| Basic Information | |
|---|---|
| Family ID | F032424 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 180 |
| Average Sequence Length | 44 residues |
| Representative Sequence | ACPSDRPNHVGMAVQRHIRAGRIQERDGKLYATPTATEQAHATA |
| Number of Associated Samples | 120 |
| Number of Associated Scaffolds | 180 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.56 % |
| % of genes near scaffold ends (potentially truncated) | 98.33 % |
| % of genes from short scaffolds (< 2000 bps) | 87.78 % |
| Associated GOLD sequencing projects | 111 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.49 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (50.556 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (38.333 % of family members) |
| Environment Ontology (ENVO) | Unclassified (45.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (43.889 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 30.56% β-sheet: 11.11% Coil/Unstructured: 58.33% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 180 Family Scaffolds |
|---|---|---|
| PF13460 | NAD_binding_10 | 3.89 |
| PF04343 | DUF488 | 3.89 |
| PF03279 | Lip_A_acyltrans | 2.78 |
| PF13378 | MR_MLE_C | 2.78 |
| PF13432 | TPR_16 | 1.67 |
| PF01553 | Acyltransferase | 1.67 |
| PF01425 | Amidase | 1.11 |
| PF00296 | Bac_luciferase | 1.11 |
| PF00403 | HMA | 1.11 |
| PF08388 | GIIM | 1.11 |
| PF13701 | DDE_Tnp_1_4 | 1.11 |
| PF00903 | Glyoxalase | 1.11 |
| PF01547 | SBP_bac_1 | 0.56 |
| PF12833 | HTH_18 | 0.56 |
| PF13229 | Beta_helix | 0.56 |
| PF13751 | DDE_Tnp_1_6 | 0.56 |
| PF01799 | Fer2_2 | 0.56 |
| PF12531 | DUF3731 | 0.56 |
| PF13649 | Methyltransf_25 | 0.56 |
| PF02518 | HATPase_c | 0.56 |
| PF03972 | MmgE_PrpD | 0.56 |
| PF08241 | Methyltransf_11 | 0.56 |
| PF05231 | MASE1 | 0.56 |
| PF13676 | TIR_2 | 0.56 |
| PF01878 | EVE | 0.56 |
| PF07683 | CobW_C | 0.56 |
| PF00857 | Isochorismatase | 0.56 |
| PF00216 | Bac_DNA_binding | 0.56 |
| PF10518 | TAT_signal | 0.56 |
| PF03466 | LysR_substrate | 0.56 |
| PF00326 | Peptidase_S9 | 0.56 |
| PF01165 | Ribosomal_S21 | 0.56 |
| PF00072 | Response_reg | 0.56 |
| PF13847 | Methyltransf_31 | 0.56 |
| PF06627 | DUF1153 | 0.56 |
| PF00732 | GMC_oxred_N | 0.56 |
| PF01042 | Ribonuc_L-PSP | 0.56 |
| PF13602 | ADH_zinc_N_2 | 0.56 |
| PF02771 | Acyl-CoA_dh_N | 0.56 |
| PF07386 | DUF1499 | 0.56 |
| PF00486 | Trans_reg_C | 0.56 |
| PF04828 | GFA | 0.56 |
| PF01609 | DDE_Tnp_1 | 0.56 |
| PF00392 | GntR | 0.56 |
| PF00271 | Helicase_C | 0.56 |
| PF01717 | Meth_synt_2 | 0.56 |
| PF00872 | Transposase_mut | 0.56 |
| PF02798 | GST_N | 0.56 |
| PF01135 | PCMT | 0.56 |
| PF13416 | SBP_bac_8 | 0.56 |
| PF01261 | AP_endonuc_2 | 0.56 |
| COG ID | Name | Functional Category | % Frequency in 180 Family Scaffolds |
|---|---|---|---|
| COG3189 | Uncharacterized conserved protein YeaO, DUF488 family | Function unknown [S] | 3.89 |
| COG4261 | Predicted acyltransferase, LPLAT superfamily | General function prediction only [R] | 2.78 |
| COG1560 | Palmitoleoyl-ACP: Kdo2-lipid-IV acyltransferase (lipid A biosynthesis) | Lipid transport and metabolism [I] | 2.78 |
| COG2608 | Copper chaperone CopZ | Inorganic ion transport and metabolism [P] | 1.11 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 1.11 |
| COG2217 | Cation-transporting P-type ATPase | Inorganic ion transport and metabolism [P] | 1.11 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 1.11 |
| COG3447 | Integral membrane sensor domain MASE1 | Signal transduction mechanisms [T] | 0.56 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.56 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.56 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.56 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.56 |
| COG2518 | Protein-L-isoaspartate O-methyltransferase | Posttranslational modification, protein turnover, chaperones [O] | 0.56 |
| COG3791 | Uncharacterized conserved protein | Function unknown [S] | 0.56 |
| COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.56 |
| COG4122 | tRNA 5-hydroxyU34 O-methylase TrmR/YrrM | Translation, ribosomal structure and biogenesis [J] | 0.56 |
| COG4446 | Uncharacterized conserved protein, DUF1499 family | Function unknown [S] | 0.56 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.56 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.56 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.56 |
| COG2947 | Predicted RNA-binding protein, contains EVE domain | General function prediction only [R] | 0.56 |
| COG2519 | tRNA A58 N-methylase Trm61 | Translation, ribosomal structure and biogenesis [J] | 0.56 |
| COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 0.56 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.56 |
| COG2079 | 2-methylcitrate dehydratase PrpD | Carbohydrate transport and metabolism [G] | 0.56 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.56 |
| COG1673 | Predicted RNA-binding protein, contains PUA-like EVE domain | General function prediction only [R] | 0.56 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.56 |
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.56 |
| COG0828 | Ribosomal protein S21 | Translation, ribosomal structure and biogenesis [J] | 0.56 |
| COG0776 | Bacterial nucleoid DNA-binding protein IHF-alpha | Replication, recombination and repair [L] | 0.56 |
| COG0642 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.56 |
| COG0620 | Methionine synthase II (cobalamin-independent) | Amino acid transport and metabolism [E] | 0.56 |
| COG0523 | Zinc metallochaperone YeiR/ZagA and related GTPases, G3E family | General function prediction only [R] | 0.56 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.56 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 50.56 % |
| All Organisms | root | All Organisms | 49.44 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002245|JGIcombinedJ26739_100926586 | Not Available | 754 | Open in IMG/M |
| 3300005171|Ga0066677_10785330 | Not Available | 528 | Open in IMG/M |
| 3300005187|Ga0066675_10804695 | Not Available | 710 | Open in IMG/M |
| 3300005332|Ga0066388_103098815 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 849 | Open in IMG/M |
| 3300005435|Ga0070714_100423251 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1262 | Open in IMG/M |
| 3300005437|Ga0070710_10182616 | All Organisms → cellular organisms → Bacteria | 1314 | Open in IMG/M |
| 3300005451|Ga0066681_10611932 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300005536|Ga0070697_100174244 | All Organisms → cellular organisms → Bacteria | 1822 | Open in IMG/M |
| 3300005536|Ga0070697_100725570 | Not Available | 877 | Open in IMG/M |
| 3300005559|Ga0066700_10702449 | Not Available | 693 | Open in IMG/M |
| 3300005764|Ga0066903_100959792 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1556 | Open in IMG/M |
| 3300006172|Ga0075018_10443015 | Not Available | 668 | Open in IMG/M |
| 3300007258|Ga0099793_10158619 | Not Available | 1074 | Open in IMG/M |
| 3300007265|Ga0099794_10788437 | Not Available | 508 | Open in IMG/M |
| 3300009012|Ga0066710_104654356 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300009038|Ga0099829_10381550 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga tunisiensis | 1163 | Open in IMG/M |
| 3300009143|Ga0099792_10271879 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 995 | Open in IMG/M |
| 3300009143|Ga0099792_10771101 | Not Available | 628 | Open in IMG/M |
| 3300009792|Ga0126374_10694771 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300009792|Ga0126374_11843259 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300010048|Ga0126373_12207730 | Not Available | 612 | Open in IMG/M |
| 3300010154|Ga0127503_10241841 | Not Available | 529 | Open in IMG/M |
| 3300010154|Ga0127503_11108610 | Not Available | 811 | Open in IMG/M |
| 3300010333|Ga0134080_10445861 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300010359|Ga0126376_10568429 | Not Available | 1065 | Open in IMG/M |
| 3300010359|Ga0126376_12363545 | Not Available | 578 | Open in IMG/M |
| 3300010360|Ga0126372_10395458 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1259 | Open in IMG/M |
| 3300010361|Ga0126378_13156915 | Not Available | 524 | Open in IMG/M |
| 3300010376|Ga0126381_102840246 | Not Available | 691 | Open in IMG/M |
| 3300010398|Ga0126383_10331593 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1534 | Open in IMG/M |
| 3300011270|Ga0137391_10065387 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3118 | Open in IMG/M |
| 3300011270|Ga0137391_11434886 | Not Available | 536 | Open in IMG/M |
| 3300012189|Ga0137388_11904538 | Not Available | 525 | Open in IMG/M |
| 3300012199|Ga0137383_10069839 | Not Available | 2529 | Open in IMG/M |
| 3300012202|Ga0137363_10762681 | Not Available | 820 | Open in IMG/M |
| 3300012203|Ga0137399_10165696 | All Organisms → cellular organisms → Bacteria | 1775 | Open in IMG/M |
| 3300012203|Ga0137399_10274386 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1388 | Open in IMG/M |
| 3300012203|Ga0137399_10595165 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 930 | Open in IMG/M |
| 3300012203|Ga0137399_10826807 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium tianshanense | 780 | Open in IMG/M |
| 3300012205|Ga0137362_10295355 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1402 | Open in IMG/M |
| 3300012205|Ga0137362_11126486 | Not Available | 667 | Open in IMG/M |
| 3300012210|Ga0137378_11442881 | Not Available | 601 | Open in IMG/M |
| 3300012361|Ga0137360_10198331 | Not Available | 1623 | Open in IMG/M |
| 3300012361|Ga0137360_10395613 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1164 | Open in IMG/M |
| 3300012361|Ga0137360_10660158 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
| 3300012361|Ga0137360_11424580 | Not Available | 596 | Open in IMG/M |
| 3300012362|Ga0137361_10113957 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2373 | Open in IMG/M |
| 3300012362|Ga0137361_10220590 | Not Available | 1721 | Open in IMG/M |
| 3300012362|Ga0137361_10303658 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 1461 | Open in IMG/M |
| 3300012362|Ga0137361_10943092 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Lichenicoccus → Lichenicoccus roseus | 781 | Open in IMG/M |
| 3300012362|Ga0137361_11400087 | Not Available | 622 | Open in IMG/M |
| 3300012917|Ga0137395_11144016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 548 | Open in IMG/M |
| 3300012918|Ga0137396_10363232 | Not Available | 1072 | Open in IMG/M |
| 3300012922|Ga0137394_10503945 | All Organisms → cellular organisms → Bacteria | 1028 | Open in IMG/M |
| 3300012922|Ga0137394_10673485 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 872 | Open in IMG/M |
| 3300012923|Ga0137359_10217007 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 1709 | Open in IMG/M |
| 3300012923|Ga0137359_10372373 | Not Available | 1269 | Open in IMG/M |
| 3300012929|Ga0137404_10714887 | Not Available | 906 | Open in IMG/M |
| 3300012930|Ga0137407_12376315 | Not Available | 507 | Open in IMG/M |
| 3300012944|Ga0137410_11226397 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 646 | Open in IMG/M |
| 3300012948|Ga0126375_10696415 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseococcus → unclassified Roseococcus → Roseococcus sp. SYP-B2431 | 790 | Open in IMG/M |
| 3300012948|Ga0126375_12082301 | Not Available | 504 | Open in IMG/M |
| 3300012971|Ga0126369_12146152 | Not Available | 646 | Open in IMG/M |
| 3300015241|Ga0137418_10627440 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 839 | Open in IMG/M |
| 3300015245|Ga0137409_10190509 | All Organisms → cellular organisms → Bacteria | 1852 | Open in IMG/M |
| 3300015245|Ga0137409_10583997 | Not Available | 946 | Open in IMG/M |
| 3300016294|Ga0182041_10095280 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. BH1-1-5 | 2170 | Open in IMG/M |
| 3300016294|Ga0182041_10665305 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 921 | Open in IMG/M |
| 3300016341|Ga0182035_11098875 | Not Available | 708 | Open in IMG/M |
| 3300016357|Ga0182032_10297726 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1273 | Open in IMG/M |
| 3300016357|Ga0182032_10806298 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300016371|Ga0182034_11155504 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300016387|Ga0182040_11297480 | Not Available | 614 | Open in IMG/M |
| 3300016422|Ga0182039_10881228 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 798 | Open in IMG/M |
| 3300016445|Ga0182038_10794916 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 829 | Open in IMG/M |
| 3300016445|Ga0182038_11736196 | Not Available | 563 | Open in IMG/M |
| 3300016445|Ga0182038_12174359 | Not Available | 503 | Open in IMG/M |
| 3300016445|Ga0182038_12189245 | Not Available | 501 | Open in IMG/M |
| 3300018468|Ga0066662_10785786 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 921 | Open in IMG/M |
| 3300020579|Ga0210407_10186637 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 1608 | Open in IMG/M |
| 3300020579|Ga0210407_10299479 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1255 | Open in IMG/M |
| 3300020579|Ga0210407_10304168 | All Organisms → cellular organisms → Bacteria | 1245 | Open in IMG/M |
| 3300020580|Ga0210403_11307703 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 553 | Open in IMG/M |
| 3300020581|Ga0210399_10951142 | Not Available | 694 | Open in IMG/M |
| 3300020581|Ga0210399_11547680 | Not Available | 513 | Open in IMG/M |
| 3300020583|Ga0210401_11513533 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300021088|Ga0210404_10556588 | Not Available | 650 | Open in IMG/M |
| 3300021170|Ga0210400_10263701 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Elioraeaceae → Elioraea → Elioraea rosea | 1410 | Open in IMG/M |
| 3300021170|Ga0210400_10752142 | Not Available | 800 | Open in IMG/M |
| 3300021171|Ga0210405_10758876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 746 | Open in IMG/M |
| 3300021178|Ga0210408_10047144 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3372 | Open in IMG/M |
| 3300021432|Ga0210384_11676060 | Not Available | 541 | Open in IMG/M |
| 3300021560|Ga0126371_13934715 | Not Available | 500 | Open in IMG/M |
| 3300022507|Ga0222729_1042260 | Not Available | 610 | Open in IMG/M |
| 3300022533|Ga0242662_10273477 | Not Available | 555 | Open in IMG/M |
| 3300022726|Ga0242654_10013560 | All Organisms → cellular organisms → Bacteria | 1857 | Open in IMG/M |
| 3300022726|Ga0242654_10121427 | Not Available | 844 | Open in IMG/M |
| 3300025898|Ga0207692_10054939 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Elioraeaceae → Elioraea → Elioraea rosea | 2036 | Open in IMG/M |
| 3300026507|Ga0257165_1071662 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga | 634 | Open in IMG/M |
| 3300027050|Ga0209325_1006568 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1247 | Open in IMG/M |
| 3300027603|Ga0209331_1012865 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2181 | Open in IMG/M |
| 3300027655|Ga0209388_1108874 | Not Available | 793 | Open in IMG/M |
| 3300027783|Ga0209448_10246137 | Not Available | 590 | Open in IMG/M |
| 3300028047|Ga0209526_10209734 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1346 | Open in IMG/M |
| 3300029636|Ga0222749_10356851 | Not Available | 767 | Open in IMG/M |
| 3300031231|Ga0170824_110777726 | Not Available | 668 | Open in IMG/M |
| 3300031474|Ga0170818_100301690 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300031474|Ga0170818_102644945 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 628 | Open in IMG/M |
| 3300031546|Ga0318538_10035654 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2355 | Open in IMG/M |
| 3300031546|Ga0318538_10821860 | Not Available | 505 | Open in IMG/M |
| 3300031561|Ga0318528_10354258 | Not Available | 788 | Open in IMG/M |
| 3300031561|Ga0318528_10483968 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 665 | Open in IMG/M |
| 3300031564|Ga0318573_10452528 | Not Available | 691 | Open in IMG/M |
| 3300031564|Ga0318573_10602229 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300031573|Ga0310915_10168688 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1520 | Open in IMG/M |
| 3300031573|Ga0310915_10483418 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 880 | Open in IMG/M |
| 3300031573|Ga0310915_10874411 | Not Available | 630 | Open in IMG/M |
| 3300031668|Ga0318542_10418896 | Not Available | 692 | Open in IMG/M |
| 3300031679|Ga0318561_10816109 | Not Available | 512 | Open in IMG/M |
| 3300031680|Ga0318574_10205119 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1133 | Open in IMG/M |
| 3300031680|Ga0318574_10813250 | Not Available | 547 | Open in IMG/M |
| 3300031744|Ga0306918_11142089 | Not Available | 602 | Open in IMG/M |
| 3300031747|Ga0318502_10363536 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
| 3300031770|Ga0318521_10664948 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300031777|Ga0318543_10343754 | Not Available | 668 | Open in IMG/M |
| 3300031781|Ga0318547_10010877 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 4168 | Open in IMG/M |
| 3300031781|Ga0318547_10466349 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300031781|Ga0318547_11031353 | Not Available | 514 | Open in IMG/M |
| 3300031797|Ga0318550_10031635 | All Organisms → cellular organisms → Bacteria | 2280 | Open in IMG/M |
| 3300031820|Ga0307473_10744162 | Not Available | 693 | Open in IMG/M |
| 3300031820|Ga0307473_11222066 | Not Available | 559 | Open in IMG/M |
| 3300031833|Ga0310917_10349442 | Not Available | 1003 | Open in IMG/M |
| 3300031835|Ga0318517_10048255 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1776 | Open in IMG/M |
| 3300031835|Ga0318517_10557659 | Not Available | 515 | Open in IMG/M |
| 3300031846|Ga0318512_10540103 | Not Available | 592 | Open in IMG/M |
| 3300031879|Ga0306919_10328283 | Not Available | 1165 | Open in IMG/M |
| 3300031890|Ga0306925_10094084 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3184 | Open in IMG/M |
| 3300031890|Ga0306925_10871646 | Not Available | 928 | Open in IMG/M |
| 3300031894|Ga0318522_10059559 | All Organisms → cellular organisms → Bacteria | 1364 | Open in IMG/M |
| 3300031894|Ga0318522_10260650 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 657 | Open in IMG/M |
| 3300031896|Ga0318551_10676131 | Not Available | 598 | Open in IMG/M |
| 3300031897|Ga0318520_10341489 | Not Available | 907 | Open in IMG/M |
| 3300031910|Ga0306923_10009588 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 9747 | Open in IMG/M |
| 3300031910|Ga0306923_10564200 | Not Available | 1281 | Open in IMG/M |
| 3300031910|Ga0306923_11629820 | Not Available | 669 | Open in IMG/M |
| 3300031912|Ga0306921_10430714 | All Organisms → cellular organisms → Bacteria | 1538 | Open in IMG/M |
| 3300031912|Ga0306921_10569361 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1312 | Open in IMG/M |
| 3300031941|Ga0310912_10003448 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 9222 | Open in IMG/M |
| 3300031941|Ga0310912_10665030 | Not Available | 808 | Open in IMG/M |
| 3300031946|Ga0310910_11421602 | Not Available | 533 | Open in IMG/M |
| 3300031947|Ga0310909_10020150 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 4791 | Open in IMG/M |
| 3300031954|Ga0306926_10174471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2666 | Open in IMG/M |
| 3300031954|Ga0306926_10272252 | All Organisms → cellular organisms → Bacteria | 2097 | Open in IMG/M |
| 3300031954|Ga0306926_10752099 | All Organisms → cellular organisms → Bacteria | 1178 | Open in IMG/M |
| 3300031954|Ga0306926_11728823 | Not Available | 713 | Open in IMG/M |
| 3300031959|Ga0318530_10030615 | All Organisms → cellular organisms → Bacteria | 1926 | Open in IMG/M |
| 3300031959|Ga0318530_10421562 | Not Available | 553 | Open in IMG/M |
| 3300031962|Ga0307479_10856210 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 883 | Open in IMG/M |
| 3300032001|Ga0306922_10027951 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5709 | Open in IMG/M |
| 3300032001|Ga0306922_10188662 | Not Available | 2211 | Open in IMG/M |
| 3300032035|Ga0310911_10744354 | Not Available | 567 | Open in IMG/M |
| 3300032042|Ga0318545_10199986 | Not Available | 715 | Open in IMG/M |
| 3300032043|Ga0318556_10208992 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1016 | Open in IMG/M |
| 3300032052|Ga0318506_10282877 | Not Available | 735 | Open in IMG/M |
| 3300032054|Ga0318570_10587585 | Not Available | 508 | Open in IMG/M |
| 3300032055|Ga0318575_10267940 | Not Available | 863 | Open in IMG/M |
| 3300032059|Ga0318533_10527768 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 865 | Open in IMG/M |
| 3300032059|Ga0318533_10583254 | Not Available | 820 | Open in IMG/M |
| 3300032059|Ga0318533_11024889 | Not Available | 605 | Open in IMG/M |
| 3300032064|Ga0318510_10083425 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1191 | Open in IMG/M |
| 3300032064|Ga0318510_10106368 | Not Available | 1073 | Open in IMG/M |
| 3300032064|Ga0318510_10454438 | Not Available | 550 | Open in IMG/M |
| 3300032065|Ga0318513_10049222 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1884 | Open in IMG/M |
| 3300032076|Ga0306924_10135530 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga | 2811 | Open in IMG/M |
| 3300032076|Ga0306924_12621709 | Not Available | 502 | Open in IMG/M |
| 3300032090|Ga0318518_10538177 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300032261|Ga0306920_104378274 | Not Available | 506 | Open in IMG/M |
| 3300033289|Ga0310914_10012558 | Not Available | 6345 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 38.33% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 21.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.22% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.22% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.22% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.22% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.67% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.67% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.67% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 1.11% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.11% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.11% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.56% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.56% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.56% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.56% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.56% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022507 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026507 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-B | Environmental | Open in IMG/M |
| 3300027050 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027603 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ26739_1009265861 | 3300002245 | Forest Soil | ELYAGCPRDRPNHVGMAVQRHIRAGRIQERDGKLYATPTATEQAHAIA* |
| Ga0066677_107853301 | 3300005171 | Soil | ACPNDRPNHIGMAVQRHIRAGRIRERDGKLYATPPATEQAHATT* |
| Ga0066675_108046951 | 3300005187 | Soil | PSDRPNHVGIAVQRHIRAGRIQERDGKLYATSTATEQARATA* |
| Ga0066388_1030988151 | 3300005332 | Tropical Forest Soil | ATGKTRQELYVACPTDRPNHVGMAVQRHIRAGRIQERDGKLYATPTAMEQAHATA* |
| Ga0070714_1004232511 | 3300005435 | Agricultural Soil | SDRPNHVGMAVQRHIRAGRIQERDGKLYATPTATEQAQATA* |
| Ga0070710_101826163 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | DRPNHVGMAVQRHIRAGRIQERDGKLYATSPATEQAPATA* |
| Ga0066681_106119321 | 3300005451 | Soil | RQELYAACPSDRPNHVGMAVQRHIRAGRIQERDGKLYATPTATEQAQATA* |
| Ga0070697_1001742441 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | AACPSDRPNHVGIAVQRHIRAGRIQERDGKFYATSTATERARATA* |
| Ga0070697_1007255702 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | LYAACPSDRPNHIGMAVQRHIRAGRIQERDGKLYATSTATERARATA* |
| Ga0066700_107024491 | 3300005559 | Soil | GKTRQELYAACPSDRPNHVGMAVQRHIRAGRIQERDGKLYATSTATEQAHATA* |
| Ga0066903_1009597921 | 3300005764 | Tropical Forest Soil | NHVGMAVQRHIRAGRIQERDGKLYATSTAAQQAPATA* |
| Ga0075018_104430152 | 3300006172 | Watersheds | RPNHVGIAVQRHIRAGRIQERDGKLYATPTATERARATA* |
| Ga0099793_101586193 | 3300007258 | Vadose Zone Soil | CPTDRPNHVGMAVQRHIRAGRIQERDGKLYATSPPTEQVPATA* |
| Ga0099794_107884371 | 3300007265 | Vadose Zone Soil | NDRPNHIGMAVQRHIRAGRIQERDGKLHATPSATEQAHATA* |
| Ga0066710_1046543562 | 3300009012 | Grasslands Soil | SDRPNHVGMAVQRHIRAGRIQERDGKLYATPTATAQA |
| Ga0099829_103815501 | 3300009038 | Vadose Zone Soil | KTRRELYAACPNDRPNHVGMAVQRHIRAGRIQERDGKLYATPTATEQAHATA* |
| Ga0099792_102718791 | 3300009143 | Vadose Zone Soil | TDRPNHVGMAVQRHIRAGRIQERDGKLHATPPATEQAHATA* |
| Ga0099792_107711011 | 3300009143 | Vadose Zone Soil | SDRPNHVGMAVQRHIRAGRIQERDGKLYATPTATEQAHATA* |
| Ga0126374_106947713 | 3300009792 | Tropical Forest Soil | PNDRPNHVGIAVQRHLRAGRIQERDGKLYATPTAADQDRATA* |
| Ga0126374_118432591 | 3300009792 | Tropical Forest Soil | RREIYLACPSDRPNVVGMAVQRHIRAGRIQERDGKLYATSPAPEQAHARG* |
| Ga0126373_122077301 | 3300010048 | Tropical Forest Soil | AACPSDRPNHVGIAVQRHIRAGRIQERDGKLYATPTATDQDHATA* |
| Ga0127503_102418412 | 3300010154 | Soil | LYVACPNDRPNHIGMAVQRHIRAGRIQERDGKLHATPPATEQAHATA* |
| Ga0127503_111086101 | 3300010154 | Soil | KTRQELYAACPSDRPNHVGMAVQRHIRAGRIQERDGKLYATPTATEQAHATA* |
| Ga0134080_104458611 | 3300010333 | Grasslands Soil | TRQELYAACPSDRPNHVGISVQRHIRAGRIQERDGKLYATPTATEQVQATA* |
| Ga0126376_105684291 | 3300010359 | Tropical Forest Soil | NHIGIAVQRHLRAGRIQERDGKLYATSSATEQARATA* |
| Ga0126376_123635451 | 3300010359 | Tropical Forest Soil | AACPSDRPNHVGIAVQRHIRAGRIQERHGKLYTTSTPAEQARETA* |
| Ga0126372_103954581 | 3300010360 | Tropical Forest Soil | NDRPNHVGIAVQRHIRAGRIQERDGKLYATLITTDQDRATA* |
| Ga0126378_131569152 | 3300010361 | Tropical Forest Soil | YAACPSDRPNHVGIAVQRHIRAGRIQERDGKLYATSTATERPRATA* |
| Ga0126381_1028402461 | 3300010376 | Tropical Forest Soil | ATGKTRQELYAACPSDRPNHVGIAVQRHIRAGRIQERDGKLYATPTATDQDHATA* |
| Ga0126383_103315931 | 3300010398 | Tropical Forest Soil | KTRQELYAACPGDRPNHVGMAVQRHIRAGRIQERDGKLYATPTAMEQAHATA* |
| Ga0137391_100653871 | 3300011270 | Vadose Zone Soil | GKTRQELYVACPTDRPNHVGMAVQRHIRAGRIQERDGKLYAISATEQAHATA* |
| Ga0137391_114348861 | 3300011270 | Vadose Zone Soil | YAACPSDRPNHVGMAVQRHIRAGRIQERDGKLYATPTATEQAHATA* |
| Ga0137388_119045381 | 3300012189 | Vadose Zone Soil | SDRPNHVGMAVQRHIRGGRIQERDGKLYATPTATEQAHATA* |
| Ga0137383_100698391 | 3300012199 | Vadose Zone Soil | ACPSDRPNHVGMAVQRHIRAGRIQERDGKLYATPTATEQAHATA* |
| Ga0137363_107626812 | 3300012202 | Vadose Zone Soil | TGDRPNHVGIAVQRHIRAGRIQERDGKLYATPTAAEQAHATA* |
| Ga0137399_101656962 | 3300012203 | Vadose Zone Soil | DRPNHVGMAVQRHIRAGRIQERDGKLHATPPATEQAHATA* |
| Ga0137399_102743861 | 3300012203 | Vadose Zone Soil | RPNHVGMAVQRHIRAGRIQERDGKLYATSPATEQVPATA* |
| Ga0137399_105951652 | 3300012203 | Vadose Zone Soil | PSDRPNHVGMAVQRHIRAGRIQERDGKLYATSPATEQAPATA* |
| Ga0137399_108268072 | 3300012203 | Vadose Zone Soil | YAACPSDRPNHIGMAAQRHIRAGRIRERDGKFYATSTATEQARATA* |
| Ga0137362_102953554 | 3300012205 | Vadose Zone Soil | AWRYKRHIRAGRIQERDGKLYATPTATEQAHATA* |
| Ga0137362_111264862 | 3300012205 | Vadose Zone Soil | AACPSDRTNHVGIAVQRHVRAGRVQERDGKLYATPTATDQDHATA* |
| Ga0137378_114428812 | 3300012210 | Vadose Zone Soil | LYVACPNDRPNHIGMAVQRHIRAGRIQERDGKLHATPSATEQAHARA* |
| Ga0137360_101983311 | 3300012361 | Vadose Zone Soil | RPNHVGMAVQRHIRAGRIQERDGKLYATSPATEQAPATA* |
| Ga0137360_103956133 | 3300012361 | Vadose Zone Soil | ELYAACPSDRPNHVGMAVQRHIRAGRIQERDGKLYATPTATEQAHATA* |
| Ga0137360_106601582 | 3300012361 | Vadose Zone Soil | CPSDRPNHVGMAVQRHIRAGRIQERDGKLYATPTATEQVHPTA* |
| Ga0137360_114245801 | 3300012361 | Vadose Zone Soil | DRPNHVGIAVQRHIRAGRIEARDGKLYATSSATEQAHPAA* |
| Ga0137361_101139571 | 3300012362 | Vadose Zone Soil | KTRQELYAACPSDRPNHVGMAVQRHIRAGRIQERDGKLYATSTATEQAHATA* |
| Ga0137361_102205901 | 3300012362 | Vadose Zone Soil | KTRQELYAACPSDRPNHVGMAVQRHIRAGRIQERDGKLYATPTATEQARATA* |
| Ga0137361_103036581 | 3300012362 | Vadose Zone Soil | NHVGIAVQRHIRAGRIQERDGKLYATPTATEQAHATA* |
| Ga0137361_109430921 | 3300012362 | Vadose Zone Soil | QELYAACPSDRPNHVGMAVQRHIRAGRIQERDGKLYSTPTATEQARATA* |
| Ga0137361_114000871 | 3300012362 | Vadose Zone Soil | VGIAVQRHIRAGRIQERDGKLYATSTATERARATA* |
| Ga0137395_111440161 | 3300012917 | Vadose Zone Soil | QELYAACPSDRPNHVGMAVQRHIRAGRIQERDGKLYATSPATEQAPATA* |
| Ga0137396_103632323 | 3300012918 | Vadose Zone Soil | YAACPSDRPNHVGMAVQRHIRAGRIQERDGKLYATSPATEQVPATA* |
| Ga0137394_105039451 | 3300012922 | Vadose Zone Soil | AACPGDRPNHVGMAVQRHIRAGRIQERDGKLYATPTATEQAHATA* |
| Ga0137394_106734853 | 3300012922 | Vadose Zone Soil | ELYTACPNDRPNHIGIAVQRHIRAGRIQERDGKLYATSPATEQAHAAA* |
| Ga0137359_102170071 | 3300012923 | Vadose Zone Soil | KTRQELYAVCPGDRPNHVGMAVQRHIRAGRIQEGDGKLYATPTATEQAHATA* |
| Ga0137359_103723731 | 3300012923 | Vadose Zone Soil | ELYAACPGDRPNHVGMAVQRHIRAGRIEERDGKLYATPTATEQAHAPA* |
| Ga0137404_107148871 | 3300012929 | Vadose Zone Soil | QELYAACPSDRPNHVGIAVQRHIRAGRIQERDGKLYATPTATEQAQATA* |
| Ga0137407_123763151 | 3300012930 | Vadose Zone Soil | NDRPNHVGIAVQRHIRAGRIEERDGKLYATSPTTAQAHAAA* |
| Ga0137410_112263972 | 3300012944 | Vadose Zone Soil | PNHVGMAVQRHIRAGRIQERDGKLHATPTATEQAHATA* |
| Ga0126375_106964151 | 3300012948 | Tropical Forest Soil | KTRQELYAACSGDRPNHVGIAVQRHIRAGQERDGKLYATSTATGRDHATA* |
| Ga0126375_120823012 | 3300012948 | Tropical Forest Soil | DRPNHVGIAVQRHIRAGRIQERDGKLYATPTATDQDHATA* |
| Ga0126369_121461521 | 3300012971 | Tropical Forest Soil | KTRQELYAACPSDRPNHVGMAVQRHIRAGRIQERDGKLYATATAAEQAPATA* |
| Ga0137418_106274402 | 3300015241 | Vadose Zone Soil | ELYVACPNDRPNHIGMAVQRHIRAGRIQERDGKLHATPSATEQAHATA* |
| Ga0137409_101905091 | 3300015245 | Vadose Zone Soil | RPNHVGMAVQRHIRAGRIQERDGKLHATPPATEQAHATA* |
| Ga0137409_105839971 | 3300015245 | Vadose Zone Soil | RPNHVGMAVQRHIRAGRIQERDGKLYATPTATEQAHATA* |
| Ga0182041_100952804 | 3300016294 | Soil | RPNHVGIAVQRHIRAGRIQERDGKLYATSTATERAHATA |
| Ga0182041_106653051 | 3300016294 | Soil | YAACPSDRPNHVGIAVQRHIRAGWIQERDGKLYATSTATERARATA |
| Ga0182035_110988752 | 3300016341 | Soil | PNHVGMAVQRHIRAGRIQERDGKLYATSTATERVRATA |
| Ga0182032_102977261 | 3300016357 | Soil | AACTGDRPNHVGMAVQRHIRAGRIQERDGKLYATSTATEQSHATA |
| Ga0182032_108062981 | 3300016357 | Soil | NHVGIAVQRHLRAGRIQERDGKLYATSPAMKQSRATA |
| Ga0182034_111555041 | 3300016371 | Soil | DSPNHVGIEVQRHLCAGRIQERDGKLYATSPAMKQSRATA |
| Ga0182040_112974801 | 3300016387 | Soil | PNHVGIAVQRHIRAGRIQERDGKLYATSTATERAHHPTA |
| Ga0182039_108812283 | 3300016422 | Soil | ACTGDRPNHVGMAVQRHIRAGRIQERDGKLYATPTATEQARATA |
| Ga0182038_107949161 | 3300016445 | Soil | CPSDRPNHVGIAVQRHIRAGWIQERDGKLYATSTETERARATA |
| Ga0182038_117361961 | 3300016445 | Soil | HVGMAVQRHIRAGRIQERDGKLYATPTATEQAHATA |
| Ga0182038_121743592 | 3300016445 | Soil | YRACPNDRPNHIGMAVQRHIRAGRIQERDGKLYATSPAT |
| Ga0182038_121892452 | 3300016445 | Soil | YAACPSDRPNHIGIAVQRHIRAGRIQERDGKLYATSTATERVRATA |
| Ga0066662_107857862 | 3300018468 | Grasslands Soil | NHIGMAVQRHIRAGRIRERDGKLHATPPATEQAHATA |
| Ga0210407_101866371 | 3300020579 | Soil | RPNHVGIAVQRHIRAGRIQERDGKLYATPTATEQARATA |
| Ga0210407_102994793 | 3300020579 | Soil | SNHVGMAVQRHIRAGRIQERDGKLYATATATEQAHATA |
| Ga0210407_103041681 | 3300020579 | Soil | GKTRQELYAACPSDRPNHVGIAVQRHIRAGRIQERDGKLYTTPTATELDQATA |
| Ga0210403_113077032 | 3300020580 | Soil | YVACPTDRPNHIGMAVQRHIRAGRIHERDGKLYATSPAAEQAHATA |
| Ga0210399_109511422 | 3300020581 | Soil | ELYAACPSDRPNHVGIAVQRHIRAGRIQERDGKLYTTPTATELDQATA |
| Ga0210399_115476802 | 3300020581 | Soil | CPSDRPNHVGIAVQRHIRAGRIQERDGKLYATSTATEQVRATA |
| Ga0210401_115135332 | 3300020583 | Soil | SPGDRPNHVGMAVQRHIRAGRIQERGGKLYAISTAAE |
| Ga0210404_105565881 | 3300021088 | Soil | VGIAVQRHIRAGRIQERDGKFYATSTATERARATA |
| Ga0210400_102637012 | 3300021170 | Soil | PSDRPNHVGMAVQRHIRAGRIQERDGKLYATSPATEQAPATA |
| Ga0210400_107521422 | 3300021170 | Soil | RPNHIGMAVQRHIRAGRIQERDGKLYATSTATERARATA |
| Ga0210405_107588761 | 3300021171 | Soil | TRQQFYAACPSDRPNHVGIALQRHIRAGRIQERDGKLYATPTATDQGHSTA |
| Ga0210408_100471441 | 3300021178 | Soil | NHVGIALQRHIRAGRIQERDGKLYATPTATDQDHSTA |
| Ga0210384_116760601 | 3300021432 | Soil | PSDRPNHVGMAVQRHIRAGRIQERDGKLYATSTATEQVRATA |
| Ga0126371_139347152 | 3300021560 | Tropical Forest Soil | GKTRRELYLACPKDRPNVIGMAVQRHIRAGRIEERDGKLYASPAAQEQAHAAV |
| Ga0222729_10422601 | 3300022507 | Soil | LYAACPSDRPNHIGMAVQRHIRAGRIQERDGKLYATSTATERARATA |
| Ga0242662_102734771 | 3300022533 | Soil | NHVGMAVQRHIRAGRIQERDGKLYATPTVTEQAHATA |
| Ga0242654_100135602 | 3300022726 | Soil | AVCPSDRPNHVGMAVQRHIRAGRIQERDGKLYATPTAREQAPATA |
| Ga0242654_101214271 | 3300022726 | Soil | ACPSDRPNHIGMAVQRHIRAGRIQERDGKLYATSTATERARATA |
| Ga0207692_100549393 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | DRPNHVGMAVQRHIRAGRIQERDGKLYATSPATEQAPATA |
| Ga0257165_10716622 | 3300026507 | Soil | TGKTRQELYAACPSDRPNHVGMAVQRHIRAGRIQERDGKLYATPTATEQAHATA |
| Ga0209325_10065682 | 3300027050 | Forest Soil | MPSVGVPSDRPKHVGMAVQRHIRAGRIQERDGKLYATSTATERARATA |
| Ga0209331_10128654 | 3300027603 | Forest Soil | AGKTRQELYVACPTDRPNHVGMAVQRHIRAGRIQERDGKLYATSPATEQAPATA |
| Ga0209388_11088742 | 3300027655 | Vadose Zone Soil | KTRQELYAACPSDRPNHVGMAVQRHIRAGRIQERDGKLYATSATEQAHATA |
| Ga0209448_102461371 | 3300027783 | Bog Forest Soil | WLPVRPDGNYLACPNDRPNVIGMAIQRHIRAGRIHERDGKLYLTPPALAQAHAAG |
| Ga0209526_102097341 | 3300028047 | Forest Soil | HVGMAVQRHIRAGRIQERDGKLYATSPAAAQAHATA |
| Ga0222749_103568511 | 3300029636 | Soil | KTRQELYAACPSDRPNHVGIAVRRHIRAGRIQERDGKFYATSTATERARATA |
| Ga0170824_1107777261 | 3300031231 | Forest Soil | RQELYVACPNDRPNHIGMAVQRHIRAGRIQERDGKLYATPPATEQAHAIA |
| Ga0170818_1003016902 | 3300031474 | Forest Soil | ELYAACTGDRPNHVGIAVQRHIRAGRIQERDGKLYATPTATEQAQATA |
| Ga0170818_1026449452 | 3300031474 | Forest Soil | NHVGIAVQRHIRAGRIAERDGKLYATSPAAEQAPATA |
| Ga0318538_100356541 | 3300031546 | Soil | RPNHVGIAVQRHIRAGWIQERDGKLYATSTETERARATA |
| Ga0318538_108218602 | 3300031546 | Soil | LATGIGIAVQRHIRAGRIQDRDGKLYATSTATERARATA |
| Ga0318528_103542582 | 3300031561 | Soil | HVGMAVQRHIRAGRIQERDGKLYATPTATEQARATA |
| Ga0318528_104839681 | 3300031561 | Soil | PGDRPNHVGMAVQRHIRAGRIQERGGKLYAISTAAE |
| Ga0318573_104525281 | 3300031564 | Soil | YAACPGDRPNHVGIAVQRHIRAGRIQERDGKLYATSTATERVRATA |
| Ga0318573_106022291 | 3300031564 | Soil | ACPGDRPNHVGMAVQRHIRAGRIQERGGKLYAISTAAE |
| Ga0310915_101686881 | 3300031573 | Soil | NFYAACPSDRPNHIGIAVQRHIRAGRIQDRDGKLYATSTTTERARATA |
| Ga0310915_104834183 | 3300031573 | Soil | RPNHIGVVVQRHLRAGRIQERDGKLYATSPVTDQARATT |
| Ga0310915_108744111 | 3300031573 | Soil | RPNHVGMAVQRHIRAGRIQERDGKLYATPTATEQAHATA |
| Ga0318542_104188961 | 3300031668 | Soil | IGDRPNHVGMAVQRHIRAGRIQERDGKLYATPTATEQAHATA |
| Ga0318561_108161091 | 3300031679 | Soil | VGMAVQRHIRAGRIQERDGKLYATPTATEQARATA |
| Ga0318574_102051193 | 3300031680 | Soil | AACNSDRPNHVGMAVQRHIRAGRIQERDGKLYATPTATEQAHATA |
| Ga0318574_108132501 | 3300031680 | Soil | AACTGDRPNHVGMAVQRHIRAGRIQERDGKLYATPTATEQAHATA |
| Ga0306918_111420891 | 3300031744 | Soil | GKTRQELYAACTGDRPNHVGMAVQRHIRAGRIQERDGKLYATSTATEQAHATA |
| Ga0318502_103635361 | 3300031747 | Soil | RELYAACPGDRPNHVGMAVQRHIRAGRIQERGGKLYAISTAAE |
| Ga0318521_106649482 | 3300031770 | Soil | PNHVGMAVQRHIRAGRIQERDGKLYATPTATQQAHATA |
| Ga0318543_103437541 | 3300031777 | Soil | NHVGIAVQRHIRAGRIQERDGKLYATSTATERAHHPTA |
| Ga0318547_100108771 | 3300031781 | Soil | PSDRPNHVGIAVQRHIRAGWIQERDGKLYATSTATERARATA |
| Ga0318547_104663491 | 3300031781 | Soil | RELYAASPGDRPNHVGMAVQRHIRAGRIQERGGKLYAISTAAE |
| Ga0318547_110313531 | 3300031781 | Soil | CIGDRPNHVGMAVQRHIRAGRIQERDGKLYATPTATEQAHATA |
| Ga0318550_100316352 | 3300031797 | Soil | CPSDRPNHIGIAVQRHIRAGRIQDRDGKLYATSTTTERARATA |
| Ga0307473_107441622 | 3300031820 | Hardwood Forest Soil | RPNHVGIAVQRHIRAGRIEERDGKLYATLPATEQAHAAA |
| Ga0307473_112220661 | 3300031820 | Hardwood Forest Soil | CPSDRPNHVGIAVQRHIRAGRIQERDGKLYATSTATERARATA |
| Ga0310917_103494421 | 3300031833 | Soil | YAACTGDRPNHVGMAVQRHIRAGRIQERDGKLYATSTATEQSHATA |
| Ga0318517_100482551 | 3300031835 | Soil | NHVGIAVQRHIRAGWIQERDGKLYATSTETERARATA |
| Ga0318517_105576591 | 3300031835 | Soil | QELYAACTGDRPNHVGMAVQRHIRAGRIQERDGKLYATPTATEQAHATA |
| Ga0318512_105401031 | 3300031846 | Soil | GKTRQELYAACTGDRPNHVGMAVQRHIRAGRIQERDGKLYATPTATEQAHATA |
| Ga0306919_103282832 | 3300031879 | Soil | TRQELYAACTGDRPNHVGMAVQRHIRAGRIQERDGKLYATSTATEQSHATA |
| Ga0306925_100940844 | 3300031890 | Soil | CTGDRPNHVGMAVQRHIRAGRIQERDGKLYATPTATEQARATA |
| Ga0306925_108716461 | 3300031890 | Soil | KTRQELYAACNGDRPNHVGMAVQRHIRAGRIQERDGKLYAIPTATEQAHATA |
| Ga0306925_112601951 | 3300031890 | Soil | AACPGDRPNHVGIAVQRHIRAGRIQEREGKLYAISTAAE |
| Ga0318522_100595593 | 3300031894 | Soil | GDRPNHVGMAVQRHIRAGRIQERGGKLYAISTAAE |
| Ga0318522_102606501 | 3300031894 | Soil | PNHIGIAVQRHIRAGRIQERDGKLYATSTATERARATA |
| Ga0318551_106761311 | 3300031896 | Soil | NHVGIAVQRHIRAGRIHERDGKLYATPTAADQDRATA |
| Ga0318520_102993241 | 3300031897 | Soil | RELYAACPGDRPNHVGIAVQRHIRAGRIQEREGKLYAVPTAAE |
| Ga0318520_103414891 | 3300031897 | Soil | LATGKTRQELYAACTGDRPNHVGMAVQRHIRAGRIQERDGKLYATPTATEQAHATA |
| Ga0306923_100095881 | 3300031910 | Soil | DRPNHVGMAVQRHIRAGRIQERDGKLYATPTATQQAHATA |
| Ga0306923_105642003 | 3300031910 | Soil | GKTRQELYAACTGDRPNHVGMAVQRHIRAGRIQERDGKLYATSTATEQSHATA |
| Ga0306923_116298203 | 3300031910 | Soil | NHVGIAVQRHIRAGRIQERDGKLYATSTATERARATA |
| Ga0306921_104307141 | 3300031912 | Soil | LPFTRQELYPACPNDRPNHVGIAVQRHIRAGRIHERDGKLYATPTAADQDRATA |
| Ga0306921_105693611 | 3300031912 | Soil | LYAACTGDRPNHVGMAVQRHIRAGRIQERDGKLYATSTATEQSHATA |
| Ga0310912_100034481 | 3300031941 | Soil | HVGIAVQRHIRAGRIQERDGKLYATSTATERAHATA |
| Ga0310912_106650301 | 3300031941 | Soil | TGDRPNHVGMAVQRHIRAGRIQERDGKLYATSTATEQAHATA |
| Ga0310910_114216022 | 3300031946 | Soil | PNHVGMAVQRHIRAGRIQERDGKLYATPTATEQARATA |
| Ga0310909_100201501 | 3300031947 | Soil | QELYAACTGDRPNHVGMAVQRHIRAGRIQERDGKLYATPTATQQAHATA |
| Ga0306926_101744711 | 3300031954 | Soil | NHVGMAVQRHIRAGRIQERDGKLYATPTATEQARATA |
| Ga0306926_102722521 | 3300031954 | Soil | VGMAVQRHIRAGRIQERDGKLYATPTATQQAHATA |
| Ga0306926_107520991 | 3300031954 | Soil | QELYAACNGDRPNHVGMAVQRHIRAGRIQERDGKLYATPTATEQAHATA |
| Ga0306926_117288232 | 3300031954 | Soil | ACPNDRPNHIGAAVQRHIRAGRIQERDGKLYATSPTLEQVDATA |
| Ga0318530_100306152 | 3300031959 | Soil | PSDRPNHIGIAVQRHIRAGRIQDRDGKLYATSTTTERARATA |
| Ga0318530_104215621 | 3300031959 | Soil | DRPNHVGMAVQRHIRAGRIQERDGKLYATPTATEQAHATA |
| Ga0307479_108562103 | 3300031962 | Hardwood Forest Soil | RPNHVGMAVQRHIRAGRIQERDGKLYATSPATEQAHATA |
| Ga0306922_100279511 | 3300032001 | Soil | AACPSDRPNHVGIAVQRHIRAGRIQERDGKLYATSTATERANATA |
| Ga0306922_101886621 | 3300032001 | Soil | ACPNDRPNHIGMAVQRHIRAGRIQERDGKLYATSPAT |
| Ga0310911_107443541 | 3300032035 | Soil | GRTRQELYRACPKDRPNHIGMAVQRHIRAGRIQERDGKLYAISPAT |
| Ga0318545_101999861 | 3300032042 | Soil | NHVGMAVQRHIRAGRIQERDGKLYATPTATEQAHATA |
| Ga0318556_102089921 | 3300032043 | Soil | ACTGDRPNHVGMAVQRHIRAGRIQERDGKLYATSTATEQSHATA |
| Ga0318506_102828771 | 3300032052 | Soil | LYAACIGDRPNHVGMAVQRHIRAGRIQERDGKLYATPTATEQAHATA |
| Ga0318570_105875851 | 3300032054 | Soil | LYAACNGDRPNHVGMAVQRHIRAGRIQERDGKLYATPTATEQAHATA |
| Ga0318575_102679401 | 3300032055 | Soil | CTGDRPNHVGMAVQRHIRAGRIQERDGKLYATPTATEQAHATA |
| Ga0318533_105277681 | 3300032059 | Soil | ELYAACIGDRPNHVGMAVQRHIRAGRIQERDGKLYATPTATEQAHATA |
| Ga0318533_105832541 | 3300032059 | Soil | TGDRPNHVGMAVQRHIRAGRIQERDGKLYATPTATEQARATA |
| Ga0318533_110248892 | 3300032059 | Soil | PGDRPNHVGIAVQRHIRAGRIQERDGKLYATSTATERVRATA |
| Ga0318510_100834252 | 3300032064 | Soil | HVGIAEQRHIRAGRIQERDGKLYAISTSTDRDHTTA |
| Ga0318510_101063682 | 3300032064 | Soil | ELYRACPNDRPNHIGMAVQRHIRAGRIQERDGKLYATSPAT |
| Ga0318510_104544381 | 3300032064 | Soil | ATGKTRQELYAACTGDRPNHVGMAVQRHIRAGRIQERDGKLYATPTATEQAHATA |
| Ga0318513_100492223 | 3300032065 | Soil | ELYAACPSDRPNHVGIAVQRHIRAGWIQERDGKLYATSTETERARATA |
| Ga0306924_101355303 | 3300032076 | Soil | YAACTGDRPNHVGMAVQRHIRAGRIQERDGKLYATPTATEQARATA |
| Ga0306924_126217091 | 3300032076 | Soil | AACTGDRPNHVGMAVQRHIRAGRIQERDGKLYATSTATEQAHATA |
| Ga0318518_105381772 | 3300032090 | Soil | ELYAACPGDRPNHVGMAVQRHIRAGRIQERGGKLYAISTAAE |
| Ga0306920_1043782742 | 3300032261 | Soil | DRPNHVGIAVQRHIRAGRIQERDGKLYATSTATERAHATA |
| Ga0310914_100125581 | 3300033289 | Soil | GDRPNHVGMAVQRHIRAGRIQERDGKLYATPTATEQAHATA |
| ⦗Top⦘ |