NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F032403

Metagenome / Metatranscriptome Family F032403

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F032403
Family Type Metagenome / Metatranscriptome
Number of Sequences 180
Average Sequence Length 46 residues
Representative Sequence SPFYPYFVVGDPSAARYLFLGVDQPSYRAHTLMATLEYRF
Number of Associated Samples 157
Number of Associated Scaffolds 180

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.56 %
% of genes near scaffold ends (potentially truncated) 98.33 %
% of genes from short scaffolds (< 2000 bps) 87.78 %
Associated GOLD sequencing projects 148
AlphaFold2 3D model prediction Yes
3D model pTM-score0.17

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (97.222 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(13.333 % of family members)
Environment Ontology (ENVO) Unclassified
(26.111 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(46.667 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 0.00%    Coil/Unstructured: 100.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.17
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 180 Family Scaffolds
PF13442Cytochrome_CBB3 38.33
PF11453DUF2950 8.89
PF03264Cytochrom_NNT 5.56
PF14522Cytochrome_C7 2.78
PF13426PAS_9 2.22
PF08802Obsolete Pfam Family 1.67
PF00033Cytochrome_B 1.11
PF00034Cytochrom_C 1.11
PF03372Exo_endo_phos 1.11
PF00239Resolvase 0.56
PF13185GAF_2 0.56
PF02796HTH_7 0.56
PF03741TerC 0.56
PF16491Peptidase_M48_N 0.56
PF13751DDE_Tnp_1_6 0.56
PF12969DUF3857 0.56
PF11376DUF3179 0.56
PF13505OMP_b-brl 0.56
PF07730HisKA_3 0.56
PF01855POR_N 0.56
PF07366SnoaL 0.56
PF13414TPR_11 0.56
PF09699Paired_CXXCH_1 0.56
PF00355Rieske 0.56
PF11799IMS_C 0.56
PF02566OsmC 0.56
PF00270DEAD 0.56
PF10509GalKase_gal_bdg 0.56
PF13620CarboxypepD_reg 0.56
PF00383dCMP_cyt_deam_1 0.56
PF03551PadR 0.56
PF01292Ni_hydr_CYTB 0.56
PF00072Response_reg 0.56

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 180 Family Scaffolds
COG3005Tetraheme cytochrome c subunit NapC of nitrate or TMAO reductaseEnergy production and conversion [C] 5.56
COG1290Cytochrome b subunit of the bc complexEnergy production and conversion [C] 1.11
COG2452Predicted site-specific integrase-resolvaseMobilome: prophages, transposons [X] 0.56
COG4585Signal transduction histidine kinase ComPSignal transduction mechanisms [T] 0.56
COG4564Signal transduction histidine kinaseSignal transduction mechanisms [T] 0.56
COG4231TPP-dependent indolepyruvate ferredoxin oxidoreductase, alpha subunitEnergy production and conversion [C] 0.56
COG4117Thiosulfate reductase cytochrome b subunitInorganic ion transport and metabolism [P] 0.56
COG3851Signal transduction histidine kinase UhpB, glucose-6-phosphate specificSignal transduction mechanisms [T] 0.56
COG3850Signal transduction histidine kinase NarQ, nitrate/nitrite-specificSignal transduction mechanisms [T] 0.56
COG3658Cytochrome b subunit of Ni2+-dependent hydrogenaseEnergy production and conversion [C] 0.56
COG3038Cytochrome b561Energy production and conversion [C] 0.56
COG2864Cytochrome b subunit of formate dehydrogenaseEnergy production and conversion [C] 0.56
COG0674Pyruvate:ferredoxin oxidoreductase or related 2-oxoacid:ferredoxin oxidoreductase, alpha subunitEnergy production and conversion [C] 0.56
COG1969Ni,Fe-hydrogenase I cytochrome b subunitEnergy production and conversion [C] 0.56
COG1961Site-specific DNA recombinase SpoIVCA/DNA invertase PinEReplication, recombination and repair [L] 0.56
COG1846DNA-binding transcriptional regulator, MarR familyTranscription [K] 0.56
COG1765Uncharacterized OsmC-related proteinGeneral function prediction only [R] 0.56
COG1764Organic hydroperoxide reductase OsmC/OhrADefense mechanisms [V] 0.56
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 0.56
COG1695DNA-binding transcriptional regulator, PadR familyTranscription [K] 0.56
COG0861Tellurite resistance membrane protein TerCInorganic ion transport and metabolism [P] 0.56


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.22 %
UnclassifiedrootN/A2.78 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2088090014|GPIPI_16499438All Organisms → cellular organisms → Bacteria → Acidobacteria2043Open in IMG/M
2170459005|F1BAP7Q01BJDS4All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300000574|JGI1357J11328_10077509All Organisms → cellular organisms → Bacteria1131Open in IMG/M
3300000579|AP72_2010_repI_A01DRAFT_1062365All Organisms → cellular organisms → Bacteria → Acidobacteria548Open in IMG/M
3300000650|AP72_2010_repI_A1DRAFT_1010764All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium728Open in IMG/M
3300000955|JGI1027J12803_101317316All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium931Open in IMG/M
3300001979|JGI24740J21852_10103531All Organisms → cellular organisms → Bacteria → Acidobacteria723Open in IMG/M
3300004140|Ga0058894_1466731All Organisms → cellular organisms → Bacteria → Acidobacteria660Open in IMG/M
3300004152|Ga0062386_100043273All Organisms → cellular organisms → Bacteria → Acidobacteria3375Open in IMG/M
3300004152|Ga0062386_100754114All Organisms → cellular organisms → Bacteria800Open in IMG/M
3300004592|Ga0068938_1173909All Organisms → cellular organisms → Bacteria576Open in IMG/M
3300004615|Ga0068926_1263693All Organisms → cellular organisms → Bacteria → Acidobacteria545Open in IMG/M
3300004633|Ga0066395_10670408All Organisms → cellular organisms → Bacteria613Open in IMG/M
3300005166|Ga0066674_10427835All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium609Open in IMG/M
3300005332|Ga0066388_100837165All Organisms → cellular organisms → Bacteria1507Open in IMG/M
3300005439|Ga0070711_100896277All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae757Open in IMG/M
3300005439|Ga0070711_101658237All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium560Open in IMG/M
3300005450|Ga0066682_10081161All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2015Open in IMG/M
3300005574|Ga0066694_10296570All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium770Open in IMG/M
3300005578|Ga0068854_101290822All Organisms → cellular organisms → Bacteria → Acidobacteria657Open in IMG/M
3300005614|Ga0068856_102461646All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium527Open in IMG/M
3300005616|Ga0068852_102061347All Organisms → cellular organisms → Bacteria → Acidobacteria592Open in IMG/M
3300005834|Ga0068851_10809783All Organisms → cellular organisms → Bacteria → Acidobacteria582Open in IMG/M
3300005836|Ga0074470_11319540All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300005841|Ga0068863_102539181All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium521Open in IMG/M
3300006050|Ga0075028_100782182All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium580Open in IMG/M
3300006050|Ga0075028_101021360All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300006086|Ga0075019_10675049All Organisms → cellular organisms → Bacteria652Open in IMG/M
3300006162|Ga0075030_100485117All Organisms → cellular organisms → Bacteria983Open in IMG/M
3300006173|Ga0070716_101418767All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium565Open in IMG/M
3300006354|Ga0075021_10053188All Organisms → cellular organisms → Bacteria2343Open in IMG/M
3300006358|Ga0068871_100081373All Organisms → cellular organisms → Bacteria → Acidobacteria2683Open in IMG/M
3300006358|Ga0068871_100089053All Organisms → cellular organisms → Bacteria2569Open in IMG/M
3300006755|Ga0079222_10081384All Organisms → cellular organisms → Bacteria → Acidobacteria1634Open in IMG/M
3300006755|Ga0079222_12382887All Organisms → cellular organisms → Bacteria → Acidobacteria530Open in IMG/M
3300006804|Ga0079221_10055200All Organisms → cellular organisms → Bacteria1796Open in IMG/M
3300006852|Ga0075433_10345865All Organisms → cellular organisms → Bacteria → Acidobacteria1314Open in IMG/M
3300006954|Ga0079219_10061213All Organisms → cellular organisms → Bacteria1675Open in IMG/M
3300006954|Ga0079219_11438123All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium619Open in IMG/M
3300007255|Ga0099791_10301583All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium764Open in IMG/M
3300007265|Ga0099794_10746908All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium522Open in IMG/M
3300009088|Ga0099830_11199995All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium630Open in IMG/M
3300009089|Ga0099828_11685424All Organisms → cellular organisms → Bacteria558Open in IMG/M
3300009137|Ga0066709_101026156All Organisms → cellular organisms → Bacteria1209Open in IMG/M
3300009174|Ga0105241_10436489All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1156Open in IMG/M
3300009545|Ga0105237_10505090All Organisms → cellular organisms → Bacteria → Acidobacteria1216Open in IMG/M
3300009618|Ga0116127_1069214All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia973Open in IMG/M
3300010046|Ga0126384_11380034All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium656Open in IMG/M
3300010047|Ga0126382_10157576All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1564Open in IMG/M
3300010048|Ga0126373_10732023All Organisms → cellular organisms → Bacteria1049Open in IMG/M
3300010048|Ga0126373_11995995All Organisms → cellular organisms → Bacteria → Acidobacteria643Open in IMG/M
3300010048|Ga0126373_12075812All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium630Open in IMG/M
3300010333|Ga0134080_10019950All Organisms → cellular organisms → Bacteria2479Open in IMG/M
3300010333|Ga0134080_10144854All Organisms → cellular organisms → Bacteria → Acidobacteria1004Open in IMG/M
3300010361|Ga0126378_10254175All Organisms → cellular organisms → Bacteria → Acidobacteria1851Open in IMG/M
3300010361|Ga0126378_11542867All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium753Open in IMG/M
3300010362|Ga0126377_10202002All Organisms → cellular organisms → Bacteria → Acidobacteria1906Open in IMG/M
3300010391|Ga0136847_13217238All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1272Open in IMG/M
3300010401|Ga0134121_11466136All Organisms → cellular organisms → Bacteria → Acidobacteria696Open in IMG/M
3300011120|Ga0150983_10297439All Organisms → cellular organisms → Bacteria585Open in IMG/M
3300011120|Ga0150983_10912418All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300011120|Ga0150983_13936601All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium978Open in IMG/M
3300011120|Ga0150983_16288405All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium519Open in IMG/M
3300011444|Ga0137463_1302887All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300012202|Ga0137363_10470583All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1053Open in IMG/M
3300012209|Ga0137379_11214007All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium661Open in IMG/M
3300012212|Ga0150985_119258900All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae762Open in IMG/M
3300012349|Ga0137387_11057780All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium580Open in IMG/M
3300012361|Ga0137360_10301356All Organisms → cellular organisms → Bacteria1330Open in IMG/M
3300012361|Ga0137360_10352046All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1233Open in IMG/M
3300012582|Ga0137358_10061330All Organisms → cellular organisms → Bacteria → Acidobacteria2514Open in IMG/M
3300012683|Ga0137398_10331880All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1027Open in IMG/M
3300012685|Ga0137397_11188002All Organisms → cellular organisms → Bacteria → Acidobacteria550Open in IMG/M
3300012931|Ga0153915_11920263All Organisms → cellular organisms → Bacteria693Open in IMG/M
3300012944|Ga0137410_10647567All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidisarcina → Acidisarcina polymorpha877Open in IMG/M
3300012948|Ga0126375_11341349Not Available603Open in IMG/M
3300012957|Ga0164303_10390331All Organisms → cellular organisms → Bacteria856Open in IMG/M
3300012958|Ga0164299_10533993All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_3_65_5788Open in IMG/M
3300012958|Ga0164299_11671480All Organisms → cellular organisms → Bacteria → Acidobacteria504Open in IMG/M
3300012971|Ga0126369_10976185Not Available934Open in IMG/M
3300012971|Ga0126369_12383198All Organisms → cellular organisms → Bacteria615Open in IMG/M
3300012986|Ga0164304_10207241All Organisms → cellular organisms → Bacteria → Acidobacteria1285Open in IMG/M
3300012989|Ga0164305_10053945All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2370Open in IMG/M
3300013296|Ga0157374_10401750All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1367Open in IMG/M
3300015374|Ga0132255_104134197All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium616Open in IMG/M
3300016294|Ga0182041_11522949All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium616Open in IMG/M
3300016357|Ga0182032_11324633All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium622Open in IMG/M
3300016371|Ga0182034_11868000All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium530Open in IMG/M
3300016387|Ga0182040_10099432All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1970Open in IMG/M
3300016387|Ga0182040_10172831All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1563Open in IMG/M
3300016404|Ga0182037_11328004All Organisms → cellular organisms → Bacteria → Acidobacteria634Open in IMG/M
3300016422|Ga0182039_10649089All Organisms → cellular organisms → Bacteria926Open in IMG/M
3300016445|Ga0182038_11362926All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium635Open in IMG/M
3300017823|Ga0187818_10367029All Organisms → cellular organisms → Bacteria637Open in IMG/M
3300017938|Ga0187854_10223747All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium824Open in IMG/M
3300017972|Ga0187781_10662065All Organisms → cellular organisms → Bacteria754Open in IMG/M
3300017973|Ga0187780_10061604All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2585Open in IMG/M
3300018002|Ga0187868_1183599All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium737Open in IMG/M
3300018003|Ga0187876_1213758All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium642Open in IMG/M
3300018012|Ga0187810_10371105All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium599Open in IMG/M
3300018021|Ga0187882_1297170All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium619Open in IMG/M
3300018060|Ga0187765_10251485All Organisms → cellular organisms → Bacteria → Acidobacteria1041Open in IMG/M
3300018064|Ga0187773_10047509All Organisms → cellular organisms → Bacteria1962Open in IMG/M
3300018085|Ga0187772_10006230All Organisms → cellular organisms → Bacteria6208Open in IMG/M
3300018089|Ga0187774_10795079All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium638Open in IMG/M
3300020140|Ga0179590_1024564All Organisms → cellular organisms → Bacteria1443Open in IMG/M
3300020581|Ga0210399_11390714All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300021088|Ga0210404_10652566All Organisms → cellular organisms → Bacteria → Acidobacteria599Open in IMG/M
3300021168|Ga0210406_10074035All Organisms → cellular organisms → Bacteria2923Open in IMG/M
3300021181|Ga0210388_11024804All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis707Open in IMG/M
3300021344|Ga0193719_10154851All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_40CM_55_7988Open in IMG/M
3300021420|Ga0210394_10271177All Organisms → cellular organisms → Bacteria1486Open in IMG/M
3300021478|Ga0210402_10430283All Organisms → cellular organisms → Bacteria1226Open in IMG/M
3300021478|Ga0210402_10512825All Organisms → cellular organisms → Bacteria1113Open in IMG/M
3300021559|Ga0210409_10157090All Organisms → cellular organisms → Bacteria2082Open in IMG/M
3300022533|Ga0242662_10133271All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium738Open in IMG/M
3300024249|Ga0247676_1023847All Organisms → cellular organisms → Bacteria972Open in IMG/M
3300025321|Ga0207656_10608552All Organisms → cellular organisms → Bacteria → Acidobacteria558Open in IMG/M
3300025898|Ga0207692_10367928All Organisms → cellular organisms → Bacteria890Open in IMG/M
3300025899|Ga0207642_10274984All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium966Open in IMG/M
3300025899|Ga0207642_11145357All Organisms → cellular organisms → Bacteria → Acidobacteria504Open in IMG/M
3300025903|Ga0207680_11086034All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium572Open in IMG/M
3300025911|Ga0207654_10559827All Organisms → cellular organisms → Bacteria → Acidobacteria813Open in IMG/M
3300025912|Ga0207707_10410248All Organisms → cellular organisms → Bacteria → Acidobacteria1162Open in IMG/M
3300025924|Ga0207694_10393144All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1152Open in IMG/M
3300025926|Ga0207659_10029098All Organisms → cellular organisms → Bacteria → Acidobacteria3761Open in IMG/M
3300025927|Ga0207687_11735548All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300025935|Ga0207709_11521310All Organisms → cellular organisms → Bacteria → Acidobacteria555Open in IMG/M
3300025941|Ga0207711_10169457All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum1981Open in IMG/M
3300025961|Ga0207712_10342052All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1241Open in IMG/M
3300025961|Ga0207712_10795100All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae831Open in IMG/M
3300026095|Ga0207676_11230498All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium742Open in IMG/M
3300026291|Ga0209890_10089085All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1082Open in IMG/M
3300026314|Ga0209268_1103181All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium774Open in IMG/M
3300026490|Ga0257153_1038621All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium984Open in IMG/M
3300026783|Ga0207778_106648Not Available844Open in IMG/M
3300027023|Ga0207736_110136All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium568Open in IMG/M
3300027641|Ga0208827_1191360All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium548Open in IMG/M
3300027765|Ga0209073_10424876All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium549Open in IMG/M
3300027787|Ga0209074_10035164All Organisms → cellular organisms → Bacteria → Acidobacteria1456Open in IMG/M
3300027825|Ga0209039_10347865All Organisms → cellular organisms → Bacteria → Acidobacteria576Open in IMG/M
3300027854|Ga0209517_10427141All Organisms → cellular organisms → Bacteria738Open in IMG/M
3300027894|Ga0209068_10034273All Organisms → cellular organisms → Bacteria → Acidobacteria2527Open in IMG/M
3300027894|Ga0209068_10040331All Organisms → cellular organisms → Bacteria → Acidobacteria2343Open in IMG/M
3300027908|Ga0209006_10223173All Organisms → cellular organisms → Bacteria1629Open in IMG/M
3300027911|Ga0209698_10324675All Organisms → cellular organisms → Bacteria1214Open in IMG/M
(restricted) 3300028043|Ga0233417_10378362All Organisms → cellular organisms → Bacteria → Acidobacteria650Open in IMG/M
3300028379|Ga0268266_11977893All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium556Open in IMG/M
3300029701|Ga0222748_1105667All Organisms → cellular organisms → Bacteria553Open in IMG/M
3300029981|Ga0302293_10186045All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium649Open in IMG/M
3300030974|Ga0075371_11534110All Organisms → cellular organisms → Bacteria571Open in IMG/M
(restricted) 3300031197|Ga0255310_10129605All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium687Open in IMG/M
3300031446|Ga0170820_11164609All Organisms → cellular organisms → Bacteria1248Open in IMG/M
3300031543|Ga0318516_10532346All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium673Open in IMG/M
3300031573|Ga0310915_10462478All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis901Open in IMG/M
3300031573|Ga0310915_10656519All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium742Open in IMG/M
3300031754|Ga0307475_10218726All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola1524Open in IMG/M
3300031771|Ga0318546_10295845All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1120Open in IMG/M
3300031795|Ga0318557_10384685All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium645Open in IMG/M
3300031823|Ga0307478_10525691All Organisms → cellular organisms → Bacteria987Open in IMG/M
3300031896|Ga0318551_10663851All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium603Open in IMG/M
3300031912|Ga0306921_10964792All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium964Open in IMG/M
3300031946|Ga0310910_10694489All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis804Open in IMG/M
3300031954|Ga0306926_11214317All Organisms → cellular organisms → Bacteria → Acidobacteria885Open in IMG/M
3300032060|Ga0318505_10264047All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium811Open in IMG/M
3300032063|Ga0318504_10125481All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1168Open in IMG/M
3300032068|Ga0318553_10548388All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium606Open in IMG/M
3300032160|Ga0311301_11295903All Organisms → cellular organisms → Bacteria921Open in IMG/M
3300032180|Ga0307471_101305156All Organisms → cellular organisms → Bacteria888Open in IMG/M
3300032205|Ga0307472_100536169All Organisms → cellular organisms → Bacteria → Acidobacteria1018Open in IMG/M
3300032342|Ga0315286_12030605All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium534Open in IMG/M
3300032421|Ga0310812_10013635All Organisms → cellular organisms → Bacteria → Acidobacteria2755Open in IMG/M
3300032770|Ga0335085_10114804All Organisms → cellular organisms → Bacteria → Acidobacteria3449Open in IMG/M
3300032783|Ga0335079_10780421All Organisms → cellular organisms → Bacteria → Acidobacteria991Open in IMG/M
3300032805|Ga0335078_10505116All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1552Open in IMG/M
3300032898|Ga0335072_10047638All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia5798Open in IMG/M
3300033289|Ga0310914_10203896All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1766Open in IMG/M
3300033412|Ga0310810_10200137All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2259Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil13.33%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil7.78%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil6.11%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.56%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds4.44%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.44%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil3.89%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil3.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.33%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland3.33%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere3.33%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil2.78%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.78%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland2.22%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.22%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.22%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.22%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.22%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.67%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.67%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.67%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment1.11%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.11%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.11%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.11%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.11%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere1.11%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.11%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.11%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment0.56%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.56%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.56%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater0.56%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.56%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.56%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.56%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.56%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.56%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.56%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.56%
Sandy SoilEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil0.56%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.56%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.56%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.56%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.56%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.56%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.56%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2088090014Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
2170459005Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cmEnvironmentalOpen in IMG/M
3300000574Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 mEnvironmentalOpen in IMG/M
3300000579Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A01EnvironmentalOpen in IMG/M
3300000650Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A1EnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001979Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6Host-AssociatedOpen in IMG/M
3300004140Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF224 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300004592Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 26 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004615Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 11 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300005166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005450Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131EnvironmentalOpen in IMG/M
3300005574Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143EnvironmentalOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005834Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2Host-AssociatedOpen in IMG/M
3300005836Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBBEnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006086Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006354Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012EnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009618Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_100EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010391Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300011444Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2EnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017823Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3EnvironmentalOpen in IMG/M
3300017938Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150EnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300018002Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_40EnvironmentalOpen in IMG/M
3300018003Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_40EnvironmentalOpen in IMG/M
3300018012Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5EnvironmentalOpen in IMG/M
3300018021Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_150EnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018064Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018089Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MGEnvironmentalOpen in IMG/M
3300020140Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300022533Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300024249Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK17EnvironmentalOpen in IMG/M
3300025321Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026291Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 (SPAdes)EnvironmentalOpen in IMG/M
3300026314Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes)EnvironmentalOpen in IMG/M
3300026490Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-AEnvironmentalOpen in IMG/M
3300026783Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 36 (SPAdes)EnvironmentalOpen in IMG/M
3300027023Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 1 (SPAdes)EnvironmentalOpen in IMG/M
3300027641Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027667Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027765Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027787Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)EnvironmentalOpen in IMG/M
3300027825Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027854Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes)EnvironmentalOpen in IMG/M
3300027894Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028043 (restricted)Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_0.5_MGEnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300029701Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029981Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N2_2EnvironmentalOpen in IMG/M
3300030974Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA8 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031197 (restricted)Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1EnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032060Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032342Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0EnvironmentalOpen in IMG/M
3300032421Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
GPIPI_020243002088090014SoilGCTTPILTTNTPNPVGVPSPFYPGFVVGDTSAARYLFLGVDQPSYHAHTIIATLEYRF
E41_043516902170459005Grass SoilTPSPLPGAASPFYPGFVVGDPSAARYLFLGVDQPSYHAHTVMATLEYRF
JGI1357J11328_1007750943300000574GroundwaterYPFFVVGDTSAARYYFLGVDQPSYRTHRIAASIQYTF*
AP72_2010_repI_A01DRAFT_106236513300000579Forest SoilSPSPFNPGFVVGDPSAARYLFLGVDQPSYQAHTIMATLEYRF*
AP72_2010_repI_A1DRAFT_101076433300000650Forest SoilSPFYPGFVXGDTAAARYVFLGADQPSYHAHVITATLEYHF*
JGI1027J12803_10131731613300000955SoilPYFQVGDTSAARYLFLGVDQPSYRAYYISATLEFHF*
JGI24740J21852_1010353133300001979Corn RhizosphereFFVVGDTSAARYLFMGVDQPSYRAHYLAGTLEYSF*
Ga0058894_146673113300004140Forest SoilPFYPYFVVGDPSAARYLFLGVDQPSYHAHTVTASLEYRF*
Ga0062386_10004327353300004152Bog Forest SoilPVLGCTSPILNSATSPTPLPGAASPFYPGFVVGDPSSARYLFLGVDQPSYHVHIVTATLEYRF*
Ga0062386_10075411413300004152Bog Forest SoilSPFYPYFQVGDPSAARYLFLGVDQPSYHAYYVSGTLEYHF*
Ga0068938_117390913300004592Peatlands SoilPILSSATATNPVGVASPFYPYFVVGDSSAARYLFLGVDQPSYRAHFLTATLEYRF*
Ga0068926_126369313300004615Peatlands SoilPGCTSPLIGTPSPYYPFFVVGDTSAARYLFLGADQPSYRAHYLAASIEYSF*
Ga0066395_1067040813300004633Tropical Forest SoilTSPTPLPGAASPFYPGFVVGDPSSARYLFLGVDQPSYHAHTIIATLEYRF*
Ga0066674_1042783523300005166SoilPFYPGFVVGDPSSARYLFLGVDQPSYHAHTVIATLEYRF*
Ga0066388_10083716533300005332Tropical Forest SoilTNTPNPVGVPSPFYPGFVVGDTSAARYLFLGVDQPSYHAHTIIATLEYRF*
Ga0070711_10089627713300005439Corn, Switchgrass And Miscanthus RhizosphereFFFPTATPGMYPYQVVGDPSAARYLFMGVDQPSYRAHYLAATLEYSF*
Ga0070711_10165823723300005439Corn, Switchgrass And Miscanthus RhizospherePVAGCSTRILDSSTSPSPNPGAASPFYPYFVVGDPSAARYLFLGVDQPSYRAHIFTATLEYRF*
Ga0066682_1008116113300005450SoilTNAVPGCTTPILTSNTPSPQPVPGPFYPGFVVGDPSSARYLFLGVDQPSYHAHTVIATLEYRF*
Ga0066694_1029657013300005574SoilPGFVVGDPSSARYLFLGVDQPSYHAHTVIATLEYRF*
Ga0068854_10129082223300005578Corn RhizosphereGCTSPLIGTPSPFYPYFVVGDTSAARYLFMGADQPSYHAHYVAATLEYSF*
Ga0068856_10246164613300005614Corn RhizospherePYFLVGDTSAARYLFLGADQPSYRAHYLAATVEYHF*
Ga0068852_10206134713300005616Corn RhizosphereAPIPGCTSPLLGTPSPYYPFFVVGDTNAARYLFMGVDQPSYRAHYIAGTLEYSF*
Ga0068851_1080978313300005834Corn RhizosphereVPGCTSRLLGTPSPFYPFFVVGDTSAARYLFMGVDQPSYRAHYLAGTLEYSF*
Ga0074470_1131954023300005836Sediment (Intertidal)SPYYPYFTVGDTSSARYLFLGADQPSYRTHYVAATMEIHF*
Ga0068863_10253918113300005841Switchgrass RhizosphereSPNGAIPFYPYFQVGDTSAARFLFLGVDQPSYRAYYVSATLEFHF*
Ga0075028_10078218213300006050WatershedsGCTTPILTSATSASPVGVASPFYPYFVVGDPSAARYLFLGVDQPSYRAHTLTASLEYRF*
Ga0075028_10102136013300006050WatershedsSTSPAPNPGALSPFYPGFVVGDPSSARYLFLGVDQPSYHAHTLMATLEYRF*
Ga0075019_1067504913300006086WatershedsASPFYPYFVVGDPSAARYLFLGVDQPSYHAHTLTASLEYRF*
Ga0075030_10048511723300006162WatershedsTSPTPVPGAASPFYPGFVVGDPSAARYLFLGVDQPSYHAHTVMATLEYRF*
Ga0070716_10141876713300006173Corn, Switchgrass And Miscanthus RhizosphereGSTVAAKSPSPFYPFFVVGDTAAARYLFLGADQPSYRSHIITGTLEYHF*
Ga0075021_1005318853300006354WatershedsSYPYFVVGDTSSARYLFLGVDQPSYHAHTIAASLEYRF*
Ga0068871_10008137343300006358Miscanthus RhizosphereLLGTPSQFYPFFVVGDTSAARYLFLGTDQPSYKAHYLATTLEYHF*
Ga0068871_10008905313300006358Miscanthus RhizosphereVPGCPNVLLGTPSQFYPFFVVGDTSAARYLFLGTDQPSYKAHYLATTLEYHF*
Ga0079222_1008138443300006755Agricultural SoilPTPVAVTSSFYPYFVVGDPSAARYLFLGTDQPSYKAHTLLATLEYRF*
Ga0079222_1238288713300006755Agricultural SoilPFYPYFVVGDTSAARYLFMGADQPSYHAHYVAATLEYSF*
Ga0079221_1005520013300006804Agricultural SoilPGATSPFYPYFVVGDPSAARYLFLGVDQPSYHAHTLFATLEYRF*
Ga0075433_1034586523300006852Populus RhizosphereIPFYPYFQVGDTSAARYLFLGVDQPSYRAYYISATLEFHF*
Ga0079219_1006121313300006954Agricultural SoilPSPTPTPGATSPFYPYFVVGDPSAARYLFLGVDQPSYHAHTLFATLEYRF*
Ga0079219_1143812313300006954Agricultural SoilFYPYFVVGDPSAARYLFLGVDQPSYKAHTLLATLEYRF*
Ga0099791_1030158323300007255Vadose Zone SoilTLSPNGPTSFYPYFQVGDTSAARYLFLGVDQPSYRAYSISATLEFHF*
Ga0099794_1074690823300007265Vadose Zone SoilAAPVAGCTKRILDSSTSPSPNPGAISPFYPYSVVGDPSGARYLFLGVDQPSYRAHFLSATLEYRF*
Ga0099830_1119999523300009088Vadose Zone SoilIGTTSTNPTFTPNSFYPGFVVGDTSAARYLFLGVDQPSYRVHTVTATLEYRF*
Ga0099828_1168542413300009089Vadose Zone SoilSPNPVGAPSPFYPYFVVGDPSAARYLFLGVDQPSYHAHTLTATLEYRF*
Ga0066709_10102615613300009137Grasslands SoilRYPSPYYPNFVVGDTGAARYIFLGADQPSYRAHVLSVTVQYHF*
Ga0105241_1043648943300009174Corn RhizosphereYPYFLVGDTSAARYLFLGADQPSYRAHYLAATVEYHF*
Ga0105237_1050509013300009545Corn RhizospherePSSFYPYFFVGDTSAARYLFMGADQPSYHAHYVAATLEYSF*
Ga0116127_106921413300009618PeatlandFYPGFVVGDPSAARYIFMGVDQPSYRVNVMSATIEYQF*
Ga0126384_1138003423300010046Tropical Forest SoilFVVGDPSSARYLFLGVDQPSYHAHTVIATIEYRF*
Ga0126382_1015757653300010047Tropical Forest SoilSTTAGKVPSPFYPGFVVGDTAAARYVFLGADQPSYHAHIITATLEYHF*
Ga0126373_1073202323300010048Tropical Forest SoilPILNSSTSPTPLPGAASPFYPGFVVGDPSAARYLFLGVDQPSYHAHIVMATLEYRF*
Ga0126373_1199599513300010048Tropical Forest SoilSPFYPGFVVGDPSSARYLFLGVDQPSYHAHTIMATLEYRF*
Ga0126373_1207581213300010048Tropical Forest SoilFYPGFVVGDPSAARYLFLGVDQPSYHAHIITATLEYRF*
Ga0134080_1001995043300010333Grasslands SoilAARYPSPYYGNIVVGDTGAARYIFLGADQPSYRAHVLSVTVQYHF*
Ga0134080_1014485413300010333Grasslands SoilPFYPGFVVGDTAAARYLFLGVDQPSYRAHIFIATLEYHF*
Ga0126378_1025417513300010361Tropical Forest SoilTPILTTNTPNPVGVPSPFYPGFVVGDTSAARYLFLGVDQPSYHAHTIIATLEYRF*
Ga0126378_1154286713300010361Tropical Forest SoilTNPILNSSTSPTPLPGALSPFYPGFVVGDPSSARYLFLGVDQPSYHAHIIMATLEYRF*
Ga0126377_1020200233300010362Tropical Forest SoilPFYPGFVVGDTSAARYLFLGVDQPSYHAHTIIATLEYRF*
Ga0136847_1321723833300010391Freshwater SedimentPTFTPSPYYPNAVVGDTSAARYIFLGVDQPSYRVHVITATLEYSW*
Ga0134121_1146613633300010401Terrestrial SoilPFFVVGDTSAARYLFMGVDEPSYRAHYLAGTLEYSF*
Ga0150983_1029743913300011120Forest SoilFPILNSSTSPTPLPGAPSPFYPGFVVGDPSAARYLFLGVDQPSYHAHIVTATLEYRF*
Ga0150983_1091241823300011120Forest SoilSPFYPYFVVGDPSAARYLFLGVDQPSYRAHTLMATLEYRF*
Ga0150983_1393660113300011120Forest SoilNSSTSPTPAPGAASPFYPGFVVGDPSAARYLFLGVDQPSYHAHTIMATLEYRF*
Ga0150983_1628840513300011120Forest SoilPGCTTPFLTSNTINPVGVASPFYPYFVVGDPSSARYLFLGVDQPSYRAHTLMASLEYRF*
Ga0137463_130288713300011444SoilTRILNSATSPNPVGVASPFYPYFVVGDPSAARYLFLGVDQPSYRAHTITASLEYRF*
Ga0137363_1047058313300012202Vadose Zone SoilPILTSNIPSPQPIPGPFYPGFVVGDPSAARYLFLGVDQPSYHAHTVIATLEYRF*
Ga0137379_1121400713300012209Vadose Zone SoilPGFVVGDTAAARYLFLGADQPSYRVHIFIATLEYHF*
Ga0150985_11925890013300012212Avena Fatua RhizosphereVCSSDLFFVVGDTSAARYLFMGADQPSYHAHYLAATLEYHF*
Ga0137387_1105778023300012349Vadose Zone SoilFYPYFVVGDPSAARYMFLGVDQPSYHAHTVMATLEYRF*
Ga0137360_1030135613300012361Vadose Zone SoilNSATSPTPVPGAASPFYPGFVVGDPSAARYLFLGVDQPSYHAHTIMATLEYRF*
Ga0137360_1035204613300012361Vadose Zone SoilNSATSPTPVPGAASPFYPGFVVGDPSAARYLFLGVDQPSYHAHTITATLEYRF*
Ga0137358_1006133053300012582Vadose Zone SoilNAVPGCTTPILTAKTASPQPVPGPFYPGFVVGDPSAARYLFLGVDQPSYHAHTVIATLEYRF*
Ga0137398_1033188013300012683Vadose Zone SoilNSATSPTPVPGAASPFYPGFVVGDPSAARYLFLGVDHPSYHAHTITATLEYRF*
Ga0137397_1118800223300012685Vadose Zone SoilGFVVGDPSAARYLFLGVDQPSYHAHTITATLEYRF*
Ga0153915_1192026323300012931Freshwater WetlandsCTTPLLTSATSATPVAVSSPFYPGFVVGDSSAARFLFLGVDQPSYHAHYLTATLEYHF*
Ga0137410_1064756723300012944Vadose Zone SoilPGPFYPGFVVGDPSSARYLFLGADQPSYHAHTVIATLEYRF*
Ga0126375_1134134913300012948Tropical Forest SoilSYYPGFVVGDTSAARYLFLGADQPSYRVHIFTATLEYRF*
Ga0164303_1039033133300012957SoilSPFYPYFVVGDTGAARYLFLGADQPSYRAHYLAATVEYHF*
Ga0164299_1053399333300012958SoilGFVVGDTAAARYIFLGADQPSYRAHIITATLEYRF*
Ga0164299_1167148013300012958SoilPSQFYPFFVVGDTSAARYLFLGTDQPSYKAHYLATTLEYHF*
Ga0126369_1097618523300012971Tropical Forest SoilGVPSPFYPGFVVGDTSAARYLFLGVDQPSYHAHTIIATLEYRF*
Ga0126369_1238319813300012971Tropical Forest SoilKSPNVYYPGFVVGDTAAARYLFLGADQPSYRTHIITATLEYHF*
Ga0164304_1020724143300012986SoilFYPYFVVGDTSAARYLFLGADQPSYRAHYVAATVEYHF*
Ga0164305_1005394513300012989SoilPLIGTPSPFYPYFVVGDTSSARFLFLGADQPSYRANYLAGTLEYSF*
Ga0157374_1040175013300013296Miscanthus RhizospherePNGAIPFYPYFQVGDTSAARFLFLGVDQPSYRAYYVSATLEFHF*
Ga0132255_10413419723300015374Arabidopsis RhizosphereVGTNLSIKSPSSFYPGFVVGDTAAARYLFLGADQPSYRAHVITATLEYRF*
Ga0182041_1152294913300016294SoilSPAPTPGATSPFYPYFVVGDPSSARYLFLGVDQPSYHAHTVMATLEYRF
Ga0182032_1132463313300016357SoilAPNAVPGCTTPILTTNTSNPMGVPSSFYPGFVVGDPSAARYLFLGVDQPSYHAHTVVATIEFQF
Ga0182034_1186800013300016371SoilAVKSPNVYYPGFVVGDTAAARYLFLGADQPSYRTHIITATLEYRF
Ga0182040_1009943213300016387SoilPNPVGVPSPFYPGFVVGDTSEARYLFLGVDQPSYHAHTIIATLEYRF
Ga0182040_1017283113300016387SoilSPVGVASPFYPYFVVGDPSAARYLFLGVDQPSYHAHTVVATIEFNF
Ga0182037_1132800413300016404SoilPGGASPFYPGFVVGDTNAARYLFLGVDQPSYHAHTIMATLEYRF
Ga0182039_1064908913300016422SoilPGFVVGDTAAARYLFLGADQPSYRTHIITATLEFRF
Ga0182038_1136292613300016445SoilPYYPYFVVGDTAAARYLFLGADQPSYHAHVFTGTVEYHF
Ga0187818_1036702913300017823Freshwater SedimentNPLIGTPSPYYPFFVVGDTSSARYLFLGADQPSYRAHYLAASIEYSF
Ga0187854_1022374723300017938PeatlandFYPGFVVGDPSAARYIFMGVDQPSYRVNVMSATIEYQF
Ga0187781_1066206513300017972Tropical PeatlandLSPNGASPFYPYFQVGDPSAARYLFLGVDQPSYHAYYVSATMEYHF
Ga0187780_1006160443300017973Tropical PeatlandPYYPGFVVGDPSAARYLFLGVDQPSYHAHIVTATLEYRF
Ga0187868_118359913300018002PeatlandSFYPGFVVGDPSAARYIFMGVDQPSYRVNVMSATIEYQF
Ga0187876_121375813300018003PeatlandIPQPSSFYPGFVVGDPSAARYIFMGVDQPSYRVNVMSATIEYQF
Ga0187810_1037110523300018012Freshwater SedimentSPPPVPGAASPFYPGFVVGDPSAARFLFLGVDQPSYHAHIVSATLEYRF
Ga0187882_129717013300018021PeatlandGFVVGDPSAARYIFMGVDQPSYRVNVMSATIEYQF
Ga0187765_1025148513300018060Tropical PeatlandGVVASPFYPFFVVGDPSAARYLFLGSDQPSYHVHYLAATLEIHF
Ga0187773_1004750943300018064Tropical PeatlandSSPFYPTFVVGDTSAARYLFLGVDQPSYHAHYLAATLEYHF
Ga0187772_1000623063300018085Tropical PeatlandFYPYFVVGDPSAARYLFLGVDQPSYHAHTIMATLEYRF
Ga0187774_1079507923300018089Tropical PeatlandMLTSSTSATATPVPGSSPFYPYFVVGDSSAARYLFLGVDQPSYHAHYVAATMEYHF
Ga0179590_102456433300020140Vadose Zone SoilPGPAPGTVPNCTSPILNSGTSPTPVPGAASPFYPGFVVGDPSAARYLFLGVDQPSYHAHTVMATLEYRF
Ga0210399_1139071423300020581SoilPGCTFPILNSSTSPTPLPGAPSPFYPGFVVGDPSAARYLFLGVDQPSYHAHIVTATLEYR
Ga0210404_1065256613300021088SoilLTSNTINPVGVASPFYPYFVVGDPSSARYLFLGVDQPSYHAHTLMASLEYRF
Ga0210406_1007403533300021168SoilKPQPGAPSPFYPGFVVGDPSSARYLFLGVDQPSYHAHTVMATLEYRF
Ga0210388_1102480413300021181SoilLTSNTPAPVGVPSPFYPYFTVGDTSAARYLFLGVDQPSYHAHTIIATLEYRF
Ga0193719_1015485123300021344SoilSPLLGTPSPFYPYFVVGDTSAARYLFLGADQPSYRAHYVAATLEYTF
Ga0210394_1027117733300021420SoilCTAPILTSNTPNPQPGAPSPFYPGFVVGDPSSARYLFLGVDQPSYHAHTVMATLEYRF
Ga0210402_1043028333300021478SoilAASPFYPGFVVGDPSSARYLFLGVDQPSYHAHTVMATLEYRF
Ga0210402_1051282513300021478SoilASPFYPGFVVGDPSAARYLFLGVDQPSYHAHTVMATLEYRF
Ga0210409_1015709033300021559SoilPSPFYPGFVVGDPSSARYLFLGVDQPSYHAHTVMATLEYRF
Ga0242662_1013327113300022533SoilGFVVGDPSAARYLFLGVDQPSYHAHIVTATLEYRF
Ga0247676_102384713300024249SoilPILTSNTPNPQPGAPSPFYPGFVVGDPSAARYLFLGVDQPSYHAHTVMATLEYRF
Ga0207656_1060855213300025321Corn RhizosphereVVPGCTSRLLGTPSPFYPFFVVGDTSAARYLFMGVDQPSYRAHYLAGTLEYSF
Ga0207692_1036792833300025898Corn, Switchgrass And Miscanthus RhizosphereQLGTPSPFYPYFVVGDTSAARYLFLGADQPSYRAHYLAATVEYHF
Ga0207642_1027498413300025899Miscanthus RhizosphereYPYFQVGDTSAARFLFLGVDQPSYRAYSVSGTLEFHF
Ga0207642_1114535713300025899Miscanthus RhizosphereGCTSPVLGTPSPYYPFFVVGDPSAARYLFMGVDQPSYHAHYIAGTLEYSF
Ga0207680_1108603413300025903Switchgrass RhizospherePSPFYPYFLVGDTSAARYLFLGADQPSYRAHYLAATVEYHF
Ga0207654_1055982713300025911Corn RhizosphereSPYYPFFVVGDTNAARYLFMGVDQPSYRAHYIAGTLEYSF
Ga0207707_1041024813300025912Corn RhizosphereFYPYFLVGDTSAARYLFLGADQPSYRAHYLAATVEYHF
Ga0207694_1039314433300025924Corn RhizospherePYFVVGDTAAARYLFLGADQPSYRAHVFTGTLEYRF
Ga0207659_1002909813300025926Miscanthus RhizosphereNGAIPFYPYFQVGDTSAARFLFLGVDQPSYRAYSVSGTLEFHF
Ga0207687_1173554813300025927Miscanthus RhizosphereTSPQLGTPSPFYPYFVVGDTSAARYLFLGADQPSYRAHYLAATVEYHF
Ga0207709_1152131023300025935Miscanthus RhizosphereLGTPSPYYPFFVVGDTNAARYLFMGVDQPSYRAHYIAGTLEYSF
Ga0207711_1016945713300025941Switchgrass RhizospherePNPEPVPGPFYPGFIVGDPSAARYLFLGADQPSYHAHTIIATLEYRF
Ga0207712_1034205213300025961Switchgrass RhizosphereIPFYPYFQVGDTSAARFLFLGVDQPSYRAYSVSGTLEFHF
Ga0207712_1079510033300025961Switchgrass RhizospherePFFVVGDTSAARYLFLGTDQPSYKAHYLATTLEYHF
Ga0207676_1123049833300026095Switchgrass RhizosphereAPVPGCTSPLLGTPSPFYPYFLVGDTSAARYLFLGADQPSYRAHYLAATVEYHF
Ga0209890_1008908533300026291SoilAPVPGCTSPLIGTPSPYYPFFVVGDPSAARYLFLGADEPSYRAHYIAASLEYTF
Ga0209268_110318123300026314SoilGPFYPGFVVGDPSSARYLFLGVDQPSYHAHTVIATLEYRF
Ga0257153_103862113300026490SoilNPILNSSTSPTPLPGALSPFYPGFVVGDPSAARYLFLGVDQPSYHAHTILATLEYRF
Ga0207778_10664823300026783Tropical Forest SoilTPILTSNTPNPVGVTSPFYPYYVVGDTSAARYLFLGVDQPSYRAHSVIATIEFNF
Ga0207736_11013613300027023Tropical Forest SoilASPFYPGFVVGDPSSARYIFLGVDQPSYHAHTVIATVEYRF
Ga0208827_119136023300027641Peatlands SoilTPVLTSNTVNPVGSPSPFYPYFTVGDPSAARYLFLGVDQPSYHAHTVLATLEYRF
Ga0209009_113384013300027667Forest SoilLIVSTSISPTFTPSPFYPGFVVGDTSAARYLFLGVDQPSYRVHIITATLEYRF
Ga0209073_1042487623300027765Agricultural SoilATSSFYPYFVVGDPSAARYLFLGVDQPSYHAHTLMATLEYRF
Ga0209074_1003516443300027787Agricultural SoilFPSAFYPFFVVGDTAAARYLFLGADQPSYRAHYFSATLEIRF
Ga0209039_1034786513300027825Bog Forest SoilPSTILNSATSATPLPGAASPYYPYFVVGDPSSARYLFLGVDQPSYHVHTVMATLEYRF
Ga0209517_1042714123300027854Peatlands SoilSPFYPYFQVGDPSAARYLFLGVDQPSYHAYYVSGTLEYHF
Ga0209068_1003427343300027894WatershedsPYFMVGDPSSARYLFLGVDQPSYRAHYIAGTLEYHF
Ga0209068_1004033153300027894WatershedsSYPYFVVGDTSSARYLFLGVDQPSYHAHTIAASLEYRF
Ga0209006_1022317333300027908Forest SoilPVPGAASPFYPGFVVGDPSAARYLFLGVDQPSYHAHTVTATLEYRF
Ga0209698_1032467523300027911WatershedsVPGAASPFYPGFVVGDPSAARYLFLGVDQPSYHAHTVMATLEYRF
(restricted) Ga0233417_1037836213300028043SedimentPYFVVGDTSSARFIFLGADQPSYRVHTLSATLEIRF
Ga0268266_1197789313300028379Switchgrass RhizospherePYFQVGDTSAARFLFLGVDQPSYRAYYVSATLEFHF
Ga0222748_110566713300029701SoilPGAASPFYPGFVVGDPSAARYLFLGVDQPSYHAHIVTATLEYRF
Ga0302293_1018604513300029981FenPVPGCTSPLIGTPSPFYPFFVVGDTSAARYLFLGADQPSYRAHYLAVSLQYTF
Ga0075371_1153411023300030974SoilPFYPGFVVGDPSSARYLFLGVDQPSYHAHTVMATLEYRF
(restricted) Ga0255310_1012960513300031197Sandy SoilSPFYPYFVVGDSAAARYYFLGADQPSYRTHRIAASIQYTF
Ga0170820_1116460913300031446Forest SoilYPGFVVGDPSAARYLFLGVDQPSYHAHTVMATLEYRF
Ga0318516_1053234623300031543SoilYPSLNYPGFVVGDTAAARYLFLGADQPSYRTHIITATLEFRF
Ga0310915_1046247813300031573SoilCTTPILTTNTPNPVGVPSPFYPGFVVGDTSAARYLFLGVDQPSYHAHTIIATLEYRF
Ga0310915_1065651913300031573SoilSPNGLTQFYPYFQVGDNSAARYLFLGVDQPSYHAYYVAATLEFHF
Ga0307475_1021872633300031754Hardwood Forest SoilFYPYFQVGDTSAARYLFLGVDQPSYRAYSVSATLEFHF
Ga0318546_1029584513300031771SoilNYPGFVVGDTAAARYLFLGADQPSYRTHIFTATLEFRF
Ga0318557_1038468513300031795SoilSLNYPGFVVGDTAAARYLFLGADQPSYRTHIITATLEFRF
Ga0307478_1052569123300031823Hardwood Forest SoilPVPGCTSPILNSSTSPTPLPGAASPFYPGFVVGDPSAARYLFLGVDQPSYHAHTIMVTLEYRF
Ga0318551_1066385123300031896SoilSVPGCTTPILLTNTASPAPGAASPFYPYFVVGDPSAARYLFLGTDQPSYHAHTLIATLEYRF
Ga0306921_1096479213300031912SoilQFYPYFQVGDNSAARYLFLGVDQPSYHAYYVAATLEFHF
Ga0310910_1069448933300031946SoilTNTPNPVGVPSPFYPGFVVGDTSAARYLFLGVDQPSYHAHTIIATLEYRF
Ga0306926_1121431713300031954SoilSPSLYYPGFVVGDTAAARYLFLGADQPSYRVHIISATLEYRF
Ga0318505_1026404713300032060SoilCTTPILLTNTASPAPGAASPFYPYFVVGDPSAARYLFLGTDQPSYHAHTLIATLEYRF
Ga0318504_1012548133300032063SoilSVPGCTTPILTTNTPNPVGVPSPFYPGFVVGDTSAARYLFLGVDQPSYHAHTIIATLEYR
Ga0318553_1054838823300032068SoilYPGFVVGDTAAARYLFLGADQPSYRTHIITATLEFRF
Ga0311301_1129590333300032160Peatlands SoilYPYFQVGDPSAARYLFLGVDQPSYHAYYVSGTLEYHF
Ga0307471_10130515623300032180Hardwood Forest SoilFYPYFVVGDPSAARYLFLGVDQPSYHAHTVLATLEYRF
Ga0307472_10053616913300032205Hardwood Forest SoilYFQVGDTSAARYLFLGVDQPSYRAYSVSATVEFHF
Ga0307472_10221081913300032205Hardwood Forest SoilSTSPSPNPGSISPFYPYFVVGDPSAARYLFLGVDQPSYRAHFLSATLEYRF
Ga0315286_1203060513300032342SedimentSPTYTPNSFYPGFVVGDTSAARYLFLGADQPSYRVHALTVALEYRF
Ga0310812_1001363513300032421SoilVPGCSSVVLGTASAYYPFFVVGDPSAARYLFMGVDQPSYRAHYLAATLEYSF
Ga0335085_1011480413300032770SoilPGCTDPLIGTPSPYYPYFVVGDTSAARYLFLGADQPSYRAHYVAASLEYHF
Ga0335079_1078042113300032783SoilYYPYFVVGDTSAARYLFLGADQPSYRAHYLAASLEYHF
Ga0335078_1050511613300032805SoilDPLIGTPSPYYPYFVVGDTSAARYLFLGADQPSYRAHYLAASLEYHF
Ga0335072_1004763813300032898SoilGSVLIGTPSLYYPYSVVGDTSAARYLFLGADEPSYRAHYLAGTLEYQF
Ga0310914_1020389633300033289SoilPSPFYPGFVVGDTSAARYLFLGVDQPSYHAHTIIATLEYRF
Ga0310810_1020013713300033412SoilSPLIGTPSPFYPYFVVGDTSAARYLFMGADQPSYHAHYVAATLEYSF


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.