Metagenome / Metatranscriptome Family F032427

Overview

Basic Information

• Family ID: F032427
• Family Type: Metagenome / Metatranscriptome
• Number of Sequences: 180
• Average Sequence Length: 41 residues
• Representative Sequence: VESIVFIVVLLVGIFAFDLGRRWWRENEWRRRWRERDDD
• Number of Associated Samples: 147
• Number of Associated Scaffolds: 180

Quality Assessment

• Transcriptomic Evidence: Yes
• Most common taxonomic group: Bacteria
• % of genes with valid RBS motifs: 31.46 %
• % of genes near scaffold ends (potentially truncated): 26.11 %
• % of genes from short scaffolds (< 2000 bps): 88.89 %
• Associated GOLD sequencing projects: 129
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.48

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Bacteria (72.778 % of family members)
• NCBI Taxonomy ID: 2
• Taxonomy: All Organisms → cellular organisms → Bacteria

Most Common Ecosystem

• GOLD Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (6.667 % of family members)
• Environment Ontology (ENVO): Unclassified (40.556 % of family members)
• Earth Microbiome Project Ontology (EMPO): Host-associated → Plant → Plant rhizosphere (46.667 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Transmembrane (alpha-helical)
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 53.73%
  β-sheet: 0.00%
  Coil/Unstructured: 46.27%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 180 Family Scaffolds
PF03372	Exo_endo_phos	7.22
PF11604	CusF_Ec	3.33
PF01904	DUF72	2.22
PF00106	adh_short	1.11
PF00487	FA_desaturase	1.11
PF02630	SCO1-SenC	1.11
PF13490	zf-HC2	0.56
PF03928	HbpS-like	0.56
PF13518	HTH_28	0.56
PF07676	PD40	0.56
PF13649	Methyltransf_25	0.56
PF08245	Mur_ligase_M	0.56

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 180 Family Scaffolds
COG1801	Sugar isomerase-related protein YecE, UPF0759/DUF72 family	General function prediction only [R]	2.22
COG1225	Peroxiredoxin	Posttranslational modification, protein turnover, chaperones [O]	1.11
COG1398	Fatty-acid desaturase	Lipid transport and metabolism [I]	1.11
COG1999	Cytochrome oxidase Cu insertion factor, SCO1/SenC/PrrC family	Posttranslational modification, protein turnover, chaperones [O]	1.11
COG3239	Fatty acid desaturase	Lipid transport and metabolism [I]	1.11

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	72.78 %
Unclassified	root	N/A	27.22 %

Level 2

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	72.78 %
Unclassified	root	N/A	27.22 %

Level 3

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	72.78 %
Unclassified	root	N/A	27.22 %

Level 4

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	27.22 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	23.33 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.56 %

Level 5

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	27.22 %
Vicinamibacteria	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria	3.33 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	1.67 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.56 %

Level 6

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	27.22 %
Vicinamibacterales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales	3.33 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1.67 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.56 %

Level 7

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	27.22 %
Vicinamibacteraceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae	3.33 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1.67 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.56 %

Level 8

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	27.22 %
Luteitalea	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea	3.33 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1.67 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.56 %

Level 9

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	27.22 %
Luteitalea pratensis	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis	3.33 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1.67 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.56 %

Associated Scaffolds

Scaffold	Taxonomy	Length
2124908007|FWIRElOz_GKZ9IRQ02I2KP7	Not Available	522
2170459005|F1BAP7Q01DP7MN	All Organisms → cellular organisms → Bacteria	526
2170459006|GBPF9FW02GG840	Not Available	534
2170459008|GA8OVOZ01BCTT7	All Organisms → cellular organisms → Bacteria	519
2199352025|deepsgr__Contig_151289	Not Available	560
3300001686|C688J18823_10047013	All Organisms → cellular organisms → Bacteria	2984
3300001686|C688J18823_10534525	Not Available	750
3300002568|C688J35102_118628432	Not Available	579
3300002568|C688J35102_118864125	All Organisms → cellular organisms → Bacteria	606
3300003267|soilL1_10098599	All Organisms → cellular organisms → Bacteria	1513
3300004081|Ga0063454_100135161	All Organisms → cellular organisms → Bacteria → Acidobacteria	1269
3300004081|Ga0063454_100672040	All Organisms → cellular organisms → Bacteria	774
3300004153|Ga0063455_100825688	All Organisms → cellular organisms → Bacteria	646
3300004157|Ga0062590_100747976	All Organisms → cellular organisms → Bacteria	889
3300004463|Ga0063356_100305524	All Organisms → cellular organisms → Bacteria	1976
3300004479|Ga0062595_102039482	All Organisms → cellular organisms → Bacteria → Acidobacteria	555
3300004480|Ga0062592_100492515	All Organisms → cellular organisms → Bacteria	1010
3300005148|Ga0066819_1024964	Not Available	521
3300005169|Ga0066810_10184691	All Organisms → cellular organisms → Bacteria	516
3300005294|Ga0065705_10362553	Not Available	937
3300005295|Ga0065707_10279394	All Organisms → cellular organisms → Bacteria → Acidobacteria	1051
3300005330|Ga0070690_100846965	Not Available	712
3300005334|Ga0068869_100242931	All Organisms → cellular organisms → Bacteria	1435
3300005334|Ga0068869_100856595	All Organisms → cellular organisms → Bacteria	784
3300005335|Ga0070666_10815347	All Organisms → cellular organisms → Bacteria	688
3300005338|Ga0068868_100741243	All Organisms → cellular organisms → Bacteria	882
3300005340|Ga0070689_100542634	All Organisms → cellular organisms → Bacteria	1001
3300005344|Ga0070661_101205474	All Organisms → cellular organisms → Bacteria	633
3300005364|Ga0070673_102415593	Not Available	500
3300005438|Ga0070701_10004345	All Organisms → cellular organisms → Bacteria → Proteobacteria	5725
3300005438|Ga0070701_10649926	Not Available	704
3300005440|Ga0070705_100174172	All Organisms → cellular organisms → Bacteria	1451
3300005444|Ga0070694_101387356	All Organisms → cellular organisms → Bacteria	593
3300005456|Ga0070678_100486016	All Organisms → cellular organisms → Bacteria → Acidobacteria	1087
3300005457|Ga0070662_100182556	All Organisms → cellular organisms → Bacteria	1655
3300005526|Ga0073909_10081527	All Organisms → cellular organisms → Bacteria → Acidobacteria	1244
3300005530|Ga0070679_101239747	Not Available	691
3300005578|Ga0068854_100940254	All Organisms → cellular organisms → Bacteria	762
3300005617|Ga0068859_100854243	All Organisms → cellular organisms → Bacteria	996
3300005713|Ga0066905_101308840	Not Available	652
3300005718|Ga0068866_10238422	All Organisms → cellular organisms → Bacteria	1106
3300005764|Ga0066903_102431313	All Organisms → cellular organisms → Bacteria	1014
3300005842|Ga0068858_100627920	All Organisms → cellular organisms → Bacteria	1043
3300005842|Ga0068858_101973058	All Organisms → cellular organisms → Bacteria	577
3300005844|Ga0068862_102323219	All Organisms → cellular organisms → Bacteria	548
3300005949|Ga0066791_10006078	All Organisms → cellular organisms → Bacteria	2818
3300005994|Ga0066789_10299282	Not Available	673
3300006041|Ga0075023_100112677	All Organisms → cellular organisms → Bacteria	956
3300006057|Ga0075026_101066242	Not Available	506
3300006172|Ga0075018_10369157	All Organisms → cellular organisms → Bacteria	723
3300006237|Ga0097621_100249713	All Organisms → cellular organisms → Bacteria	1553
3300006237|Ga0097621_101502704	All Organisms → cellular organisms → Bacteria	639
3300006358|Ga0068871_101577398	Not Available	621
3300006358|Ga0068871_101626865	Not Available	612
3300006572|Ga0074051_11182540	All Organisms → cellular organisms → Bacteria	856
3300006577|Ga0074050_11801277	All Organisms → cellular organisms → Bacteria	950
3300006578|Ga0074059_11982800	All Organisms → cellular organisms → Bacteria → Acidobacteria	677
3300006606|Ga0074062_11713588	All Organisms → cellular organisms → Bacteria	900
3300006852|Ga0075433_10335777	All Organisms → cellular organisms → Bacteria	1336
3300006881|Ga0068865_100457081	All Organisms → cellular organisms → Bacteria	1057
3300006953|Ga0074063_12855783	All Organisms → cellular organisms → Bacteria	571
3300009029|Ga0066793_10038940	All Organisms → cellular organisms → Bacteria	2668
3300009029|Ga0066793_10171218	All Organisms → cellular organisms → Bacteria	1265
3300009093|Ga0105240_11569103	All Organisms → cellular organisms → Bacteria	689
3300009137|Ga0066709_104197796	All Organisms → cellular organisms → Bacteria	525
3300009148|Ga0105243_12291135	Not Available	577
3300009148|Ga0105243_13034774	All Organisms → cellular organisms → Bacteria	509
3300009162|Ga0075423_12391457	Not Available	576
3300009177|Ga0105248_10189681	All Organisms → cellular organisms → Bacteria	2316
3300009177|Ga0105248_11597917	All Organisms → cellular organisms → Bacteria	739
3300009177|Ga0105248_12124062	Not Available	639
3300009177|Ga0105248_12911460	All Organisms → cellular organisms → Bacteria → Acidobacteria	546
3300009661|Ga0105858_1292934	Not Available	508
3300009662|Ga0105856_1026348	All Organisms → cellular organisms → Bacteria → Acidobacteria	1654
3300009662|Ga0105856_1358312	Not Available	502
3300010362|Ga0126377_13423863	Not Available	513
3300010399|Ga0134127_10237008	All Organisms → cellular organisms → Bacteria	1719
3300010399|Ga0134127_10492907	All Organisms → cellular organisms → Bacteria	1235
3300010400|Ga0134122_10026670	All Organisms → cellular organisms → Bacteria	4356
3300010400|Ga0134122_11019182	All Organisms → cellular organisms → Bacteria → Acidobacteria	813
3300010400|Ga0134122_12052751	Not Available	611
3300010401|Ga0134121_12861861	All Organisms → cellular organisms → Bacteria	529
3300010401|Ga0134121_12905395	Not Available	526
3300010403|Ga0134123_10127607	All Organisms → cellular organisms → Bacteria	2070
3300010876|Ga0126361_10995961	Not Available	587
3300011414|Ga0137442_1105414	Not Available	616
3300011421|Ga0137462_1171130	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	536
3300012212|Ga0150985_112905506	Not Available	576
3300012212|Ga0150985_118721134	Not Available	610
3300012212|Ga0150985_118952477	All Organisms → cellular organisms → Bacteria	527
3300012469|Ga0150984_102364167	All Organisms → cellular organisms → Bacteria → Acidobacteria	787
3300012469|Ga0150984_107661973	All Organisms → cellular organisms → Bacteria	857
3300012469|Ga0150984_116334942	All Organisms → cellular organisms → Bacteria → Acidobacteria	807
3300012685|Ga0137397_10868722	All Organisms → cellular organisms → Bacteria → Acidobacteria	669
3300012916|Ga0157310_10086781	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	982
3300012924|Ga0137413_10934041	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	676
3300012927|Ga0137416_10680733	All Organisms → cellular organisms → Bacteria	902
3300012929|Ga0137404_12026047	Not Available	537
3300012944|Ga0137410_10493882	All Organisms → cellular organisms → Bacteria → Acidobacteria	999
3300012944|Ga0137410_11106553	All Organisms → cellular organisms → Bacteria	678
3300012955|Ga0164298_11168310	All Organisms → cellular organisms → Bacteria	581
3300012984|Ga0164309_11047587	All Organisms → cellular organisms → Bacteria	675
3300013297|Ga0157378_13197373	Not Available	509
3300013306|Ga0163162_10928885	All Organisms → cellular organisms → Bacteria	982
3300014325|Ga0163163_10080708	All Organisms → cellular organisms → Bacteria	3253
3300014969|Ga0157376_10708427	All Organisms → cellular organisms → Bacteria	1012
3300015162|Ga0167653_1035459	All Organisms → cellular organisms → Bacteria → Acidobacteria	921
3300015199|Ga0167647_1049335	All Organisms → cellular organisms → Bacteria	1171
3300015242|Ga0137412_11096873	Not Available	564
3300017792|Ga0163161_10808943	Not Available	788
3300018051|Ga0184620_10039122	All Organisms → cellular organisms → Bacteria	1286
3300018056|Ga0184623_10244832	All Organisms → cellular organisms → Bacteria	819
3300018469|Ga0190270_11170707	All Organisms → cellular organisms → Bacteria	806
3300018476|Ga0190274_10353301	All Organisms → cellular organisms → Bacteria	1399
3300019362|Ga0173479_10087258	All Organisms → cellular organisms → Bacteria	1124
3300020000|Ga0193692_1012720	All Organisms → cellular organisms → Bacteria	2053
3300020580|Ga0210403_10445713	All Organisms → cellular organisms → Bacteria	1055
3300021080|Ga0210382_10361284	All Organisms → cellular organisms → Bacteria → Acidobacteria	641
3300021602|Ga0194060_10005703	All Organisms → cellular organisms → Bacteria → Acidobacteria	8487
3300021861|Ga0213853_10288574	All Organisms → cellular organisms → Bacteria	1522
3300022756|Ga0222622_10022672	All Organisms → cellular organisms → Bacteria	3225
3300022756|Ga0222622_10229070	All Organisms → cellular organisms → Bacteria	1248
3300025899|Ga0207642_10254961	All Organisms → cellular organisms → Bacteria	997
3300025903|Ga0207680_10407369	All Organisms → cellular organisms → Bacteria	962
3300025907|Ga0207645_10606865	Not Available	743
3300025908|Ga0207643_10583477	Not Available	719
3300025913|Ga0207695_11227495	All Organisms → cellular organisms → Bacteria	630
3300025917|Ga0207660_10553527	All Organisms → cellular organisms → Bacteria	936
3300025921|Ga0207652_11058667	All Organisms → cellular organisms → Bacteria → Acidobacteria	711
3300025926|Ga0207659_10623932	All Organisms → cellular organisms → Bacteria → Acidobacteria	920
3300025940|Ga0207691_10151703	All Organisms → cellular organisms → Bacteria	2037
3300025941|Ga0207711_10127787	All Organisms → cellular organisms → Bacteria → Acidobacteria	2275
3300025941|Ga0207711_10192278	All Organisms → cellular organisms → Bacteria → Acidobacteria	1860
3300025941|Ga0207711_11837117	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis	549
3300025942|Ga0207689_10830430	All Organisms → cellular organisms → Bacteria → Acidobacteria	780
3300025944|Ga0207661_10874545	All Organisms → cellular organisms → Bacteria	828
3300025944|Ga0207661_12107346	All Organisms → cellular organisms → Bacteria	510
3300025981|Ga0207640_11713338	All Organisms → cellular organisms → Bacteria → Acidobacteria	567
3300025986|Ga0207658_10953324	All Organisms → cellular organisms → Bacteria	782
3300026023|Ga0207677_10739419	All Organisms → cellular organisms → Bacteria → Acidobacteria	876
3300026221|Ga0209848_1047567	All Organisms → cellular organisms → Bacteria	786
3300026221|Ga0209848_1092143	Not Available	529
3300026276|Ga0209847_1015192	All Organisms → cellular organisms → Bacteria → Acidobacteria	1671
3300027821|Ga0209811_10051504	All Organisms → cellular organisms → Bacteria	1408
3300027895|Ga0209624_11051169	Not Available	526
3300027905|Ga0209415_10622928	All Organisms → cellular organisms → Bacteria → Acidobacteria	793
3300027907|Ga0207428_10034328	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis	4158
3300027909|Ga0209382_10025576	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis	7139
3300027910|Ga0209583_10305325	Not Available	724
3300027911|Ga0209698_11154735	Not Available	572
3300027986|Ga0209168_10218250	All Organisms → cellular organisms → Bacteria	950
3300028380|Ga0268265_11569383	All Organisms → cellular organisms → Bacteria	663
3300028381|Ga0268264_10174773	All Organisms → cellular organisms → Bacteria	1946
3300028381|Ga0268264_11183217	Not Available	774
3300028381|Ga0268264_11590461	All Organisms → cellular organisms → Bacteria → Acidobacteria	664
3300028381|Ga0268264_12071462	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis	578
3300028768|Ga0307280_10189917	Not Available	723
3300028784|Ga0307282_10356305	Not Available	707
3300028807|Ga0307305_10572580	Not Available	503
3300028824|Ga0307310_10662957	Not Available	534
3300030007|Ga0311338_11584046	Not Available	600
3300031057|Ga0170834_103070954	Not Available	588
3300031199|Ga0307495_10243989	All Organisms → cellular organisms → Bacteria	514
3300031231|Ga0170824_109686212	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis	628
3300031235|Ga0265330_10241413	All Organisms → cellular organisms → Bacteria → Acidobacteria	762
3300031446|Ga0170820_13118419	All Organisms → cellular organisms → Bacteria	753
3300031736|Ga0318501_10339430	All Organisms → cellular organisms → Bacteria → Acidobacteria	806
3300031782|Ga0318552_10462165	Not Available	648
3300031792|Ga0318529_10135839	All Organisms → cellular organisms → Bacteria	1126
3300031847|Ga0310907_10828687	Not Available	519
3300031879|Ga0306919_10762690	All Organisms → cellular organisms → Bacteria → Acidobacteria	744
3300031997|Ga0315278_12198282	All Organisms → cellular organisms → Bacteria → Acidobacteria	510
3300032013|Ga0310906_10431856	All Organisms → cellular organisms → Bacteria → Acidobacteria	877
3300032163|Ga0315281_10010442	All Organisms → cellular organisms → Bacteria	12806
3300032163|Ga0315281_10123357	All Organisms → cellular organisms → Bacteria → Acidobacteria	2970
3300032173|Ga0315268_12580383	All Organisms → cellular organisms → Bacteria	522
3300032205|Ga0307472_102547632	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis	521
3300034268|Ga0372943_0054392	All Organisms → cellular organisms → Bacteria → Acidobacteria	2246

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Environmental	Environmental	65.56%
Host-Associated	Host-Associated	34.44%

Class

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	55.56%
Plants	Host-Associated → Plants	34.44%
Aquatic	Environmental → Aquatic	10.00%

Category

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	55.00%
Rhizosphere	Host-Associated → Plants → Rhizosphere	16.67%
Rhizoplane	Host-Associated → Plants → Rhizoplane	15.00%
Sediment	Environmental → Aquatic → Sediment	6.11%
Freshwater	Environmental → Aquatic → Freshwater	3.89%
Roots	Host-Associated → Plants → Roots	2.78%
Peat	Environmental → Terrestrial → Peat	0.56%

Type

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	37.22%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	12.78%
Loam	Environmental → Terrestrial → Soil → Loam	12.22%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	9.44%
Soil	Host-Associated → Plants → Rhizosphere → Soil	7.22%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	6.11%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	5.56%
Lake	Environmental → Aquatic → Freshwater → Lake	2.78%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	2.78%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	1.67%
Sediment	Environmental → Aquatic → Freshwater → Sediment	1.11%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	0.56%
Soil	Host-Associated → Plants → Rhizoplane → Soil	0.56%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	26.11%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	12.78%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	9.44%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	7.22%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	6.11%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	6.11%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	5.56%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost	5.56%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	3.89%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	2.78%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	2.22%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	2.22%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	2.22%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	2.22%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	1.67%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	1.11%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	1.11%
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	0.56%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	0.56%
Unclassified	Host-Associated → Plants → Rhizoplane → Soil → Unclassified	0.56%

Habitat

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	6.67%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	5.00%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	5.00%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	5.00%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	4.44%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	4.44%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	3.89%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	3.89%
Permafrost Soil	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil	3.33%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	2.78%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	2.78%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	2.78%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	2.22%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	2.22%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	2.22%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	2.22%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	2.22%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	1.67%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	1.67%
Grass Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil	1.67%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	1.67%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	1.67%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	1.67%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	1.67%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere	1.67%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	1.11%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	1.11%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	1.11%
Glacier Forefield Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil	1.11%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere	1.11%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	1.11%
Soil	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil	1.11%
Prmafrost Soil	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil	1.11%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	1.11%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	1.11%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	1.11%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.11%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	1.11%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.11%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	1.11%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	0.56%
Watersheds	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds	0.56%
Anoxic Zone Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater	0.56%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	0.56%
Peatlands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil	0.56%
Sugarcane Root And Bulk Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil	0.56%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	0.56%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.56%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	0.56%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	0.56%
Palsa	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa	0.56%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	0.56%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere	0.56%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	0.56%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere	0.56%
Boreal Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil	0.56%

Associated Samples

Taxon OID	Sample Name	Habitat Type
2124908007	Soil microbial communities from sample at FACE Site Metagenome WIR_ElevOz2	Environmental
2170459005	Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm	Environmental
2170459006	Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect in plug lysis (for fosmid construction) 0-10cm	Environmental
2170459008	Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect DNA Tissue lysis 0-10cm	Environmental
2199352025	Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL	Environmental
3300001686	Grasslands soil microbial communities from Hopland, California, USA	Environmental
3300002568	Grasslands soil microbial communities from Hopland, California, USA - 2	Environmental
3300003267	Sugarcane bulk soil Sample L1	Environmental
3300004081	Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)	Environmental
3300004153	Grasslands soil microbial communities from Hopland, California, USA (version 2)	Environmental
3300004157	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2	Environmental
3300004463	Combined assembly of Arabidopsis thaliana microbial communities	Host-Associated
3300004479	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs	Environmental
3300004480	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4	Environmental
3300005148	Soil and rhizosphere microbial communities from Laval, Canada - mgLMA	Environmental
3300005169	Soil and rhizosphere microbial communities from Laval, Canada - mgHPA	Environmental
3300005294	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil	Environmental
3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3	Environmental
3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Environmental
3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Host-Associated
3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Host-Associated
3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Host-Associated
3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Environmental
3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Host-Associated
3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Host-Associated
3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Environmental
3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Environmental
3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Environmental
3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Host-Associated
3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Host-Associated
3300005526	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1	Environmental
3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Environmental
3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Host-Associated
3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Host-Associated
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental
3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Host-Associated
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental
3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Host-Associated
3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Host-Associated
3300005949	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil leachate replicate DNA2013-051	Environmental
3300005994	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049	Environmental
3300006041	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014	Environmental
3300006057	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012	Environmental
3300006172	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014	Environmental
3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)	Host-Associated
3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Host-Associated
3300006572	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPB (Metagenome Metatranscriptome)	Environmental
3300006577	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPA (Metagenome Metatranscriptome)	Environmental
3300006578	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome)	Environmental
3300006606	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome)	Environmental
3300006852	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Host-Associated
3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Host-Associated
3300006953	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome)	Environmental
3300009029	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189	Environmental
3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Host-Associated
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated
3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Host-Associated
3300009661	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-062	Environmental
3300009662	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-060	Environmental
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental
3300010399	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3	Environmental
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental
3300010401	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1	Environmental
3300010403	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3	Environmental
3300010876	Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome)	Environmental
3300011414	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT266_2	Environmental
3300011421	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT769_2	Environmental
3300012212	Combined assembly of Hopland grassland soil	Host-Associated
3300012469	Combined assembly of Soil carbon rhizosphere	Host-Associated
3300012685	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG	Environmental
3300012916	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2	Environmental
3300012918	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG	Environmental
3300012924	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)	Environmental
3300012927	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)	Environmental
3300012929	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)	Environmental
3300012944	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)	Environmental
3300012955	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG	Environmental
3300012984	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG	Environmental
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated
3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Host-Associated
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated
3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Host-Associated
3300015162	Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-4c, rock/ice/stream interface)	Environmental
3300015199	Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-2c, rock/snow interface)	Environmental
3300015242	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)	Environmental
3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Host-Associated
3300018051	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1	Environmental
3300018056	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1	Environmental
3300018469	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T	Environmental
3300018476	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T	Environmental
3300019362	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)	Environmental
3300020000	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a1	Environmental
3300020580	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M	Environmental
3300021080	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo	Environmental
3300021602	Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L222-5m	Environmental
3300021861	Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome)	Environmental
3300022756	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1	Environmental
3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)	Host-Associated
3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)	Host-Associated
3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)	Host-Associated
3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)	Host-Associated
3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)	Host-Associated
3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)	Environmental
3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)	Environmental
3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)	Host-Associated
3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)	Host-Associated
3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)	Host-Associated
3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)	Host-Associated
3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)	Environmental
3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)	Host-Associated
3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)	Host-Associated
3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)	Host-Associated
3300026221	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-062 (SPAdes)	Environmental
3300026276	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-060 (SPAdes)	Environmental
3300027821	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes)	Environmental
3300027895	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)	Environmental
3300027905	Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)	Environmental
3300027907	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)	Host-Associated
3300027909	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)	Host-Associated
3300027910	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes)	Environmental
3300027911	Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)	Environmental
3300027986	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes)	Environmental
3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)	Host-Associated
3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)	Host-Associated
3300028768	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119	Environmental
3300028784	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121	Environmental
3300028807	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186	Environmental
3300028824	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197	Environmental
3300030007	I_Palsa_E1 coassembly	Environmental
3300031057	Oak Coassembly Site 11 - Champenoux / Amance forest	Environmental
3300031199	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_S	Environmental
3300031231	Coassembly Site 11 (all samples) - Champenoux / Amance forest	Environmental
3300031235	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG	Host-Associated
3300031446	Fir Summer Coassembly Site 11 - Champenoux / Amance forest	Environmental
3300031736	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21	Environmental
3300031782	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20	Environmental
3300031792	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23	Environmental
3300031847	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4	Environmental
3300031879	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)	Environmental
3300031997	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0	Environmental
3300032013	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3	Environmental
3300032163	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0	Environmental
3300032173	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top	Environmental
3300032205	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05	Environmental
3300034268	Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2	Environmental

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
FWIRElOz_00562020	2124908007	Soil	VLTVIFIVVLIAGIFIADIAGRWWRENEWRRRWKDRADDD
E41_02829580	2170459005	Grass Soil	VESIVFIVLLLVGIFAFDLGKRWWRENEWQRRWRERDDD
L01_08207740	2170459006	Grass Soil	LVFLVGATVFIVVLLVGIFAVDLGRRWWRENEWQRRWRRRDDDD
F48_02557420	2170459008	Grass Soil	VLTVIFIVVLIVGIFIADIAGRWWRENEWRRRWKDRADDD
deepsgr_02487920	2199352025	Soil	LLFLVGATVFIVVLLVGIFAVDLGRRWWRENEWQRRWRRRDEDD
C688J18823_100470133	3300001686	Soil	VEATVFIVILIVGIFVFDLGRRWWLENEWQRRWKERDEE*
C688J18823_105345251	3300001686	Soil	VEATVFIVILIVGIFVFDLARRWWLENEWQRRWKERDEE*
C688J35102_1186284322	3300002568	Soil	TGPPLFWSGLVESTFFIVSLIACIFAFDLGKRWWRENEWRRRWRQRDDD*
C688J35102_1188641251	3300002568	Soil	LADLVESTVFIVVLLVGIFAFDLWRRWWRENEWRRRWREREDD*
soilL1_100985994	3300003267	Sugarcane Root And Bulk Soil	VGAAIFIAALILVIFAVDIGSRWWRENEWRRRWRERERGDE*
Ga0063454_1001351614	3300004081	Soil	VEATVFIILLIVGIFIFDLGRRWWLENEWQRRWKERDED*
Ga0063454_1006720402	3300004081	Soil	LIPRVEATVFIVILIVGIFVFDLARRWWLENEWQRRWKERDE
Ga0063455_1008256882	3300004153	Soil	VESTFFIVLLIACIFAFDLGKRWWRENEWRRRWRQRDDD*
Ga0062590_1007479762	3300004157	Soil	VEAALFIVVLIFVIFAVDIGSRWWRENEWRRRWRERQRDDD*
Ga0063356_1003055241	3300004463	Arabidopsis Thaliana Rhizosphere	VEAALFIAALIFVIFAVDIIGRWWRENEWRRRWRERERDDE*
Ga0062595_1020394821	3300004479	Soil	VESIVFIVVLLVGIFAFDLGKRWWRENEWQRRWRERDED*
Ga0062592_1004925152	3300004480	Soil	VEAVLFIIALLFIIFAVDLGGRWWRENEWRRRWRERDDE*
Ga0066819_10249641	3300005148	Soil	LVFLVEATVFIVVLLVGIFVVDLGRRWWRENEWQRRWRRRDEDD*
Ga0066810_101846912	3300005169	Soil	LLVESIVFIVVLVVGIFVFDLGWRWWRENEWQRRWRDRDDDD*
Ga0065705_103625532	3300005294	Switchgrass Rhizosphere	VEAGIFIAALIVVIFAVDIIGRWWRENEWRRRWRERERERDDR*
Ga0065707_102793941	3300005295	Switchgrass Rhizosphere	VEATVFIVALLFVIFAVELIGRWWRQNEWRRRWRERDDE*
Ga0070690_1008469651	3300005330	Switchgrass Rhizosphere	LLRLVESIVFIVVLIVGIFAVDLGRRWWRENEWQRRWRERDDD*
Ga0068869_1002429312	3300005334	Miscanthus Rhizosphere	LIVLRASTILAWLVESIVFIVALLVGIFAFDLVRRWWRENEWQRRWRERDDD*
Ga0068869_1008565952	3300005334	Miscanthus Rhizosphere	VEAVVFIVALLVVNFAVDLVGRWWRENEWRRRWRERERDDD*
Ga0070666_108153471	3300005335	Switchgrass Rhizosphere	VEATVFIVVLLVAIFAVDLGRRWWRENEWQRRWRQRDEE*
Ga0068868_1007412432	3300005338	Miscanthus Rhizosphere	LRSLVEATIFIVVLVVGIFAVDLGRRWWRENEWQRRWRQRGEDESGD*
Ga0070689_1005426342	3300005340	Switchgrass Rhizosphere	VESAIFIAALIFVIFAVDIVGRWWRENEWRRRWRERERERDDQ*
Ga0070661_1012054742	3300005344	Corn Rhizosphere	LLRLVESIVFIVVLIVGIFVVDLGRRWWRENEWQRRWRERDDD*
Ga0070673_1024155932	3300005364	Switchgrass Rhizosphere	VPVEAIVFIILLLAAIFAFDIGRRWWRENEWQRRWRERDEE*
Ga0070701_100043455	3300005438	Corn, Switchgrass And Miscanthus Rhizosphere	VGAAIFIAALILVIFAVDIGNRWWRENEWRRRWRERERNDE*
Ga0070701_106499263	3300005438	Corn, Switchgrass And Miscanthus Rhizosphere	VEAGLFIAALIFVIFAVDLIGRWWRENEWRRRWRGRERDRDDR*
Ga0070705_1001741723	3300005440	Corn, Switchgrass And Miscanthus Rhizosphere	VEAVVFIVGLLFVIFVVDLVGRWWRENEWRRRWRERDDD*
Ga0070694_1013873562	3300005444	Corn, Switchgrass And Miscanthus Rhizosphere	VGAAIFIAALILAIFVVDIGSRWWRENEWRRRWRERERDEE
Ga0070678_1004860163	3300005456	Miscanthus Rhizosphere	LDFPVEAIAFIVVLIVGIFAFDLGKRWWRENEWQRRWRERDDD*
Ga0070662_1001825563	3300005457	Corn Rhizosphere	VEAVLFIVTLLFIIFAVDLGGRWWRENEWRRRWRERDDE*
Ga0073909_100815274	3300005526	Surface Soil	VESIVFIVVLVVGIFVFDLGRRWWRENEWQRRWRDRDDE*
Ga0070679_1012397472	3300005530	Corn Rhizosphere	VESIFFIVVLIVGIFAVDLGKRWWRENEWRRRWRERDED*
Ga0068854_1009402542	3300005578	Corn Rhizosphere	VESIVFIVLLLVGIFAFDIGKRWWRENEWQRRWRERDEE*
Ga0068859_1008542432	3300005617	Switchgrass Rhizosphere	VEAAVFIGALLFVIFAVDLVGRWWRENEWRRRWRERERDDD*
Ga0066905_1012195562	3300005713	Tropical Forest Soil	VSALVFIVAMIIVVFVVDIGKRWWLENEWRRRWRRTETDDD*
Ga0066905_1013088401	3300005713	Tropical Forest Soil	FIVVLVVGIFVFDFASRWWRENEWQRRWKRKNEED*
Ga0068866_102384221	3300005718	Miscanthus Rhizosphere	LFLDFPVEAIAFIVVLIVGIFAFDLGKRWWRENEWQRRWRERDDD*
Ga0066903_1024313132	3300005764	Tropical Forest Soil	LAFLVATVFIVVLVVGIFVYDFARRWWRENEWQRRWRRREDDE*
Ga0068858_1006279201	3300005842	Switchgrass Rhizosphere	PGTPLFLLRLVESIVFIVVLIVGIFVVDLGRRWWRENEWQRRWRERDDD*
Ga0068858_1019730582	3300005842	Switchgrass Rhizosphere	LGFPVEATVFIVVLLVAIFAVDLGRRWWRENEWQRRWRERDED*
Ga0068862_1023232191	3300005844	Switchgrass Rhizosphere	VHYAFRGLVEAVVFIVGLLFVIFVVDLVGRWWRENEWRRRWRERDDD*
Ga0066791_100060784	3300005949	Soil	VESILFIIVLLVGIFVFDLGRRWWQQNEWQRRWREKDDD*
Ga0066789_102992821	3300005994	Soil	LLVESILFIIVLLVGIFVFDLGRRWWQQNEWQRRWREKDDD*
Ga0075023_1001126773	3300006041	Watersheds	VESTVFIIVLLVGIFVVDLGRRWWRENEWRRRWRERDED*
Ga0075026_1010662421	3300006057	Watersheds	VESTLFIIVLLVGIFAFDLGKRWWRENEWQRRWRERDDDD*
Ga0075018_103691571	3300006172	Watersheds	VLIARRTSTILADLVESIVFIVVLLVGIFAFDLGRRWWRENEWRRRWRERDDD*
Ga0097621_1002497132	3300006237	Miscanthus Rhizosphere	VEAAVFIGALLFVIFAVDLVGRWWRENEWRRRWRERDDD*
Ga0097621_1015027042	3300006237	Miscanthus Rhizosphere	LGFPVEATVFIVVLLVAIFAVDLGRRWWRENEWQRRWR
Ga0068871_1015773983	3300006358	Miscanthus Rhizosphere	ILAWLVESIVFIVALLVGIFAFDLVRRWWRENEWQRRWRERDDD*
Ga0068871_1016268653	3300006358	Miscanthus Rhizosphere	LFLVFLVEATVFIVVLLVGIFVVDLGRRWWRENEWQRRWRRRDEDD*
Ga0074051_111825401	3300006572	Soil	LVFLVEATVFIVVLLVGIFVVDLGRRWWRENEWQRRWRE
Ga0074050_118012771	3300006577	Soil	LVFLVEATVFIVVLLVGIFVVDLGRRWWRENEWQRRWRERDDDD*
Ga0074059_119828001	3300006578	Soil	LVESIVFIVVLVVGIFVFDLGWRWWRENEWQRRWRDRDDDD*
Ga0074062_117135881	3300006606	Soil	LVFLVEATVFIVVLLVGIFVVDLGRRWWRENEWQRRWRRRD
Ga0075433_103357771	3300006852	Populus Rhizosphere	VGAAIFIAALILVIFVVDIGSRWWRENEWRRRWRERERDEE*
Ga0068865_1004570813	3300006881	Miscanthus Rhizosphere	VFIVVLLVAIFAVDLGRRWWRENEWQRRWRERDED*
Ga0074063_128557832	3300006953	Soil	LKFSVGATAFIIVLLIGIFVVDLGRRWWRENEWQRRWRERDDDD*
Ga0066793_100389402	3300009029	Prmafrost Soil	VTSIVFIVVLIVGIFIADIVGRWWRENEWRRRWRDRRDDDD*
Ga0066793_101712182	3300009029	Prmafrost Soil	VASILFIIVLIVGIFVVDLGRRWWRENEWQRRWRKRDED*
Ga0105240_115691031	3300009093	Corn Rhizosphere	VNAIVFIVLLLIGIFVVDIGKRWWRENEWQRRWRERDDD*
Ga0066709_1041977961	3300009137	Grasslands Soil	LIPRVEATVFIVLLIVGIFVFDLARRWWLENEWQRR
Ga0105243_122911352	3300009148	Miscanthus Rhizosphere	VEAVVFIVALLVVIFAVDLVGRWWRENEWRRRWRERDDD*
Ga0105243_130347742	3300009148	Miscanthus Rhizosphere	LAFPVATVFIVVLVVGIFVFDFARRWWRENEWQRRWR
Ga0075423_123914571	3300009162	Populus Rhizosphere	VGAAIFIAALILVIFVVDIGSRWWRENEWRRRWRERERERDDR*
Ga0105248_101896812	3300009177	Switchgrass Rhizosphere	VEATVFIVVLLVAIFAVDLGRRWWRENEWQRRWRERDED*
Ga0105248_115979172	3300009177	Switchgrass Rhizosphere	VESIVFIVVLIVGIFAVDLGRRWWRENEWQRRWRERDDD*
Ga0105248_121240621	3300009177	Switchgrass Rhizosphere	YAFRVLVEAAVFIGALLFVIFAVDLVGRWWRENEWRRRWRERDDD*
Ga0105248_129114602	3300009177	Switchgrass Rhizosphere	VESIVFIVALLVGIFAFDLVRRWWRENEWQRRWRERDDD*
Ga0105858_12929342	3300009661	Permafrost Soil	VLTVIFIVVLIVGIFAADIAGRWWRENEWRRRWKDRADDD*
Ga0105856_10263484	3300009662	Permafrost Soil	LISFSLLVESILFIIVLLVGIFVFDLGRRWWQQNEWQRRWREKDDD*
Ga0105856_13583121	3300009662	Permafrost Soil	TAALLSFLKLVEATLFIGVVIIGIFVFDLGKRWWRENEYKRRWRERDDD*
Ga0126377_134238632	3300010362	Tropical Forest Soil	LVSPVATVFIVVLVVGIFVFDFASRWWRENEWQRRWKRKNEED*
Ga0134127_102370082	3300010399	Terrestrial Soil	VESAIFIAALIFVIFAVDIIGRWWRENEWRRRWRERERERDDR*
Ga0134127_104929072	3300010399	Terrestrial Soil	VEAVLFIIALLVVIFAVDLGGRWWRENEWRRRWRERDDE*
Ga0134122_100266703	3300010400	Terrestrial Soil	VEAAVFIVALLLVIFAVELIGRWWRQNAWRRRWRERECDDE*
Ga0134122_110191823	3300010400	Terrestrial Soil	AIGVLLVGIFAFDLGKRWWRENEWQRRWRERDDD*
Ga0134122_120527512	3300010400	Terrestrial Soil	VEAALFIVVLIVVIFAVDIGSRWWRENEWRRRWRERQRDDD*
Ga0134121_128618612	3300010401	Terrestrial Soil	VEAVVFIVALLLIIFAVDLGGRWWRENEWRRRWRERERDDD*
Ga0134121_129053951	3300010401	Terrestrial Soil	VVFIVALLLIIFAVDLGGRWWRENEWRRRWRERERDDE*
Ga0134123_101276072	3300010403	Terrestrial Soil	VESAIFIAALIFVIFAVDIIGRWWRENEWRRRWRERERERDDQ*
Ga0126361_109959611	3300010876	Boreal Forest Soil	VESIVFIVVLLVGIFAFDLGRRWWRENEWQRRWRERDED*
Ga0137442_11054143	3300011414	Soil	LIVRRTSTILAFLVESIVFIVALLVGIFAVDLVRRWWRENEYKRRWRERDDD*
Ga0137462_11711302	3300011421	Soil	VEAVLFIVALLFIIFAVDLGGRWWRENEWRRRWRERDDE*
Ga0150985_1129055061	3300012212	Avena Fatua Rhizosphere	AILFIVVMLVGIFAFDIGRRWWRENEWQRRWRERDKE*
Ga0150985_1187211343	3300012212	Avena Fatua Rhizosphere	VEATVFIIVLVVGIFVVDLGRRWWLENEWQRRWRERDED*
Ga0150985_1189524771	3300012212	Avena Fatua Rhizosphere	VGSIVFIVALLIGIFAFDIGRRWWRENEWQRRWRQRDEE*
Ga0150984_1023641671	3300012469	Avena Fatua Rhizosphere	CVEATVFIIVLVVGIFVVDLGRRWWLENEWQRRWRERDED*
Ga0150984_1076619733	3300012469	Avena Fatua Rhizosphere	VESLVFIVVLVIGIFAFDIGRRWWRENEWQRRWRQRDEE*
Ga0150984_1163349421	3300012469	Avena Fatua Rhizosphere	TVFIVVLVVGIFVFDLVSRRWRENEWQRRWRRRDEDN*
Ga0137397_108687222	3300012685	Vadose Zone Soil	VESIVFIVILVVGIFVFDLGRRWWRENEWQRRWRERDED*
Ga0157310_100867812	3300012916	Soil	VEAVLFIVTLLFIIFAVDLSGRWWRENEWRRRWRERDDE*
Ga0137396_101185921	3300012918	Vadose Zone Soil	AVLFIVVLIVAIFAYDLVRRWWRENEWKRRLRDRDH*
Ga0137413_109340412	3300012924	Vadose Zone Soil	VESIVFIVVLLVGIFAFDLVRRWWRENEYKRRWRERDDD*
Ga0137416_106807332	3300012927	Vadose Zone Soil	VESIVFIVALLVGIFAFDLGRRWWRENEWRRRWRERDED*
Ga0137404_120260471	3300012929	Vadose Zone Soil	LQFPVAATVFILVLLVSIFAFDLGRRWWRENEWQRRWRRRDDE*
Ga0137410_104938823	3300012944	Vadose Zone Soil	LDFPVEAIAFIVVLLVGIFAFDLGKRWWRENEWQRRWRQRDEE*
Ga0137410_111065532	3300012944	Vadose Zone Soil	VLTVIFIVALIAGIFIADIAGRWWRENEWRRRWKDRSDDD*
Ga0164298_111683101	3300012955	Soil	VAATVFIVVLIVGIFVFDLGRRWWLENEWQRRWKERDEE*
Ga0164309_110475872	3300012984	Soil	LVFLVEATVFIVVLLVGIFVVDLGRRWWRENEWKRRWRRGKDDD*
Ga0157378_131973732	3300013297	Miscanthus Rhizosphere	LAFPVATVFIVVLVVGIFVFDFARRWWRENEWQRRWRHRNDDD*
Ga0163162_109288853	3300013306	Switchgrass Rhizosphere	GLPVEATVFIVVLLVAIFAFDLGRRWWRENEWQRRWRQRDED*
Ga0163163_100807086	3300014325	Switchgrass Rhizosphere	LRSLVEATVFIVVLVVGIFAVDLGRRWWRENEWQRRWRQRGEDESGD*
Ga0157376_107084273	3300014969	Miscanthus Rhizosphere	LVFLVEATVFIVVLLVGIFAVDLGRRWWRENEWQRRWRRRDEDD*
Ga0167653_10354591	3300015162	Glacier Forefield Soil	VEAAIFIGVMLLAIFAFDLGKRWWRENEWQRRWRERDEE*
Ga0167647_10493352	3300015199	Glacier Forefield Soil	VAAIVFIVVVLVGIFAFDLGMRWWRENEWRRRWRERDEE*
Ga0137412_110968732	3300015242	Vadose Zone Soil	VGATVFIVVLIVGIFVVDFGRRKWRENEWQRRWRQRDDD*
Ga0163161_108089433	3300017792	Switchgrass Rhizosphere	VEAVVFIVALLLIIFAVDLGGRWWRENEWRRRWRERERDDE
Ga0184620_100391222	3300018051	Groundwater Sediment	VEAAVFIVALLIVIFAVDLIGRWWRQNEWRRRWRERDDD
Ga0184623_102448321	3300018056	Groundwater Sediment	VEAAVFIVALLIVIFAVDLIGRWWRQNEWRRRWREHDDE
Ga0190270_111707072	3300018469	Soil	VEAAVFIVGLIFVIFVVDLVGRWWRENEWRRRWRERDDE
Ga0190274_103533011	3300018476	Soil	VESAIFIAALIFVIFAVDIVGRWWRENEWRRRWRERERERDDQ
Ga0173479_100872582	3300019362	Soil	VEAVLFIVTLLFIIFAVDLGGRWWRENEWRRRWRERDDE
Ga0193692_10127203	3300020000	Soil	VEATVFIVVLLVAIFAIDLGRRWWRENEWQRRWRQRDEE
Ga0210403_104457132	3300020580	Soil	LGFPVEAIVFIVVLLVGIFAFDLGRRWWRENEWQRRWRQRDED
Ga0210382_103612842	3300021080	Groundwater Sediment	VEAAVFIVGLLFVIFAVDLVGRWWRENEWRRRRWRQRDDE
Ga0194060_100057036	3300021602	Anoxic Zone Freshwater	VFAILVITVSIVGIFAFDIARRWWRETEWQRRWNQRDENDD
Ga0213853_102885744	3300021861	Watersheds	MLVESIVFIVVLLVGIFAFDLGRRWWRENEWQRRWRERDDD
Ga0222622_100226723	3300022756	Groundwater Sediment	VEAVVFIVALLFIIFAVDLGGRWWRENEWRRRWRERDDE
Ga0222622_102290702	3300022756	Groundwater Sediment	VEATVFIVALLIVIFAVELVGRWWRQNEWRRRWRERDDD
Ga0207642_102549611	3300025899	Miscanthus Rhizosphere	LDFPVEAIAFIVVLIVGIFAFDLGKRWWRENEWQRRWRERDDD
Ga0207680_104073691	3300025903	Switchgrass Rhizosphere	DFPVEAIAFIVVLIVGIFAFDLGKRWWRENEWQRRWRERDDD
Ga0207645_106068651	3300025907	Miscanthus Rhizosphere	VEAALFIVVLIFVIFAVDIGSRWWRENEWRRRWRERQRDDD
Ga0207643_105834772	3300025908	Miscanthus Rhizosphere	VESAIFIAALIFVIFAVDIVGRWWRENEWRRRWRERERERDDR
Ga0207695_112274951	3300025913	Corn Rhizosphere	VNAIVFIVLLLIGIFVVDIGKRWWRENEWQRRWRERDD
Ga0207660_105535271	3300025917	Corn Rhizosphere	VEAVLFIVALLFIIFAVDLGGRWWRENEWRRRWRERDDE
Ga0207652_110586672	3300025921	Corn Rhizosphere	VESIFFIVVLIVGIFAVDLGKRWWRENEWRRRWRERDED
Ga0207659_106239321	3300025926	Miscanthus Rhizosphere	VESAIFIAALIFVIFAVDIIGRWWRENEWRRRWRERERERDDR
Ga0207691_101517031	3300025940	Miscanthus Rhizosphere	VEAGLFIAALIFVIFAVDLIGRWWRENEWRRRWRGRERDRDDR
Ga0207711_101277872	3300025941	Switchgrass Rhizosphere	VEATVFIVVLLVAIFAVDLGRRWWRENEWQRRWRERDED
Ga0207711_101922784	3300025941	Switchgrass Rhizosphere	HYAFRVLVEAAVFIGALLFVIFAVDLVGRWWRENEWRRRWRERERDDD
Ga0207711_118371172	3300025941	Switchgrass Rhizosphere	VESIIFIVLLVAGIFAFDLGRRWWRENEWRRRWRERDEG
Ga0207689_108304303	3300025942	Miscanthus Rhizosphere	TVFIVLLLAGIFIVDLGRRRWRENEWQRRWRDRDKEE
Ga0207661_108745451	3300025944	Corn Rhizosphere	VNAIVFIVLLLIGIFVVDIGKRWWRENEWQRRWRERDDD
Ga0207661_121073462	3300025944	Corn Rhizosphere	LAFPVATVFIVVLVVGIFVFDFARRWWRENEWQRR
Ga0207640_117133381	3300025981	Corn Rhizosphere	VEAAVFIGALLFVIFAVDLVGRWWRENEWRRRWRERDDD
Ga0207658_109533242	3300025986	Switchgrass Rhizosphere	LAFPVATVFIVVLVVGIFVFDFARRWWRENEWQRRWRHRNDD
Ga0207677_107394191	3300026023	Miscanthus Rhizosphere	LVESTVFIVLLLVGIFAFDIIKRWWRENEWQRRWRERDDE
Ga0209848_10475671	3300026221	Permafrost Soil	VESILFIIVLLVGIFVFDLGRRWWQQNEWQRRWREKDDD
Ga0209848_10921433	3300026221	Permafrost Soil	SILFIIVLLVGIFVFDLGRRWWQQNEWQRRWREKDDD
Ga0209847_10151924	3300026276	Permafrost Soil	FSLLVESILFIIVLLVGIFVFDLGRRWWQQNEWQRRWREKDDD
Ga0209811_100515042	3300027821	Surface Soil	LVFLVEATVFIVVLLVGIFVVDLGRRWWRENEWQRRWRRRDEDD
Ga0209624_110511691	3300027895	Forest Soil	FIVVLIAGIFIADIGGRWWRENEWRRRWKNRADDD
Ga0209415_106229282	3300027905	Peatlands Soil	MSDVTFVVVLVVGIFVFDFIRRWWKENEWKRRWRDRDED
Ga0207428_100343284	3300027907	Populus Rhizosphere	VGAAIFIAALILVIFVVDIGSRWWRENEWRRRWRERERDEE
Ga0209382_100255766	3300027909	Populus Rhizosphere	VEAGLFIAALIFVIFAVDIIGRWWRENEWRRRWRERERERDDR
Ga0209583_103053251	3300027910	Watersheds	VESTVFIIVLLVGIFVVDLGRRWWRENEWRRRWRERDED
Ga0209698_111547351	3300027911	Watersheds	TTFIVLLIVAIFAFELGRRWWRENEWKRRWRDHEKDQD
Ga0209168_102182502	3300027986	Surface Soil	VLSIVFIVVLVIGIFAVDIGGRWWRENEWRRRWRDT
Ga0268265_115693832	3300028380	Switchgrass Rhizosphere	VGAAIFIAALILVIFAVDIGNRWWRENEWRRRWRERERNDE
Ga0268264_101747734	3300028381	Switchgrass Rhizosphere	LAFPVATVFIVVLVVGIFVFDFARRWWRENEWQRRWRHRNDDD
Ga0268264_111832173	3300028381	Switchgrass Rhizosphere	LIVLRASTILAWLVESIVFIVALLVGIFAFDLVRRWWRENEWQRRWRERDDD
Ga0268264_115904612	3300028381	Switchgrass Rhizosphere	VAPEIVFVIVLLVAIFAFDLGRRWWRENEWQRRWRRRDEDD
Ga0268264_120714622	3300028381	Switchgrass Rhizosphere	VESIVFIVALLVGIFAFDLVRRWWRENEYKRRWRERERDDD
Ga0307280_101899171	3300028768	Soil	VLVESIVFIIALLVGIFAVDLVRRWWRENEWQRRWRERDDD
Ga0307282_103563052	3300028784	Soil	VEAAVFIVGLLFVIFAVDLVGRWWRENEWRRRRWRGRDDE
Ga0307305_105725801	3300028807	Soil	AFRGLVEAAVFIVGLLFVIFAVDLVGRWWRENEWRRRRWRGRDDE
Ga0307310_106629572	3300028824	Soil	LLVESIVFIVALLVGIFAFDLVRRWWRENEYKRRWRERERDDD
Ga0311338_115840462	3300030007	Palsa	VLSIAFIVVLILGIFVADIGGRWWRENEWRRRWRDREDED
Ga0170834_1030709541	3300031057	Forest Soil	PVLSGCPDVHVLTVIFIVVLIAGIFIADIGGRWWRENEWRRRWKNRADDD
Ga0307495_102439892	3300031199	Soil	LVFLVGATVFIVVLLVGIFVFDLGRRWWRENEWKRRWRRGKDDD
Ga0170824_1096862122	3300031231	Forest Soil	VESIVFIVVLLVGIFAFDLGRRWWRENEWRRRWRERDDD
Ga0265330_102414132	3300031235	Rhizosphere	MVIFIVVLIVGIFAFDFGHRWWRETEWKRRWKDRSLDD
Ga0170820_131184192	3300031446	Forest Soil	VLTVIFIVVLIAGIFIADIGGRWWRENEWRRRWKNRADDD
Ga0318501_103394301	3300031736	Soil	GWPCLFLIFPVATVFIVVLVVGIFVFDFASRWWRENEWQRRWRRRQDEE
Ga0318552_104621653	3300031782	Soil	FLIFPVATVFIVVLVVGIFVFDFASRWWRENEWQRRWRRRQDEE
Ga0318529_101358394	3300031792	Soil	PCLFLIFPVATVFIVVLVVGIFVFDFASRWWRENEWQRRWRRRQDEE
Ga0310907_108286871	3300031847	Soil	PVESAIFIAALIFVIFAVDIVGRWWRENEWRRRWRERERERDDQ
Ga0306919_107626903	3300031879	Soil	VATVFIVVLVVGIFVFDFASRWWRENEWQRRWRRRQDEE
Ga0315278_121982822	3300031997	Sediment	VESTVFIVVLIAAIFVFDVGRRWWRQNEWRRRWLQRRDDD
Ga0310906_104318563	3300032013	Soil	SAIFIAALIFVIFAVDIVGRWWRENEWRRRWRERERERDDQ
Ga0315281_100104424	3300032163	Sediment	VTSIVFIVVLLVGIFVFDVGKRWWRENEWRRRWRARKRDDDD
Ga0315281_101233573	3300032163	Sediment	VEAIVFIVVLVVGIFVFDVVRRWWRENEWRRRWHKRDED
Ga0315268_125803831	3300032173	Sediment	VESTVFIVVLIAAIFVFDVGRRWWRENEWRRRWRQRRDDQ
Ga0307472_1025476322	3300032205	Hardwood Forest Soil	LAFPVATVFIVVLVVGIFVFDFVWRWWRENEWQRRWRRRDEEE
Ga0372943_0054392_783_902	3300034268	Soil	VEATVFIVILIVGIFVFDLARRWWLENEWQRRWKERDDE