| Basic Information | |
|---|---|
| Family ID | F032394 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 180 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MNDKWHFMSETKLRDGSVLLAGGYPNNDQATAQTWIYRP |
| Number of Associated Samples | 152 |
| Number of Associated Scaffolds | 180 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 5.62 % |
| % of genes near scaffold ends (potentially truncated) | 92.22 % |
| % of genes from short scaffolds (< 2000 bps) | 87.22 % |
| Associated GOLD sequencing projects | 143 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (85.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (18.333 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.222 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 23.88% Coil/Unstructured: 76.12% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 180 Family Scaffolds |
|---|---|---|
| PF13407 | Peripla_BP_4 | 9.44 |
| PF12838 | Fer4_7 | 5.00 |
| PF02310 | B12-binding | 2.22 |
| PF07690 | MFS_1 | 2.22 |
| PF00590 | TP_methylase | 1.67 |
| PF00326 | Peptidase_S9 | 1.67 |
| PF11967 | RecO_N | 1.67 |
| PF07676 | PD40 | 1.11 |
| PF00216 | Bac_DNA_binding | 1.11 |
| PF01344 | Kelch_1 | 1.11 |
| PF00330 | Aconitase | 1.11 |
| PF14579 | HHH_6 | 1.11 |
| PF07228 | SpoIIE | 1.11 |
| PF01741 | MscL | 1.11 |
| PF12680 | SnoaL_2 | 1.11 |
| PF00581 | Rhodanese | 1.11 |
| PF13418 | Kelch_4 | 1.11 |
| PF08123 | DOT1 | 0.56 |
| PF07883 | Cupin_2 | 0.56 |
| PF00857 | Isochorismatase | 0.56 |
| PF13231 | PMT_2 | 0.56 |
| PF07927 | HicA_toxin | 0.56 |
| PF12708 | Pectate_lyase_3 | 0.56 |
| PF00474 | SSF | 0.56 |
| PF06262 | Zincin_1 | 0.56 |
| PF03949 | Malic_M | 0.56 |
| PF13282 | DUF4070 | 0.56 |
| PF06662 | C5-epim_C | 0.56 |
| PF01676 | Metalloenzyme | 0.56 |
| PF04909 | Amidohydro_2 | 0.56 |
| PF03965 | Penicillinase_R | 0.56 |
| PF08031 | BBE | 0.56 |
| PF13419 | HAD_2 | 0.56 |
| PF00005 | ABC_tran | 0.56 |
| PF02091 | tRNA-synt_2e | 0.56 |
| PF08818 | DUF1801 | 0.56 |
| PF03544 | TonB_C | 0.56 |
| PF12730 | ABC2_membrane_4 | 0.56 |
| PF06736 | TMEM175 | 0.56 |
| PF13847 | Methyltransf_31 | 0.56 |
| PF01343 | Peptidase_S49 | 0.56 |
| PF14321 | DUF4382 | 0.56 |
| COG ID | Name | Functional Category | % Frequency in 180 Family Scaffolds |
|---|---|---|---|
| COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 1.11 |
| COG0776 | Bacterial nucleoid DNA-binding protein IHF-alpha | Replication, recombination and repair [L] | 1.11 |
| COG1970 | Large-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 1.11 |
| COG1724 | Predicted RNA binding protein YcfA, dsRBD-like fold, HicA-like mRNA interferase family | General function prediction only [R] | 0.56 |
| COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 0.56 |
| COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 0.56 |
| COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 0.56 |
| COG3824 | Predicted Zn-dependent protease, minimal metalloprotease (MMP)-like domain | Posttranslational modification, protein turnover, chaperones [O] | 0.56 |
| COG3682 | Transcriptional regulator, CopY/TcrY family | Transcription [K] | 0.56 |
| COG3548 | Uncharacterized membrane protein | Function unknown [S] | 0.56 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.56 |
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.56 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.56 |
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.56 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.56 |
| COG0752 | Glycyl-tRNA synthetase, alpha subunit | Translation, ribosomal structure and biogenesis [J] | 0.56 |
| COG0686 | Alanine dehydrogenase (includes sporulation protein SpoVN) | Amino acid transport and metabolism [E] | 0.56 |
| COG0281 | Malic enzyme | Energy production and conversion [C] | 0.56 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 85.00 % |
| Unclassified | root | N/A | 15.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001356|JGI12269J14319_10186543 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 833 | Open in IMG/M |
| 3300001404|JGI20181J14860_1000861 | All Organisms → cellular organisms → Bacteria | 4761 | Open in IMG/M |
| 3300001413|JGI20180J14839_1000701 | Not Available | 1977 | Open in IMG/M |
| 3300001471|JGI12712J15308_10176277 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 558 | Open in IMG/M |
| 3300001593|JGI12635J15846_10261056 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1105 | Open in IMG/M |
| 3300001867|JGI12627J18819_10315976 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300004080|Ga0062385_11123975 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300004082|Ga0062384_100227034 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1119 | Open in IMG/M |
| 3300004082|Ga0062384_100572014 | Not Available | 761 | Open in IMG/M |
| 3300004091|Ga0062387_100182973 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1246 | Open in IMG/M |
| 3300004092|Ga0062389_100823261 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1109 | Open in IMG/M |
| 3300005332|Ga0066388_100634253 | All Organisms → cellular organisms → Bacteria | 1686 | Open in IMG/M |
| 3300005436|Ga0070713_100268155 | All Organisms → cellular organisms → Bacteria | 1562 | Open in IMG/M |
| 3300005535|Ga0070684_101792949 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 579 | Open in IMG/M |
| 3300005541|Ga0070733_10088612 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1965 | Open in IMG/M |
| 3300005563|Ga0068855_102488776 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300005574|Ga0066694_10145385 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1123 | Open in IMG/M |
| 3300005575|Ga0066702_10595555 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 664 | Open in IMG/M |
| 3300005602|Ga0070762_10489723 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300005610|Ga0070763_10729034 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 582 | Open in IMG/M |
| 3300005614|Ga0068856_100504436 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 1231 | Open in IMG/M |
| 3300005921|Ga0070766_10443994 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
| 3300006052|Ga0075029_100777834 | Not Available | 650 | Open in IMG/M |
| 3300006059|Ga0075017_100439942 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 983 | Open in IMG/M |
| 3300006162|Ga0075030_100025859 | All Organisms → cellular organisms → Bacteria | 5029 | Open in IMG/M |
| 3300006162|Ga0075030_100028548 | All Organisms → cellular organisms → Bacteria | 4768 | Open in IMG/M |
| 3300006162|Ga0075030_100930196 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 685 | Open in IMG/M |
| 3300006174|Ga0075014_100492990 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300006174|Ga0075014_100890305 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300006176|Ga0070765_100360930 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1352 | Open in IMG/M |
| 3300006893|Ga0073928_10153569 | All Organisms → cellular organisms → Bacteria | 1854 | Open in IMG/M |
| 3300009638|Ga0116113_1010874 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1924 | Open in IMG/M |
| 3300009644|Ga0116121_1013929 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2607 | Open in IMG/M |
| 3300009672|Ga0116215_1107394 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1249 | Open in IMG/M |
| 3300009824|Ga0116219_10083807 | Not Available | 1865 | Open in IMG/M |
| 3300010339|Ga0074046_10237817 | All Organisms → cellular organisms → Bacteria | 1134 | Open in IMG/M |
| 3300010361|Ga0126378_10448058 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1405 | Open in IMG/M |
| 3300010366|Ga0126379_12559796 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300010376|Ga0126381_101008787 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1201 | Open in IMG/M |
| 3300010379|Ga0136449_101930240 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 876 | Open in IMG/M |
| 3300010397|Ga0134124_10945495 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
| 3300010876|Ga0126361_10809688 | Not Available | 1174 | Open in IMG/M |
| 3300011120|Ga0150983_10513125 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 601 | Open in IMG/M |
| 3300011120|Ga0150983_15567065 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 808 | Open in IMG/M |
| 3300011120|Ga0150983_15618016 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 713 | Open in IMG/M |
| 3300012205|Ga0137362_11115095 | Not Available | 670 | Open in IMG/M |
| 3300012924|Ga0137413_10484612 | Not Available | 907 | Open in IMG/M |
| 3300014501|Ga0182024_11191326 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 892 | Open in IMG/M |
| 3300015372|Ga0132256_101068811 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 922 | Open in IMG/M |
| 3300017822|Ga0187802_10072905 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1274 | Open in IMG/M |
| 3300017823|Ga0187818_10011357 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3805 | Open in IMG/M |
| 3300017930|Ga0187825_10308930 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300017937|Ga0187809_10105435 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 948 | Open in IMG/M |
| 3300017940|Ga0187853_10307591 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300017946|Ga0187879_10285738 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 917 | Open in IMG/M |
| 3300017955|Ga0187817_10000263 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 21346 | Open in IMG/M |
| 3300017955|Ga0187817_10418355 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 855 | Open in IMG/M |
| 3300017955|Ga0187817_10517006 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
| 3300017955|Ga0187817_10722355 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 635 | Open in IMG/M |
| 3300017955|Ga0187817_11032705 | Not Available | 527 | Open in IMG/M |
| 3300017970|Ga0187783_11314843 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 521 | Open in IMG/M |
| 3300018013|Ga0187873_1345225 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 544 | Open in IMG/M |
| 3300018019|Ga0187874_10368161 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 581 | Open in IMG/M |
| 3300018034|Ga0187863_10437574 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 730 | Open in IMG/M |
| 3300018037|Ga0187883_10579624 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 581 | Open in IMG/M |
| 3300018042|Ga0187871_10011979 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5870 | Open in IMG/M |
| 3300018042|Ga0187871_10420259 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 739 | Open in IMG/M |
| 3300018042|Ga0187871_10775278 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
| 3300018044|Ga0187890_10317358 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
| 3300018044|Ga0187890_10464256 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 711 | Open in IMG/M |
| 3300018047|Ga0187859_10380225 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 773 | Open in IMG/M |
| 3300018086|Ga0187769_11448341 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
| 3300018088|Ga0187771_10917061 | Not Available | 743 | Open in IMG/M |
| 3300018088|Ga0187771_11590985 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
| 3300018431|Ga0066655_10861857 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300019787|Ga0182031_1170194 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1149 | Open in IMG/M |
| 3300020579|Ga0210407_11298376 | Not Available | 544 | Open in IMG/M |
| 3300020581|Ga0210399_11420493 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
| 3300020582|Ga0210395_11309458 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 530 | Open in IMG/M |
| 3300021170|Ga0210400_11093867 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 645 | Open in IMG/M |
| 3300021178|Ga0210408_10267209 | All Organisms → cellular organisms → Bacteria | 1363 | Open in IMG/M |
| 3300021178|Ga0210408_10625245 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 852 | Open in IMG/M |
| 3300021180|Ga0210396_10750771 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 840 | Open in IMG/M |
| 3300021180|Ga0210396_11476781 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 559 | Open in IMG/M |
| 3300021181|Ga0210388_10296392 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1421 | Open in IMG/M |
| 3300021362|Ga0213882_10387964 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 589 | Open in IMG/M |
| 3300021402|Ga0210385_10045204 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2917 | Open in IMG/M |
| 3300021402|Ga0210385_10975012 | Not Available | 651 | Open in IMG/M |
| 3300021405|Ga0210387_10921350 | Not Available | 768 | Open in IMG/M |
| 3300021432|Ga0210384_10257312 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 1571 | Open in IMG/M |
| 3300021433|Ga0210391_10504510 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 950 | Open in IMG/M |
| 3300021433|Ga0210391_10961780 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 665 | Open in IMG/M |
| 3300021474|Ga0210390_10051354 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3390 | Open in IMG/M |
| 3300021477|Ga0210398_10281657 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1356 | Open in IMG/M |
| 3300021477|Ga0210398_10409618 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1105 | Open in IMG/M |
| 3300021478|Ga0210402_10156725 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2076 | Open in IMG/M |
| 3300021478|Ga0210402_10399178 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 1277 | Open in IMG/M |
| 3300021559|Ga0210409_11375103 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 582 | Open in IMG/M |
| 3300021560|Ga0126371_11927529 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 710 | Open in IMG/M |
| 3300021861|Ga0213853_11554840 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 885 | Open in IMG/M |
| 3300022530|Ga0242658_1211342 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 532 | Open in IMG/M |
| 3300022531|Ga0242660_1051855 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
| 3300022557|Ga0212123_10590400 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 703 | Open in IMG/M |
| 3300022557|Ga0212123_10821980 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 556 | Open in IMG/M |
| 3300022717|Ga0242661_1016334 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1147 | Open in IMG/M |
| 3300022726|Ga0242654_10213107 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300024227|Ga0228598_1002591 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3929 | Open in IMG/M |
| 3300025928|Ga0207700_10556458 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1018 | Open in IMG/M |
| 3300027063|Ga0207762_1060182 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 551 | Open in IMG/M |
| 3300027370|Ga0209010_1008215 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1986 | Open in IMG/M |
| 3300027559|Ga0209222_1013831 | All Organisms → cellular organisms → Bacteria | 1613 | Open in IMG/M |
| 3300027590|Ga0209116_1126351 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 560 | Open in IMG/M |
| 3300027701|Ga0209447_10024800 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1677 | Open in IMG/M |
| 3300027729|Ga0209248_10079880 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 992 | Open in IMG/M |
| 3300027768|Ga0209772_10045471 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1300 | Open in IMG/M |
| 3300027853|Ga0209274_10541859 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300027879|Ga0209169_10477305 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 655 | Open in IMG/M |
| 3300027884|Ga0209275_10515264 | Not Available | 683 | Open in IMG/M |
| 3300027898|Ga0209067_10002880 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 10067 | Open in IMG/M |
| 3300027898|Ga0209067_10103563 | All Organisms → cellular organisms → Bacteria | 1482 | Open in IMG/M |
| 3300027911|Ga0209698_10162923 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1823 | Open in IMG/M |
| 3300027911|Ga0209698_11110998 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300027986|Ga0209168_10425457 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 645 | Open in IMG/M |
| 3300028746|Ga0302233_10213375 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 736 | Open in IMG/M |
| 3300028747|Ga0302219_10415261 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300028906|Ga0308309_10058840 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2810 | Open in IMG/M |
| 3300029920|Ga0302142_1012217 | Not Available | 2813 | Open in IMG/M |
| 3300029951|Ga0311371_12413621 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
| 3300029956|Ga0302150_10142558 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 914 | Open in IMG/M |
| 3300029987|Ga0311334_10235553 | All Organisms → cellular organisms → Bacteria | 1412 | Open in IMG/M |
| 3300030007|Ga0311338_10259815 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1946 | Open in IMG/M |
| 3300030045|Ga0302282_1180572 | Not Available | 809 | Open in IMG/M |
| 3300030056|Ga0302181_10435634 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 560 | Open in IMG/M |
| 3300030294|Ga0311349_11627816 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 598 | Open in IMG/M |
| 3300030506|Ga0302194_10206071 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 807 | Open in IMG/M |
| 3300030520|Ga0311372_12635163 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 559 | Open in IMG/M |
| 3300030737|Ga0302310_10551823 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300030838|Ga0311335_10512045 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
| 3300030940|Ga0265740_1026960 | Not Available | 621 | Open in IMG/M |
| 3300030946|Ga0075379_10866170 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 642 | Open in IMG/M |
| 3300031010|Ga0265771_1025664 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300031028|Ga0302180_10245008 | Not Available | 944 | Open in IMG/M |
| 3300031057|Ga0170834_101968954 | Not Available | 837 | Open in IMG/M |
| 3300031090|Ga0265760_10002294 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5585 | Open in IMG/M |
| 3300031090|Ga0265760_10152271 | Not Available | 759 | Open in IMG/M |
| 3300031128|Ga0170823_16920580 | Not Available | 879 | Open in IMG/M |
| 3300031241|Ga0265325_10021186 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3576 | Open in IMG/M |
| 3300031573|Ga0310915_10776797 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 674 | Open in IMG/M |
| 3300031640|Ga0318555_10565625 | Not Available | 616 | Open in IMG/M |
| 3300031679|Ga0318561_10840210 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300031708|Ga0310686_111151055 | Not Available | 679 | Open in IMG/M |
| 3300031718|Ga0307474_10514770 | Not Available | 939 | Open in IMG/M |
| 3300031719|Ga0306917_10626420 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 846 | Open in IMG/M |
| 3300031719|Ga0306917_11157828 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 601 | Open in IMG/M |
| 3300031720|Ga0307469_12076462 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 552 | Open in IMG/M |
| 3300031748|Ga0318492_10335741 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 790 | Open in IMG/M |
| 3300031753|Ga0307477_10019483 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4639 | Open in IMG/M |
| 3300031754|Ga0307475_11493666 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
| 3300031890|Ga0306925_11743707 | Not Available | 599 | Open in IMG/M |
| 3300031902|Ga0302322_102070178 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300031942|Ga0310916_10845012 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 769 | Open in IMG/M |
| 3300031946|Ga0310910_10128601 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1916 | Open in IMG/M |
| 3300031947|Ga0310909_10150382 | All Organisms → cellular organisms → Bacteria | 1914 | Open in IMG/M |
| 3300031962|Ga0307479_10609290 | Not Available | 1074 | Open in IMG/M |
| 3300032076|Ga0306924_10753790 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1089 | Open in IMG/M |
| 3300032160|Ga0311301_11370892 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 885 | Open in IMG/M |
| 3300032174|Ga0307470_10603155 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 821 | Open in IMG/M |
| 3300032515|Ga0348332_12625472 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3735 | Open in IMG/M |
| 3300032783|Ga0335079_10238490 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2004 | Open in IMG/M |
| 3300032783|Ga0335079_12334695 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 507 | Open in IMG/M |
| 3300032828|Ga0335080_12410780 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
| 3300032829|Ga0335070_10093428 | All Organisms → cellular organisms → Bacteria | 3166 | Open in IMG/M |
| 3300032829|Ga0335070_11093616 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300032896|Ga0335075_11209041 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300033433|Ga0326726_10806288 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 909 | Open in IMG/M |
| 3300034125|Ga0370484_0004527 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2742 | Open in IMG/M |
| 3300034163|Ga0370515_0429615 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
| 3300034199|Ga0370514_054224 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1009 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 18.33% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 6.67% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 6.11% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 5.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.00% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 4.44% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.44% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.44% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.89% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.78% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.78% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.78% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 2.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.22% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.22% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.67% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.67% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.67% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.11% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.11% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.11% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.11% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.11% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.11% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.11% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.11% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.11% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.56% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.56% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.56% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.56% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.56% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.56% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.56% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.56% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.56% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.56% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.56% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.56% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.56% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.56% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300001404 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 deep-072012 | Environmental | Open in IMG/M |
| 3300001413 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 shallow-072012 | Environmental | Open in IMG/M |
| 3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300009638 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10 | Environmental | Open in IMG/M |
| 3300009644 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 | Environmental | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018013 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100 | Environmental | Open in IMG/M |
| 3300018019 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300019787 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021362 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09 | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022530 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022717 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027063 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 37 (SPAdes) | Environmental | Open in IMG/M |
| 3300027370 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027559 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027590 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027701 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028746 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300028747 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029920 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_3 | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300029956 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_2 | Environmental | Open in IMG/M |
| 3300029987 | I_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030045 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_3 | Environmental | Open in IMG/M |
| 3300030056 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300030294 | II_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300030506 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_1 | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030737 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300030838 | I_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300030940 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030946 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA7 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031010 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Host-Associated | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300034125 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15 | Environmental | Open in IMG/M |
| 3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
| 3300034199 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_01D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12269J14319_101865431 | 3300001356 | Peatlands Soil | KWHYMSETRLKDGSVLLAGGYPNSDQTTSQTWIYRP* |
| JGI20181J14860_10008615 | 3300001404 | Arctic Peat Soil | SDARHFMTATLLSDGRVLLAGGYAYSPEATAETWIYRR* |
| JGI20180J14839_10007011 | 3300001413 | Arctic Peat Soil | AMSDARHFMXATLLSDGRVLLAGGYAYSPEATAETWIYRR* |
| JGI12712J15308_101762772 | 3300001471 | Forest Soil | MSDAWHYTSETKLKDGRVLLAGGYPNSDQATAQTWIFHP* |
| JGI12635J15846_102610562 | 3300001593 | Forest Soil | LPDARHYMSETRLADGSVLLAGGYPNNDQATGAAWVYRP* |
| JGI12627J18819_103159762 | 3300001867 | Forest Soil | GELSENWHFMSETRLRDGRVLMAGGYANDDKATAQTWVYVP* |
| Ga0062385_111239752 | 3300004080 | Bog Forest Soil | EIYDPATGTFLPVSGELNEAWHYMSETSLKDGKVLLAGGYPNNDQATTQTWIYRP* |
| Ga0062384_1002270341 | 3300004082 | Bog Forest Soil | GQMHDARHYLSETKLRDGSVLLAGGYPNSDQSTAETWLYRPQ* |
| Ga0062384_1005720142 | 3300004082 | Bog Forest Soil | MNDAHHYMSETKLKDGNVLLAGGYPDYDQSTAETWIYRP* |
| Ga0062387_1001829732 | 3300004091 | Bog Forest Soil | LIVAGQMHDARHYLSETKLRDGSVLLAGGYPNSDQSTAETWLYRPQSPWN* |
| Ga0062389_1008232611 | 3300004092 | Bog Forest Soil | LIVAGQMHDARHYLSETKLRDGSVLLAGGYPNSDQSTAETWLYRPQ* |
| Ga0066388_1006342531 | 3300005332 | Tropical Forest Soil | ISAPWHFMTETRLSDGSVLFAGGYANNDQATAQTWIYKP* |
| Ga0070713_1002681553 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MNDKWHYMTETKLRDGSVLLAGGYANNDQGTAQTWIYRP* |
| Ga0070684_1017929491 | 3300005535 | Corn Rhizosphere | SRQAEIYIPESGTFKTVPGTMSENWHYMSETLLKDGSVLLAGGYPNSDRATGETWIYRP* |
| Ga0070733_100886121 | 3300005541 | Surface Soil | GQMSDAWHYMSETKLKDGSVLLAGGYPNSDRATQEVWIYRP* |
| Ga0068855_1024887761 | 3300005563 | Corn Rhizosphere | GQLSNDWHYMSETRLNDGTVLLAGGYPNNDRATAETWIFKP* |
| Ga0066694_101453851 | 3300005574 | Soil | CPRPLSEPWHFMTETGLKDGSVLLAGGYANDDQGTRQTWIYTSGF* |
| Ga0066702_105955552 | 3300005575 | Soil | RHFMTETKLKDGSVLLAGGYPDNDQATAQTWVYKP* |
| Ga0070762_104897231 | 3300005602 | Soil | GRFLAVSGQMNDKWHYMSETKLRDGSVLLAGGYPNNDQATAQAWIYRP* |
| Ga0070763_107290341 | 3300005610 | Soil | EIDDARHYMSETRLRDGRVLLAGGYANNDQATAQTWMYVP* |
| Ga0068856_1005044363 | 3300005614 | Corn Rhizosphere | PWHFMTETRLKDGSVLLAGGYPNSDRATAQTWVFRP* |
| Ga0070766_104439941 | 3300005921 | Soil | FLAVSGQMNDKWHYMSETKLRDGSVLLAGGYPNNDQATAQAWIYRP* |
| Ga0075029_1007778341 | 3300006052 | Watersheds | RHFMTETRLKDGSVLLAGGYPNSDQATGQTWIYRP* |
| Ga0075017_1004399422 | 3300006059 | Watersheds | DSWHFMTETKLMDGGVLLAGGYANDDRATAQTWIYKPQ* |
| Ga0075030_1000258598 | 3300006162 | Watersheds | LMNDKWHYMTETKLRDGSVLLAGGYADNDRATAQTWIYRP* |
| Ga0075030_1000285481 | 3300006162 | Watersheds | ASGQMNGKWYFMSETRLKDGRVLLAGGYPNSDQATAQTWIYRP* |
| Ga0075030_1009301961 | 3300006162 | Watersheds | MYDARHFMTETRLKDGSVLLAGGYPNSDQATGQTWIYRP* |
| Ga0075014_1004929902 | 3300006174 | Watersheds | SGQMNDAWHFMSETQLKDGTVLLAGGYPNNDQGTAQTWIYRP* |
| Ga0075014_1008903051 | 3300006174 | Watersheds | VFDAVSGKFLVAAGQMHDAWHYTSETRLKDGSVLLAGGYPDNDQATAQTWTYRP* |
| Ga0070765_1003609303 | 3300006176 | Soil | KVEIFDPQSGKFLVVAGEMSDAWHYTSETKLKDGRVLLAGGYPNSDQATAQTWIFHP* |
| Ga0073928_101535694 | 3300006893 | Iron-Sulfur Acid Spring | PHYMSETLLKDGSVLLAGGYYNDDQASKMTWIYRP* |
| Ga0116113_10108741 | 3300009638 | Peatland | ATGKFDVASGQMNDKWHFMSETKLRDGSVLLAGGYPNNDQATAQTWIYRP* |
| Ga0116121_10139293 | 3300009644 | Peatland | VEIFDPASGKFLVAAGQIDDARHFMTETKLRDGSVLLAGGYPDDDQATSAAWIYKP* |
| Ga0116215_11073941 | 3300009672 | Peatlands Soil | DERHFMTETKLRDGSVLLAGGYPNNDQATAQTWIYRP* |
| Ga0116219_100838074 | 3300009824 | Peatlands Soil | FDPASGRFLAATGQMSDRWHYLTETKLRDGSVLMAGGYANNDQATAEAWIYRP* |
| Ga0074046_102378174 | 3300010339 | Bog Forest Soil | DAWHFMTETRLKDGRVLLTGGYPNNDRATAETWIYRP* |
| Ga0126378_104480583 | 3300010361 | Tropical Forest Soil | ADARHYMSETKLSDGRVLLTGGYPNNDQATAQSWIYEP* |
| Ga0126379_125597961 | 3300010366 | Tropical Forest Soil | FQVASGQISNDCHYMSETRLNDGSVLLAGGYPNNDRATAETWIFKP* |
| Ga0126381_1008057421 | 3300010376 | Tropical Forest Soil | IYDARTGKFAVVSGQLSGPWHFMTETRLKNGTVLLAGGYPDNDKATSETWIYIP* |
| Ga0126381_1010087871 | 3300010376 | Tropical Forest Soil | KETEIFDPASGRFVAVAGQMNEKWHYMSETKLRDGSVLLAGGYANNDEGTAQTWTYHP* |
| Ga0136449_1019302401 | 3300010379 | Peatlands Soil | SGKFLLAAGQMNDERHFMTETKLRDGSVLLAGGYPNNDQATAQTWIYRP* |
| Ga0134124_109454952 | 3300010397 | Terrestrial Soil | YRPESGTFKTVAGIISNNWHYMSETLLKDGSVLLAGGYPNNDRATSETWIYRP* |
| Ga0126361_108096882 | 3300010876 | Boreal Forest Soil | MVAAGQMNEPWHFMTETKLRDGSVLLAGGYPNGPHATTKTWIYRP* |
| Ga0150983_105131251 | 3300011120 | Forest Soil | DKWHYLSETKLRDGSVLLAGGYPNSDQATAQAWIYRP* |
| Ga0150983_155670651 | 3300011120 | Forest Soil | QMNDAWHYMTETRLNDGRVLLAGGYPNNDQATSQTWIYRP* |
| Ga0150983_156180162 | 3300011120 | Forest Soil | PWHFMTETKLADGTILLAGGYANNDQATAQTWIYKPE* |
| Ga0137362_111150951 | 3300012205 | Vadose Zone Soil | VEVFDPVSGKFLVATGQISDKWHYMTETKLRDGSVLLAGGYPNSDQATTQTWIYRP* |
| Ga0137413_104846122 | 3300012924 | Vadose Zone Soil | GQLSEPWHFMTETRLRDGSVLLAGGYPNNPEATARTWIYRP* |
| Ga0182024_111913261 | 3300014501 | Permafrost | DSRHFMSETRLRDGSVLLAGGYPNNDQATAQTWIYRP* |
| Ga0132256_1010688112 | 3300015372 | Arabidopsis Rhizosphere | AEGQMNDAWHYLTETRLKDGRVLLAGGYANSDRATAQTWIYKP* |
| Ga0187802_100729051 | 3300017822 | Freshwater Sediment | TRHYMSETGLSDGRVLLAGGYPNNDQATAQAWLYKP |
| Ga0187818_100113571 | 3300017823 | Freshwater Sediment | DPASGKFLVAAGEMADARHYMSETRLKDGSVLVAGGYPNSDQATTQAWIYKP |
| Ga0187825_103089301 | 3300017930 | Freshwater Sediment | MNDAWHFMSETELRDGRVLLAGGYPDDDQTTAQTWIFRP |
| Ga0187809_101054351 | 3300017937 | Freshwater Sediment | KFLVARGLMSDSWHFMTETKLRDGSVLLAGGYPNNDQATAQTWIYKP |
| Ga0187853_103075911 | 3300017940 | Peatland | VEIFDPASGKFLVAAGQIDDARHFMTETKLRDGSVLLAGGYPDDDQATSAAWIYKP |
| Ga0187879_102857383 | 3300017946 | Peatland | PGTGRFALVSGQMNDSWHFMSETRLRDGSVLLAGGYPNNDQATAQTWLFQP |
| Ga0187817_100002637 | 3300017955 | Freshwater Sediment | MELYDPTTGEFLLVPGQMDDDWHFMTETKLKDGSVLLAGGYPNNDQATAQTWIYRP |
| Ga0187817_104183552 | 3300017955 | Freshwater Sediment | FDPASGKFAVASGQMSDARHYMTETRLGDGSVLLAGGYPNNDRATAQTWIYRP |
| Ga0187817_105170061 | 3300017955 | Freshwater Sediment | PKSGKFVVASGQMNDAWHFMSETQLKDGTVLLAGGYPNSDQCTAQTWIYRP |
| Ga0187817_107223551 | 3300017955 | Freshwater Sediment | DERHFVTETKLRDGSVLLAGGYPNNDQATAQTWIYRP |
| Ga0187817_110327051 | 3300017955 | Freshwater Sediment | DPETGKFLVASGQMNDARHFMTETKLQDGSVLLAGGYPDNPEATAQTWIYRPESVVSSR |
| Ga0187783_113148432 | 3300017970 | Tropical Peatland | GQLDQAWHFMSETKLGDGSVLLAGGYPNSDQGTAQAWIYRH |
| Ga0187873_13452251 | 3300018013 | Peatland | SGKFIPVAGEMSDKWHYLSETKLRDGSVLLAGGYPNSDQATSQAWIYLP |
| Ga0187874_103681612 | 3300018019 | Peatland | ASGKFIPVAGEMSDKWYYLSETKLRDGSVLLAGGYPNSDQATSQAWIYLP |
| Ga0187863_104375742 | 3300018034 | Peatland | SRDVEVFDSTSGRFRIATGQMRDSRHFMSETKLRDGSVLLTGGYPNDDAATAETWIFRQ |
| Ga0187883_105796242 | 3300018037 | Peatland | FDPGTGRFALVSGQMNDSWHFMSETRLRDGSVLLAGGYPNNDQATAQTWLFQP |
| Ga0187871_100119794 | 3300018042 | Peatland | MNDKWHYLSETKLRDGSVPLAGGYANNDQATAQAWIYRP |
| Ga0187871_104202591 | 3300018042 | Peatland | LVAAGEMNDARHFMSETRLKDGSVLLAGGYPNNDQATARAWIYRP |
| Ga0187871_107752782 | 3300018042 | Peatland | DPVRGKFLVAAGEMNDARHFMSETRLMDGRVLLAGGYPNSDQATAQAWIYKP |
| Ga0187890_103173581 | 3300018044 | Peatland | IYDPALGKFFTVSGQLNDSWHYMTETELRDGSVLLAGGYPDGDQPTAQTWIYHP |
| Ga0187890_104642562 | 3300018044 | Peatland | GQMRDIRHFMSETKLRDGSVLLAGGYPNNDLATTETWVLRP |
| Ga0187859_103802251 | 3300018047 | Peatland | GGQMRDIRHFMTETKLRDGSVLLAGGYPNNDLATAETWLFRP |
| Ga0187769_114483411 | 3300018086 | Tropical Peatland | EMNDARHFMSETKLKDGSVLLAGGYADNDQATAETWIYRPDSR |
| Ga0187771_109170612 | 3300018088 | Tropical Peatland | ARFLVAVGEIADARHFMTETKLRDGRVLLAGGYPDNDQATSQAWIYTP |
| Ga0187771_115909851 | 3300018088 | Tropical Peatland | VEVFDPATAKFLVVEGQLDQAWHFMSETKLQDGSVFLAGGYPNGDQATAQAWIYRP |
| Ga0066655_108618571 | 3300018431 | Grasslands Soil | EKFFVVTGQLDDTWHFMSETRLKDGSVLLAGGYPNNDSATRHTWIYRP |
| Ga0182031_11701941 | 3300019787 | Bog | CTTSAKRHFMTETKLKDGSVLLAGGYPDNDAGTAETWLFRP |
| Ga0210407_112983761 | 3300020579 | Soil | EIFDPVGGKFVAVAGQMNDRWHYMSETKLHDGSVLLAGGYPDGDQATGQTWIYRP |
| Ga0210399_114204932 | 3300020581 | Soil | QMNDKWHYMTETKLRDGSVLLAGGYPNSDQATAQAWIYRP |
| Ga0210395_113094582 | 3300020582 | Soil | PWHFMSETKLRDGRVLLAGGYPNNPDATSQTWIYHP |
| Ga0210400_110938672 | 3300021170 | Soil | FLAVSGQMNDKWHYMSETKLRDGSVLLAGGYPNNDQATAQAWIFRP |
| Ga0210408_102672091 | 3300021178 | Soil | MSETRLKDGKVLLTGGFPNNDQATTQEWIYRPKRGCAR |
| Ga0210408_106252451 | 3300021178 | Soil | TFAVAGGQMSDRWHYMSETKLGDGSVLLAGGYANSDQATPQTWIYRP |
| Ga0210396_107507711 | 3300021180 | Soil | VAGQMNQRWHYMSETGLRDGSVLMAGGYANDDLGTAQTWIYRP |
| Ga0210396_114767812 | 3300021180 | Soil | DPASGKFIPVAGEMSDKWHYLSETKLRDGSVLLAGGYPNSDQATSQAWIYYP |
| Ga0210388_102963921 | 3300021181 | Soil | GRFSVAGGELSAPWHYMSETRLRDGRVLLAGGYANNDQATAQTWMYVP |
| Ga0213882_103879642 | 3300021362 | Exposed Rock | DGDLSDAWHYMSETRLRDGRVLLAGGYANNDRATAQAWMYVP |
| Ga0210385_100452041 | 3300021402 | Soil | SWHFMSETRLNDGSVLLAGGYANNDKATADAWIYRP |
| Ga0210385_109750121 | 3300021402 | Soil | KWHYLSETKLRDGRVLLAGGYPNSDEATAQAWIYRP |
| Ga0210387_109213501 | 3300021405 | Soil | PASGQISDVWHFMSETRLKDGRVLLAGGYANNDKATAEAWVYRP |
| Ga0210384_102573121 | 3300021432 | Soil | QMNQKWHYMSETGLRDGSVLMAGGYANDDLGTAQTWIYRP |
| Ga0210391_105045101 | 3300021433 | Soil | GKFAVVPGQMNDRWHYISETRLRDGSVLLAGGYPNSDQTTAATWIYRP |
| Ga0210391_109617802 | 3300021433 | Soil | LVVAGQMNDSRHFMSETRLRDGSVLLAGGYPNNDQATAQTWIYRP |
| Ga0210390_100513546 | 3300021474 | Soil | GKFLVAAGEMNDARHFMSETRLKDGSVLLAGGYPNNDQATAQAWIYRP |
| Ga0210398_102816571 | 3300021477 | Soil | MVVAGQMNDSRHFMSETRLRDGSVLLAGGYPNNDQATAQTWIYRP |
| Ga0210398_104096182 | 3300021477 | Soil | AGQMNDRWHFLSETKLRDGRVLLAGGYPDGDQTTNQTWIYRP |
| Ga0210402_101567253 | 3300021478 | Soil | TGNFLVAAGQMADARHYMSETKLKDGSVLLAGGYPNNDQATSQAWIYKP |
| Ga0210402_103991781 | 3300021478 | Soil | VAGQMNQKWHYMSETGLRDGSVLMAGGYANDDLGTAQTWIYRP |
| Ga0210409_113751032 | 3300021559 | Soil | RWHYMSETKLRDGTVLLAGGYPNSDQATGQTWIYRP |
| Ga0126371_119275292 | 3300021560 | Tropical Forest Soil | DPSLRKFVVVDGQMNDSRHFMSETKLTDGSVLLAGGYANNDQATENTWIYRP |
| Ga0213853_115548401 | 3300021861 | Watersheds | LQVVGQMNDARHFMTETKLNDGSVLLVGGYPNNDQATAQAWIYQP |
| Ga0242658_12113422 | 3300022530 | Soil | GKFLVVPGQMNDKWHYMSETKLRDGSVLLAGGYPNNDQATPQAWIYRP |
| Ga0242660_10518552 | 3300022531 | Soil | KTVEVFDPAASRFAVASGEISGPWHFMTETRLGDGRVLLAGGYANNDQATAQTWIYTPR |
| Ga0212123_105904002 | 3300022557 | Iron-Sulfur Acid Spring | AWHFMSETKLQDGSVLLAGGYPNGPGATAQAWIYHP |
| Ga0212123_108219801 | 3300022557 | Iron-Sulfur Acid Spring | PHYMSETLLKDGSVLLAGGYYNDDQASKMTWIYRP |
| Ga0242661_10163342 | 3300022717 | Soil | VFDPATSRFAVASGEISAPWHFMTETKLADGTILLAGGYANNDQATAQTWIYKPE |
| Ga0242654_102131072 | 3300022726 | Soil | AGGSKTVEVFDPAASRFSAASGELSGPWHFMTETRLGDGRVLLAGGYANNDQATAQTWIYTPR |
| Ga0228598_10025912 | 3300024227 | Rhizosphere | MNDLRHFMSETKLQDGNVLLAGGYPNSDLATVETWMFRP |
| Ga0207700_105564581 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | GRFLVAQGQISDAWHFMTETRLKDGRVLLAGGYPNSDQATAEAWLYKP |
| Ga0207762_10601821 | 3300027063 | Tropical Forest Soil | KFQVASGQMDESWHYLSETRLRDGRVLLAGGYPDGDACTSKTWIYHP |
| Ga0209010_10082151 | 3300027370 | Forest Soil | AGGELNDAWHYMSETRLRDGRVLLAGGYANNDQATAQTWMYVP |
| Ga0209222_10138311 | 3300027559 | Forest Soil | VVPGQMNDRWHYISETRLRDGSVLLAGGYPNSDQTTAATWIYRP |
| Ga0209116_11263511 | 3300027590 | Forest Soil | NEPWHYVSETRLRDGRVLLAGGYPNGDQTTAQTWIYRP |
| Ga0209447_100248003 | 3300027701 | Bog Forest Soil | LYDPASGRFLIVAGQMRDARHYLSETKLRDGSVLLAGGYPNNDQATAETWIYRPQ |
| Ga0209248_100798802 | 3300027729 | Bog Forest Soil | MDDKWHYMSETKLRDGSVLLAGGYPDNDQATAQAWIYRP |
| Ga0209772_100454711 | 3300027768 | Bog Forest Soil | GQMHDARHYLSETKLRDGSVLLAGGYPNSDQSTAETWLYRPQ |
| Ga0209274_105418592 | 3300027853 | Soil | MHDLRHFMSETKLNDGSVLLAGGYPNSDLATAEAWMFRP |
| Ga0209169_104773051 | 3300027879 | Soil | MNDGRHFMSETRLKDGSVLLAGGYPNNDQATAQAWIYRP |
| Ga0209275_105152642 | 3300027884 | Soil | PVSGKFFVVSGEMNDKWHYLSETKLRDGRVLLAGGYPNSDQATAQTWIYRP |
| Ga0209067_100028801 | 3300027898 | Watersheds | LMNDARHFMTETRLKDGSVLLTGGYPNNDQATAQAWIYRP |
| Ga0209067_101035633 | 3300027898 | Watersheds | GLMNDKWHYMTETKLRDGSVLLAGGYADSDQATAQTWIYRP |
| Ga0209698_101629234 | 3300027911 | Watersheds | GLRNDKWHYMTETKLRDGSVLLAGGYADSDQATAQTWIYRP |
| Ga0209698_111109981 | 3300027911 | Watersheds | GDMGDARHFMTETLLNDGRVLLAGGYAYTPEATAQTWIYRP |
| Ga0209168_104254572 | 3300027986 | Surface Soil | IVAGQMNQKWHYMSETGLRDGSVLMAGGYANDDLGTAQTWIYRP |
| Ga0302233_102133752 | 3300028746 | Palsa | GQMTDARHFMTETKLNDGTVLLAGGYPNNDQGTSNTWIYHP |
| Ga0302219_104152611 | 3300028747 | Palsa | FDPATGKFLVVPGQMDDKWHYITETRLRDGSVLLAGGYPENDHTTAQTWIHKP |
| Ga0308309_100588404 | 3300028906 | Soil | GSKTLEVFDPASGRFLAVNDQLPDARHYMSETRLADGSVLLAGGYPNNDQATGAAWVYRP |
| Ga0302142_10122175 | 3300029920 | Bog | REVEIFDPSSGRFKIAAGQMHDQRHFMTETKLKDGSVLLAGGYPDNDAGTAETWLFRP |
| Ga0311371_124136211 | 3300029951 | Palsa | PASGKFAVVPGQMNDKWHYMSETKLGDGSVLLAGGYPNSDQTTAATWIYRP |
| Ga0302150_101425582 | 3300029956 | Bog | MNDKWHYMSETKLRDGSVLLAGGYPNNDQATAQTWIYRP |
| Ga0311334_102355531 | 3300029987 | Fen | MSDARHFMSETLLSDGRVLLAGGYAYSPEATAETWIYRP |
| Ga0311338_102598154 | 3300030007 | Palsa | MNDKWHYMSETKLGDGSVLLAGGYPNSDQTTAATWIYRP |
| Ga0302282_11805722 | 3300030045 | Fen | TGKFDVASGQMNDKWHFMSETKLRDGSVLLAGGYPNNDQATAQTWIYRP |
| Ga0302181_104356341 | 3300030056 | Palsa | TDARHFMTETKLNDGTVLLAGGYPNNDQGTSNTWIYHP |
| Ga0311349_116278162 | 3300030294 | Fen | KEVEVFDPASGKFLVAGGQMVDARHYMSETKLQDGTVLLAGGYPNNDQATSQVWLYKP |
| Ga0302194_102060711 | 3300030506 | Bog | ASGEMNDKWHYMSETKLRDGSVLLAGGYPNNDQATAQTWIYRP |
| Ga0311372_126351631 | 3300030520 | Palsa | HADESHYLSEPRLRDGSVLAGGYPSSDQTTANLWIYRP |
| Ga0302310_105518232 | 3300030737 | Palsa | GKFLVVPGQMDDKWHYITETRLRDGSVLLAGGYPENDHTTAQTWIYKP |
| Ga0311335_105120452 | 3300030838 | Fen | PGAMSDARHFMSETLLSDGRVLLAGGYAYSPEATAETWIYRP |
| Ga0265740_10269602 | 3300030940 | Soil | WHYLSETKLRDGRVLLAGGYPNSDQATAQTWIYRP |
| Ga0075379_108661702 | 3300030946 | Soil | GQLNEAWHFMTETKLRDGSVLLAGGYPDGPEATAQTWIYRP |
| Ga0265771_10256642 | 3300031010 | Soil | LASGQLSNAWHFMSETRLKDGRILLAGGYPDDDHATAEAWIYKPSS |
| Ga0302180_102450081 | 3300031028 | Palsa | LVVPGQMDDKWHYITETRLRDGSVLLAGGYPENDHTTAQTWIHKP |
| Ga0170834_1019689542 | 3300031057 | Forest Soil | DSRHFMTETLLSDGRVLLAGGYAYSPDATAQTWIYRP |
| Ga0265760_100022947 | 3300031090 | Soil | FLAVSGQMNDKWHYMSETKLRDGSVLLAGGYPNNDQATAQAWIYRP |
| Ga0265760_101522712 | 3300031090 | Soil | GTFLVVAGQLNDARHYMTETKLKDGSVLLTGGYPDNDQATAETWIYHP |
| Ga0170823_169205801 | 3300031128 | Forest Soil | GKFAVASGQLNEAWHFMTETKLRDGSVLLAGGYPDGPEATAQTWIYRP |
| Ga0265325_100211861 | 3300031241 | Rhizosphere | TGQMDERWHYMSETRLRDGSVLLAGGYPNNDQATAQTWTYRP |
| Ga0310915_107767971 | 3300031573 | Soil | SGEMNDSWHFMTETRLKDGSVLLAGGYANNDRGTAQAWVYRP |
| Ga0318555_105656251 | 3300031640 | Soil | AVGRMDAPWHFESATALADGGVLLAGGYANDDRATTHTWIYRP |
| Ga0318561_108402102 | 3300031679 | Soil | GDARHYMSETLLRDGRVLLAGGYAFTPEATAQTWIYKP |
| Ga0310686_1111510551 | 3300031708 | Soil | NEPWHFMSETKLRDGRVLLAGGYPNDDQATAQAWIYRP |
| Ga0307474_105147701 | 3300031718 | Hardwood Forest Soil | ASGKFLVAAGRMNDKWHYLSETQLHDGSVLLAGGYPNSDQATALTWIYRP |
| Ga0306917_106264201 | 3300031719 | Soil | DLLIAGGSRQVEIFEPSTSKFHSVSGQMPEARHFMTETRLADGSVLLAGGYPNDDKATAQTWLYQP |
| Ga0306917_111578281 | 3300031719 | Soil | ELFDPAHAKFIEATGEISGPWHFMTETRLKDGSVLLAGGYANNDRATAQTWIYKP |
| Ga0307469_120764621 | 3300031720 | Hardwood Forest Soil | FARASGDISGPWHFMTETKLKDGSVLLAGGYANDDRATAQTWIYKPQ |
| Ga0318492_103357411 | 3300031748 | Soil | GEMGDARHFMSETLLGDGRVLLAGGYAFTPEATARTWIYRP |
| Ga0307477_100194831 | 3300031753 | Hardwood Forest Soil | GEISGPWHFMTETKLADGTILLAGGYANNDQATAQTWIYKPE |
| Ga0307475_114936662 | 3300031754 | Hardwood Forest Soil | LVAAGQMSDPWHFMTETKLRDGSVLLAGGYPNGPAATTKTWIYRP |
| Ga0306925_117437071 | 3300031890 | Soil | APWHFESATALADGGVLLAGGYANDDRATTHTWIYRP |
| Ga0302322_1020701781 | 3300031902 | Fen | MSDARHFMSETLLSDGRVLLAGGYAYGPEATAETWIYRP |
| Ga0310916_108450122 | 3300031942 | Soil | TSKFHSVSGQMPEARHFMTETRLADGSVLLAGGYPNDDKATAQTWLYQP |
| Ga0310910_101286011 | 3300031946 | Soil | TGEISGPWHFMTETRLKDGSVLLAGGYANNDRATAQTWIYKP |
| Ga0310909_101503824 | 3300031947 | Soil | RHYMSETLLRDGRVLLAGGYAFTPEATAQTWIYKP |
| Ga0307479_106092902 | 3300031962 | Hardwood Forest Soil | VFDPASGKFLLAAGQLSQPWHFMTETKLRDGSVFLAGGYPNNPEATAQTWLYRP |
| Ga0306924_107537902 | 3300032076 | Soil | VASGEMNDSWHFMTETRLKDGSVLLAGGYANNDRGTAQAWVYRP |
| Ga0311301_113708921 | 3300032160 | Peatlands Soil | ASGKFLLAAGQMNDERHFMTETKLRDGSVLLAGGYPNNDQATPQTWIYRP |
| Ga0307470_106031552 | 3300032174 | Hardwood Forest Soil | EVFDCARGEFLVAIGQLSGPWHFMTETKLRDGSVLLAGGYPDNPGATAQTWVYRP |
| Ga0348332_126254725 | 3300032515 | Plant Litter | GRFKVVPGQMNDLRHFMSETKLQDGNVLLAGGYPNSDLATVETWMFRP |
| Ga0335079_102384901 | 3300032783 | Soil | DPESGKFLPVPGQMNDKWHYMTETKLRDGSVLLAGGYADNDRGTAQTWIYRP |
| Ga0335079_123346951 | 3300032783 | Soil | VASGQLDDRWHFMTETRLKDGRALLTGGYPNNDHCTSETWIYRP |
| Ga0335080_124107802 | 3300032828 | Soil | MDKPWHFMTETRLADGEVLLAGGYANDPEATAQTWIYR |
| Ga0335070_100934284 | 3300032829 | Soil | GKFAIAAGELDGPWHFMTETRLKDGRVLLAGGYPNSDRATAQTWIYHP |
| Ga0335070_110936162 | 3300032829 | Soil | AAGELNGAWHYMSETSLKDGSVLLAGGYPNNDQATAQTWIFRP |
| Ga0335075_112090411 | 3300032896 | Soil | SDAWHYMSETRLKDGRVLLAGGYPNSDQTTAQAWIYRP |
| Ga0335071_107677812 | 3300032897 | Soil | VEIFQPETGRFLAVPGRLSNAWHFMSETRLKNGQVLLAGGYPNNDQATNEAWLYHP |
| Ga0326726_108062881 | 3300033433 | Peat Soil | WHFMSETRLKDGSILLAGGYANDDRATAQTWMYKP |
| Ga0370484_0004527_2_166 | 3300034125 | Untreated Peat Soil | VFDPSVGKFEIAAGQMNDRWHFMSETRLRDGSVLLAGGYPNNPEATSQTWIYRP |
| Ga0370515_0429615_430_549 | 3300034163 | Untreated Peat Soil | MNDKWHFMSETKLRDGSVLLAGGYPNNDQATAQTWIYRP |
| Ga0370514_054224_1_159 | 3300034199 | Untreated Peat Soil | DSATGKFSVASGEMNDKWHFMSETKLRDGSVLLAGGYPNSDQATAQTWIYRP |
| ⦗Top⦘ |