMDSLAATTAAASRMLLVAV |
| Ga0307308_103660542 | 3300028884 | Soil | RDLAWNKARLLWAVRNDPLARGLFLDSLAASTALASRMLLVAV |
| Ga0308309_118597492 | 3300028906 | Soil | VHSGRDLAWNNARLLWAVRDDPLARGLFLDSLAASTALASRMLLVAV |
| Ga0311361_114260611 | 3300029911 | Bog | ELAVDHHLRAVATLTCNWTMNSARDLAWNNSLLLWALRDDPFERGLFMDSLAATTAAASRMLLVAV |
| Ga0311363_113208072 | 3300029922 | Fen | LAWNNSLLLWALRDDPFERGLFMDSLAATTAAASRMLLVAV |
| Ga0311330_108771391 | 3300029945 | Bog | LLLWELRDIPVARGLLLDNLAAATALASRMLLVAV |
| Ga0302190_101679502 | 3300029988 | Bog | LTCNWTMNSARDLAWNNSLLLWALRDDPFERGLFMDSLAATTAAASRMLLVAV |
| Ga0302178_101478821 | 3300030013 | Palsa | VATLTCNWTMNSARDLAWNNSLLLWALRDDPFERGLFLDTLAATTATASRMLLVAV |
| Ga0302181_102101541 | 3300030056 | Palsa | INSARDMAWKNCLLLWAVRHDPVARGLLLDSLAASTAMASRLLLVAV |
| Ga0311370_120441341 | 3300030503 | Palsa | LLLWAVRHNPVARALLLDSLAASTAMASRLLLVAV |
| Ga0311372_124326792 | 3300030520 | Palsa | NSLLLWDVRENPAARGLLCDSLAATTALASRMLLVAV |
| Ga0302324_1004200253 | 3300031236 | Palsa | LAWNNCLLLWAVRDDPIARGLFTDTLAASTALASQMLLIAA |
| Ga0302324_1023919722 | 3300031236 | Palsa | VEAVASLIANWTVNSARDLAWKNCLLLWTVRNDPFARGLLLDSLAASTALASQLLLVAV |
| Ga0318534_101256721 | 3300031544 | Soil | VANLIATWTINGARDMAWNNCLLLWAVRDDPIARGLFLGTLAASTALASQMLLVAV |
| Ga0318534_101669332 | 3300031544 | Soil | VANLIATWTINGARDMAWNNCLLLWAVRGDPIARGLFLDALAASTALASQMLLVAV |
| Ga0318538_107909902 | 3300031546 | Soil | RDLAWNNSLLLWAVRDDPIARGLMADSLAASAALSSRLLLVAV |
| Ga0318571_100086561 | 3300031549 | Soil | SIAAARDLAWNNCLLLWAVRGDPVATGLLQDNLAAATALASRLLLVAV |
| Ga0318571_100615162 | 3300031549 | Soil | DNCLLLWAVRDDPIARGLALDTLAASTALAGQMLLVAV |
| Ga0318571_103399552 | 3300031549 | Soil | ANLIGNWSIAAARDLAWNNCLLLWAVRDDPAAAGLLQDNLAAGTSLASRLLLVVV |
| Ga0318571_103514211 | 3300031549 | Soil | LIGNWSIATARDLAWNNCLLLWAVRDDPAATGLLQDNLAAATALAGRLLLVAV |
| Ga0318573_103522082 | 3300031564 | Soil | NNCLLLWAVRDDPLARGLLLDSLAAATALASRMLLVAV |
| Ga0318542_101866611 | 3300031668 | Soil | TNCLLLWGMRDDPPARELFLGSLAASAALASRLLLVAV |
| Ga0318542_104415261 | 3300031668 | Soil | SARDLAWNNCLLLWAVRDDPIARGLFLDSLAASTALASKTLLVAV |
| Ga0318561_107401621 | 3300031679 | Soil | LLLWGMRDDPPARELFLGSLAASAALASRLLLVAV |
| Ga0318574_103239231 | 3300031680 | Soil | AWTNCLLLWAVRDDPIARGLFLDTLAASTALASRLLLVAV |
| Ga0318574_104427351 | 3300031680 | Soil | CLLLWAVRDDPIARGLFLAALAASTALASQMLLVAV |
| Ga0310686_1012202692 | 3300031708 | Soil | DLAWNNCLLLWAVRDNPIARGLFLDTLATSTALASQMLLVAV |
| Ga0310686_1104839422 | 3300031708 | Soil | MMVSARDLAWNNARLLCAVRRDPLARGLFLDSLAASTALASRMLLVAV |
| Ga0318496_101122644 | 3300031713 | Soil | MAWNNCLLLWAVRDDPIARGLFLGTLAASTALASQM |
| Ga0318500_101174062 | 3300031724 | Soil | ARDLAWTNCLLLWGMRDDPIARELFLGSLAASAALASRLLLVAV |
| Ga0306918_112423162 | 3300031744 | Soil | ESAPELAADRHLAAVANLIGNWSIAAARDLAWNNCLLLWAVRGDPVATGLLQDNLAAATALASRLLLVAV |
| Ga0318502_101364553 | 3300031747 | Soil | WNNSLLLWAIRDDPIPSDLFLGTLTSSTVLASRMLLVAV |
| Ga0318502_109549613 | 3300031747 | Soil | RDLAWNNCLLLWAVRHDPIARGLLLNTLAASTALASQMLLVAV |
| Ga0318494_104726032 | 3300031751 | Soil | NSARDLAWNNSLLLWAVRDDPIARGLVTDGLAASAELTSRLLLVAV |
| Ga0318526_100135214 | 3300031769 | Soil | CLLLWAVRDDPIARGLALDTLAASTALAGRMLLVAV |
| Ga0318521_101863411 | 3300031770 | Soil | GNWSIATARDLAWNNCLLLWAVRDDPAATGLLQDNLAAATALASRLLLVAV |
| Ga0318521_106358642 | 3300031770 | Soil | VANLIATWTINGARDMAWNNCLLLWAVRDDPIARGLFLGTLAASTALASQMLLAAV |
| Ga0318521_107372801 | 3300031770 | Soil | PELAADRSQVAVANLIGNWSIAAARDLAWNNCLLLWAVRDDPVATGLLQDNLAAATALASRLLLVAV |
| Ga0318546_103070822 | 3300031771 | Soil | NNSLLLWAIRDVPVARGLFLDSLTASTVLASRLLLVAV |
| Ga0318566_102912441 | 3300031779 | Soil | RDLAWNNSLLLWAIRDVPVARGLLLDSLTASTVLASQLLLVAV |
| Ga0318547_110049071 | 3300031781 | Soil | VTTWTITSARDLAWNNTLLLWAVRDDPIARRLFLDALAASTALASKMLLVAV |
| Ga0318552_101148762 | 3300031782 | Soil | INSARDLAWTNCLLLWGMRGDPPARELFLGSLAASAALASRLLLVAV |
| Ga0318529_100712642 | 3300031792 | Soil | LAWNNCLLLWAVRGDPVATGLLQDNLAAATALASRLLLVAV |
| Ga0318548_102841222 | 3300031793 | Soil | NNARDLAWNNCLLLWAVRDDPLARGLLLDSLAAATALASRMLLVAV |
| Ga0318557_103536912 | 3300031795 | Soil | WNNCLLLWAVRDDPFARGLLADSLASSAALASRLLLVEL |
| Ga0318576_105874172 | 3300031796 | Soil | ARDLAWNNCLLLWAVRDDPIARGLLLNTLAASTALASQMLLVAV |
| Ga0318523_102447232 | 3300031798 | Soil | NNSLLLWAIRDVPVARGLLLDSLTASTVLASQLLLVAV |
| Ga0318568_110604221 | 3300031819 | Soil | ARDLAWNNCLLLWAVRDDPAAAGLLQDNLAAGTSLASRLLLVVV |
| Ga0318517_104758692 | 3300031835 | Soil | VANLIATWTINGARDMAWNNCLLLWAVRDDPIARGLFLGTLAASTALASQMLLVA |
| Ga0318512_104326562 | 3300031846 | Soil | MAWNNCLLLWAVRDDPIARGLFLGTLAASTALASQMLL |
| Ga0318495_100274181 | 3300031860 | Soil | RDLAWTNCLLLWGMRGDPPARELFLGSLAASAALASRLLLVAV |
| Ga0318495_100488023 | 3300031860 | Soil | LVASWSINNARDLAWNNCLLLWAVRDDPLARGLLLDSLAAATALASRMLLVAV |
| Ga0306919_108733321 | 3300031879 | Soil | AVANLIATWTINGARDMAWNNCLLLWAVRDDPIARGLFLGTLAASTALASQMLLVAV |
| Ga0306923_105585471 | 3300031910 | Soil | TITSARDLAWDNCLLLWAVRDDPIARGLALDTLAASTALAGQMLLVAV |
| Ga0306923_108090111 | 3300031910 | Soil | VANLIATWTINGARDMAWNNCLLLWAVRDDPIARGLFLAALAASTALASQMLLVAV |
| Ga0306923_109003181 | 3300031910 | Soil | IISARDLAWNNCLLLWAVRDDPIARGLFLDSLAASTALASKTLLVAV |
| Ga0308174_114162021 | 3300031939 | Soil | AVANLIASWTITSARDLAWNNCLLLWAVRDDPIARGLFLGTLATATALASKMLLVAV |
| Ga0310913_107585271 | 3300031945 | Soil | NNARLLWAVRDDPLARGLFLDSLAASTALASRMLLVAV |
| Ga0310913_113175592 | 3300031945 | Soil | EIGLGNRAAVANLIATWTINGARDMAWNNCLLLWAVRDDPIARGLFLGTLAASTALASQMLLVAV |
| Ga0310910_103061693 | 3300031946 | Soil | SLLLWEVRGDPIARGLLADSLAATAALCSRLLLVAV |
| Ga0310909_103934213 | 3300031947 | Soil | NARDLAWNNCLLLWAVRDDPLARGLLLDSLAAATALASRMLLVAV |
| Ga0310909_112687372 | 3300031947 | Soil | DLAWDNCLLLWAVRDDPIARGLALDTLAASTALAGRMLLVAV |
| Ga0310909_115341752 | 3300031947 | Soil | LREIGLGNRAAVANLIATWTINGARDMAWNNCLLLWAVRDDPIARGLFLGTLAASTALASQMLLVAV |
| Ga0306922_109461103 | 3300032001 | Soil | VSAVAVLNLIATWTVNGARDMAWNNCLLLWAVRDDPIARGLFLAALAASTALASQMLLVA |
| Ga0318563_105335781 | 3300032009 | Soil | AWTNSLLLWAVRDDQIPRELFLDALAASTALASRLLLVAV |
| Ga0318556_106223632 | 3300032043 | Soil | SWSINNARDLAWNNCLLLWAVRDDPLARGLLLDSLAAATALASRMLLVAV |
| Ga0318558_100925993 | 3300032044 | Soil | ARDLAWNNSLLLWEVRGDPIARGLLADSLAATAALCSRLLLVAV |
| Ga0318570_101867381 | 3300032054 | Soil | LLLWEVRGDPIARGLLADSLAATAALCSRLLLVAV |
| Ga0318570_104604481 | 3300032054 | Soil | INSARDMAWNNCLLLWAVRDDPFARGLLADSLASSAALASRLLLVEL |
| Ga0318533_105195341 | 3300032059 | Soil | NNCLLLWAVRDDPAATGLLQDNLAAATALAGRLLLVAV |
| Ga0318505_102276022 | 3300032060 | Soil | LLLWAVRDDPLARGLLLDSLAAATALASRMLLVAV |
| Ga0318505_105286021 | 3300032060 | Soil | RPRLREIGLGNRAAVANLIATWTINGARDMAWNNCLLLWAVRDDPIARGLFLGTLAASTALASQMLLVAV |
| Ga0318513_105540111 | 3300032065 | Soil | LLLWAVRDDPIARGLFLDSLAASTALASKTLLVAV |
| Ga0318514_101088161 | 3300032066 | Soil | IGNWSIAAARDLAWNNCLLLWAVRGDPVATGLLQDNLAAATALASRLLLVAV |
| Ga0306924_106425161 | 3300032076 | Soil | AARDLAWNNCLLLWAVRDDPAAAGLLQDNLAAGTSLASRLLLVVV |
| Ga0318525_101991033 | 3300032089 | Soil | AWNNSLLLWAIRDVPVARGLLLDSLTASTVLASQLLLVAV |
| Ga0318540_100700813 | 3300032094 | Soil | FQARSRAVRDDPAATGLLQDNLAAATALAGRLLLVAV |
| Ga0311301_111240401 | 3300032160 | Peatlands Soil | LLLWAVRDDPIARGLFLDTLATSTALASQMLLVAV |
| Ga0311301_121009031 | 3300032160 | Peatlands Soil | NCLLLWAVRDDPIARGLFLDMLAASTALASRLLLVAV |
| Ga0306920_1010998851 | 3300032261 | Soil | WNNSLLLWAVRDDPIARGLVTDGLAASAELTSRLLLVAV |
| Ga0306920_1044594001 | 3300032261 | Soil | DMAWNNCLLLWAVRDDPVARGLFLGTLAASTALAGRMLLVAV |
| Ga0335085_113611411 | 3300032770 | Soil | TINSARDLAWNNCLLLWAVRDNPIARGLFLDSLAASTALSSRMLLVAV |
| Ga0335078_107107921 | 3300032805 | Soil | SARDLAWNNCLLLWAVRSDPIASGLLADSLARSAALTSRLLLVAV |
| Ga0335080_103479841 | 3300032828 | Soil | NFLLLWAVRDDPIARGLLADSLAGSAAVASRLLLVAV |
| Ga0335080_112911621 | 3300032828 | Soil | RDLAWDNCLLLWGMRDDPPARELFLGSLAASAALASRLLLVAV |
| Ga0335070_116965082 | 3300032829 | Soil | AWNNSLLLWEIRADPFVSGLFGDSLAASTAAASRMLLIAV |
| Ga0335074_108757871 | 3300032895 | Soil | DLSWNNALLLWAVRDDPIARGLLLDTLAASTALASQMLLVAV |
| Ga0335076_108643173 | 3300032955 | Soil | NSLLLWEIRANPFACGLFRDSLAASTAAASRLLLIAV |
| Ga0335084_115116721 | 3300033004 | Soil | WTNCLLLWAVRDNPVARGLLLDSLAASAALASRMLLVAV |
| Ga0335077_105197841 | 3300033158 | Soil | WNNTRLLWALRDDPLVRGLFLDSLAASTALASRMLLVAV |
| ⦗Top⦘ |