NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F032345

Metagenome / Metatranscriptome Family F032345

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F032345
Family Type Metagenome / Metatranscriptome
Number of Sequences 180
Average Sequence Length 46 residues
Representative Sequence MTEQATTLTSAAAARGPLAMEAISVSKDFRIGRGQTLHAVRDVSFN
Number of Associated Samples 159
Number of Associated Scaffolds 180

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 98.33 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 95.00 %
Associated GOLD sequencing projects 154
AlphaFold2 3D model prediction Yes
3D model pTM-score0.39

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (57.778 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(30.556 % of family members)
Environment Ontology (ENVO) Unclassified
(26.667 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(44.444 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 6.76%    β-sheet: 31.08%    Coil/Unstructured: 62.16%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.39
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 180 Family Scaffolds
PF08352oligo_HPY 96.11
PF00005ABC_tran 1.11
PF00528BPD_transp_1 1.11
PF12911OppC_N 0.56
PF07282OrfB_Zn_ribbon 0.56
PF00232Glyco_hydro_1 0.56

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 180 Family Scaffolds
COG2723Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidaseCarbohydrate transport and metabolism [G] 0.56


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A57.78 %
All OrganismsrootAll Organisms42.22 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300004082|Ga0062384_101017024All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia593Open in IMG/M
3300004157|Ga0062590_101706259All Organisms → cellular organisms → Bacteria642Open in IMG/M
3300005343|Ga0070687_100893080All Organisms → cellular organisms → Bacteria636Open in IMG/M
3300005345|Ga0070692_11254730All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300005436|Ga0070713_101463554Not Available663Open in IMG/M
3300005467|Ga0070706_100236309All Organisms → cellular organisms → Bacteria1706Open in IMG/M
3300005468|Ga0070707_101103129All Organisms → cellular organisms → Bacteria759Open in IMG/M
3300005518|Ga0070699_102066313All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia520Open in IMG/M
3300005535|Ga0070684_102263553All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300005558|Ga0066698_11009824Not Available528Open in IMG/M
3300005576|Ga0066708_10111881All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Cellulomonadaceae → Cellulomonas1636Open in IMG/M
3300005602|Ga0070762_10574871All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales746Open in IMG/M
3300005602|Ga0070762_10981025Not Available579Open in IMG/M
3300005617|Ga0068859_100233789All Organisms → cellular organisms → Bacteria1927Open in IMG/M
3300005921|Ga0070766_10513074All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia798Open in IMG/M
3300006162|Ga0075030_100603528All Organisms → cellular organisms → Bacteria871Open in IMG/M
3300006176|Ga0070765_101125117All Organisms → cellular organisms → Bacteria742Open in IMG/M
3300006354|Ga0075021_10965633All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria555Open in IMG/M
3300006755|Ga0079222_10454557All Organisms → cellular organisms → Bacteria917Open in IMG/M
3300006755|Ga0079222_11442924All Organisms → cellular organisms → Bacteria640Open in IMG/M
3300006804|Ga0079221_11814669All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300009090|Ga0099827_11375904Not Available614Open in IMG/M
3300009176|Ga0105242_12944010Not Available527Open in IMG/M
3300009700|Ga0116217_10207326All Organisms → cellular organisms → Bacteria1286Open in IMG/M
3300010048|Ga0126373_10417236All Organisms → cellular organisms → Bacteria1370Open in IMG/M
3300010048|Ga0126373_12225570Not Available609Open in IMG/M
3300010152|Ga0126318_10403184All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidithrix → Acidithrix ferrooxidans1530Open in IMG/M
3300010322|Ga0134084_10361452Not Available556Open in IMG/M
3300010341|Ga0074045_10133059All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidithrix → Acidithrix ferrooxidans1700Open in IMG/M
3300010373|Ga0134128_13046650Not Available515Open in IMG/M
3300010379|Ga0136449_104360814Not Available522Open in IMG/M
3300010858|Ga0126345_1129121Not Available682Open in IMG/M
3300010867|Ga0126347_1291296Not Available513Open in IMG/M
3300012198|Ga0137364_10092375All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2115Open in IMG/M
3300012209|Ga0137379_11571099Not Available557Open in IMG/M
3300012285|Ga0137370_10340681All Organisms → cellular organisms → Bacteria901Open in IMG/M
3300012360|Ga0137375_10417407All Organisms → cellular organisms → Bacteria1167Open in IMG/M
3300012685|Ga0137397_10966596Not Available628Open in IMG/M
3300012951|Ga0164300_10275777All Organisms → cellular organisms → Bacteria867Open in IMG/M
3300013296|Ga0157374_12819507Not Available514Open in IMG/M
3300014200|Ga0181526_10963281Not Available536Open in IMG/M
3300014493|Ga0182016_10221159All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium hirsutum1207Open in IMG/M
3300014657|Ga0181522_10385332All Organisms → cellular organisms → Bacteria837Open in IMG/M
3300016294|Ga0182041_10443597All Organisms → cellular organisms → Bacteria1114Open in IMG/M
3300016319|Ga0182033_10792437All Organisms → cellular organisms → Bacteria834Open in IMG/M
3300016357|Ga0182032_11696900Not Available551Open in IMG/M
3300016357|Ga0182032_11820014Not Available532Open in IMG/M
3300016371|Ga0182034_11840526Not Available534Open in IMG/M
3300016445|Ga0182038_11350097Not Available638Open in IMG/M
3300017657|Ga0134074_1232982Not Available659Open in IMG/M
3300017926|Ga0187807_1321133Not Available517Open in IMG/M
3300017932|Ga0187814_10053674All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidithrix → Acidithrix ferrooxidans1484Open in IMG/M
3300017937|Ga0187809_10174826All Organisms → cellular organisms → Bacteria752Open in IMG/M
3300017937|Ga0187809_10302197Not Available590Open in IMG/M
3300017943|Ga0187819_10736696Not Available555Open in IMG/M
3300017946|Ga0187879_10332374Not Available843Open in IMG/M
3300017947|Ga0187785_10417632Not Available649Open in IMG/M
3300018012|Ga0187810_10020548All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidithrix → Acidithrix ferrooxidans2373Open in IMG/M
3300018012|Ga0187810_10336421Not Available628Open in IMG/M
3300018038|Ga0187855_10149325Not Available1394Open in IMG/M
3300018058|Ga0187766_11239479Not Available541Open in IMG/M
3300018085|Ga0187772_10903007Not Available642Open in IMG/M
3300018086|Ga0187769_10046402All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidithrix → Acidithrix ferrooxidans3002Open in IMG/M
3300018090|Ga0187770_10612617All Organisms → cellular organisms → Bacteria866Open in IMG/M
3300019268|Ga0181514_1577890Not Available558Open in IMG/M
3300020582|Ga0210395_10189032All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidithrix → Acidithrix ferrooxidans1543Open in IMG/M
3300021170|Ga0210400_10445306All Organisms → cellular organisms → Bacteria → Proteobacteria1068Open in IMG/M
3300021171|Ga0210405_10274791All Organisms → cellular organisms → Bacteria1332Open in IMG/M
3300021401|Ga0210393_11396043Not Available559Open in IMG/M
3300021407|Ga0210383_11104380Not Available669Open in IMG/M
3300021420|Ga0210394_11483812Not Available574Open in IMG/M
3300021432|Ga0210384_11135516Not Available685Open in IMG/M
3300021432|Ga0210384_11379197Not Available610Open in IMG/M
3300021445|Ga0182009_10168887All Organisms → cellular organisms → Bacteria1049Open in IMG/M
3300021478|Ga0210402_10657606All Organisms → cellular organisms → Bacteria → Proteobacteria970Open in IMG/M
3300021560|Ga0126371_12490939Not Available626Open in IMG/M
3300021861|Ga0213853_10883066Not Available606Open in IMG/M
3300022522|Ga0242659_1023084All Organisms → cellular organisms → Bacteria970Open in IMG/M
3300022527|Ga0242664_1158809Not Available504Open in IMG/M
3300022718|Ga0242675_1058788Not Available662Open in IMG/M
3300022873|Ga0224550_1021186All Organisms → cellular organisms → Bacteria919Open in IMG/M
3300024286|Ga0247687_1044232Not Available663Open in IMG/M
3300024295|Ga0224556_1130795Not Available614Open in IMG/M
3300024323|Ga0247666_1035434All Organisms → cellular organisms → Bacteria1033Open in IMG/M
3300025898|Ga0207692_10116051All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidithrix → Acidithrix ferrooxidans1492Open in IMG/M
3300025903|Ga0207680_10104014All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidithrix → Acidithrix ferrooxidans1829Open in IMG/M
3300025924|Ga0207694_10806371All Organisms → cellular organisms → Bacteria793Open in IMG/M
3300026374|Ga0257146_1023652All Organisms → cellular organisms → Bacteria998Open in IMG/M
3300026481|Ga0257155_1004609All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidithrix → Acidithrix ferrooxidans1687Open in IMG/M
3300026551|Ga0209648_10258028Not Available1285Open in IMG/M
3300027590|Ga0209116_1141179Not Available525Open in IMG/M
3300027609|Ga0209221_1165904Not Available543Open in IMG/M
3300027609|Ga0209221_1173310Not Available528Open in IMG/M
3300027725|Ga0209178_1024046All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidithrix → Acidithrix ferrooxidans1903Open in IMG/M
3300027787|Ga0209074_10166088All Organisms → cellular organisms → Bacteria806Open in IMG/M
3300027829|Ga0209773_10378522Not Available589Open in IMG/M
3300027842|Ga0209580_10109034Not Available1344Open in IMG/M
3300027884|Ga0209275_10655204Not Available604Open in IMG/M
3300027905|Ga0209415_10828851Not Available640Open in IMG/M
3300027910|Ga0209583_10576318Not Available569Open in IMG/M
3300028747|Ga0302219_10234755Not Available710Open in IMG/M
3300028773|Ga0302234_10246159Not Available770Open in IMG/M
3300028780|Ga0302225_10496866Not Available569Open in IMG/M
3300028877|Ga0302235_10276672Not Available728Open in IMG/M
3300028877|Ga0302235_10335456Not Available651Open in IMG/M
3300029882|Ga0311368_10099553All Organisms → cellular organisms → Bacteria2487Open in IMG/M
3300029910|Ga0311369_11230162Not Available577Open in IMG/M
3300029943|Ga0311340_11297161Not Available580Open in IMG/M
3300029951|Ga0311371_10052925All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidithrix → Acidithrix ferrooxidans6885Open in IMG/M
3300030013|Ga0302178_10310740Not Available722Open in IMG/M
3300030056|Ga0302181_10517383Not Available501Open in IMG/M
3300030058|Ga0302179_10323418Not Available679Open in IMG/M
3300030058|Ga0302179_10432821Not Available579Open in IMG/M
3300030520|Ga0311372_12451712Not Available588Open in IMG/M
3300030524|Ga0311357_11034060Not Available720Open in IMG/M
3300030580|Ga0311355_10438986All Organisms → cellular organisms → Bacteria1267Open in IMG/M
3300030580|Ga0311355_11847390Not Available511Open in IMG/M
3300031170|Ga0307498_10026992All Organisms → cellular organisms → Bacteria1376Open in IMG/M
3300031234|Ga0302325_12741854Not Available579Open in IMG/M
3300031543|Ga0318516_10435379All Organisms → cellular organisms → Bacteria → Proteobacteria754Open in IMG/M
3300031708|Ga0310686_103109672Not Available729Open in IMG/M
3300031708|Ga0310686_119102672Not Available523Open in IMG/M
3300031715|Ga0307476_10953288Not Available633Open in IMG/M
3300031723|Ga0318493_10239923All Organisms → cellular organisms → Bacteria → Proteobacteria966Open in IMG/M
3300031723|Ga0318493_10320192All Organisms → cellular organisms → Bacteria839Open in IMG/M
3300031724|Ga0318500_10703640Not Available515Open in IMG/M
3300031736|Ga0318501_10417218Not Available726Open in IMG/M
3300031740|Ga0307468_102502512Not Available505Open in IMG/M
3300031744|Ga0306918_10706977All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia788Open in IMG/M
3300031744|Ga0306918_11044868Not Available634Open in IMG/M
3300031747|Ga0318502_10046585All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidithrix → Acidithrix ferrooxidans2268Open in IMG/M
3300031778|Ga0318498_10228426All Organisms → cellular organisms → Bacteria → Proteobacteria841Open in IMG/M
3300031778|Ga0318498_10405305Not Available606Open in IMG/M
3300031779|Ga0318566_10341362Not Available740Open in IMG/M
3300031780|Ga0318508_1203365Not Available567Open in IMG/M
3300031792|Ga0318529_10324635Not Available717Open in IMG/M
3300031795|Ga0318557_10371811Not Available657Open in IMG/M
3300031799|Ga0318565_10649292All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300031821|Ga0318567_10374845All Organisms → cellular organisms → Bacteria805Open in IMG/M
3300031894|Ga0318522_10090867All Organisms → cellular organisms → Bacteria1123Open in IMG/M
3300031896|Ga0318551_10515428Not Available686Open in IMG/M
3300031897|Ga0318520_10102956All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidithrix → Acidithrix ferrooxidans1604Open in IMG/M
3300031941|Ga0310912_11246208Not Available565Open in IMG/M
3300031943|Ga0310885_10089625All Organisms → cellular organisms → Bacteria1375Open in IMG/M
3300032008|Ga0318562_10214064All Organisms → cellular organisms → Bacteria1117Open in IMG/M
3300032010|Ga0318569_10287413Not Available765Open in IMG/M
3300032010|Ga0318569_10562418Not Available531Open in IMG/M
3300032035|Ga0310911_10717290Not Available579Open in IMG/M
3300032039|Ga0318559_10432297Not Available614Open in IMG/M
3300032041|Ga0318549_10068397All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidithrix → Acidithrix ferrooxidans1503Open in IMG/M
3300032043|Ga0318556_10767397Not Available501Open in IMG/M
3300032044|Ga0318558_10464309Not Available631Open in IMG/M
3300032052|Ga0318506_10426707Not Available588Open in IMG/M
3300032054|Ga0318570_10492542Not Available559Open in IMG/M
3300032055|Ga0318575_10694974Not Available514Open in IMG/M
3300032063|Ga0318504_10201051All Organisms → cellular organisms → Bacteria930Open in IMG/M
3300032063|Ga0318504_10374185Not Available678Open in IMG/M
3300032064|Ga0318510_10395663Not Available588Open in IMG/M
3300032065|Ga0318513_10505266Not Available592Open in IMG/M
3300032067|Ga0318524_10652275Not Available554Open in IMG/M
3300032068|Ga0318553_10569373Not Available593Open in IMG/M
3300032089|Ga0318525_10479875Not Available637Open in IMG/M
3300032090|Ga0318518_10404596Not Available700Open in IMG/M
3300032090|Ga0318518_10688449Not Available520Open in IMG/M
3300032160|Ga0311301_11055952All Organisms → cellular organisms → Bacteria1064Open in IMG/M
3300032205|Ga0307472_101248062All Organisms → cellular organisms → Bacteria712Open in IMG/M
3300032261|Ga0306920_102540767Not Available704Open in IMG/M
3300032770|Ga0335085_11790771Not Available630Open in IMG/M
3300032770|Ga0335085_12153873Not Available562Open in IMG/M
3300032770|Ga0335085_12239367Not Available548Open in IMG/M
3300032783|Ga0335079_10097334All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidithrix → Acidithrix ferrooxidans3337Open in IMG/M
3300032805|Ga0335078_10067228All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidithrix → Acidithrix ferrooxidans5250Open in IMG/M
3300032829|Ga0335070_10894576All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas schubertii822Open in IMG/M
3300032893|Ga0335069_11823386Not Available645Open in IMG/M
3300032898|Ga0335072_10300380All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidithrix → Acidithrix ferrooxidans1799Open in IMG/M
3300032898|Ga0335072_11661254Not Available535Open in IMG/M
3300032955|Ga0335076_10158564All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidithrix → Acidithrix ferrooxidans2176Open in IMG/M
3300033134|Ga0335073_10871460All Organisms → cellular organisms → Bacteria → Proteobacteria953Open in IMG/M
3300033158|Ga0335077_11688262Not Available599Open in IMG/M
3300033289|Ga0310914_11843356Not Available509Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil30.56%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa10.00%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil6.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.00%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment3.89%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.33%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.33%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.78%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.78%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.22%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil2.22%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland1.67%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.67%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.67%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.67%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.67%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.11%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog1.11%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.11%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.11%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil1.11%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil1.11%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds0.56%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.56%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.56%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.56%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.56%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.56%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.56%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.56%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.56%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.56%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.56%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.56%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.56%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.56%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.56%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.56%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.56%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300004082Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006354Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010152Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010341Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010858Boreal forest soil eukaryotic communities from Alaska, USA - C3-2 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010867Boreal forest soil eukaryotic communities from Alaska, USA - C3-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014493Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaGEnvironmentalOpen in IMG/M
3300014657Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaGEnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017657Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015EnvironmentalOpen in IMG/M
3300017926Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2EnvironmentalOpen in IMG/M
3300017932Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4EnvironmentalOpen in IMG/M
3300017937Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017947Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MGEnvironmentalOpen in IMG/M
3300018012Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300019268Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300021861Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022522Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022527Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022718Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022873Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 10-14EnvironmentalOpen in IMG/M
3300024286Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK28EnvironmentalOpen in IMG/M
3300024295Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 1-5EnvironmentalOpen in IMG/M
3300024323Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK07EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026374Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-AEnvironmentalOpen in IMG/M
3300026481Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-AEnvironmentalOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300027590Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027609Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027725Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027787Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)EnvironmentalOpen in IMG/M
3300027829Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027842Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300027910Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes)EnvironmentalOpen in IMG/M
3300028747Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2EnvironmentalOpen in IMG/M
3300028773Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_2EnvironmentalOpen in IMG/M
3300028780Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2EnvironmentalOpen in IMG/M
3300028877Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3EnvironmentalOpen in IMG/M
3300029882III_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300029910III_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300029951III_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030013Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_3EnvironmentalOpen in IMG/M
3300030056Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3EnvironmentalOpen in IMG/M
3300030058Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1EnvironmentalOpen in IMG/M
3300030520III_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030524II_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300030580II_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300031170Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_SEnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031780Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031894Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031943Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032052Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032064Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17EnvironmentalOpen in IMG/M
3300032065Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0062384_10101702413300004082Bog Forest SoilMTEQTQALTSAAAERGPLAMEAVSVSKDFRIGRGQTLHAVRNVSFNLYRGAVVA
Ga0062590_10170625923300004157SoilVTEQATTLTSAAAARGELAMEAISVSKDFKIGRGQIVHAVRDVSFNLYRGAVV
Ga0070687_10089308023300005343Switchgrass RhizosphereVTEQATTLTSAAAARGELAMEAIAVSKDFKIGRGQIVHAVRD
Ga0070692_1125473013300005345Corn, Switchgrass And Miscanthus RhizosphereVTEQATTLTSAAAARGELAMEAIALSKDFKIGRGQIVHAVRDVSFNLYRGAV
Ga0070713_10146355413300005436Corn, Switchgrass And Miscanthus RhizosphereMTAPTLTSAAAARGPLAMEAISLSKDFRIGRGHTLHAVRDVSFNLYR
Ga0070706_10023630933300005467Corn, Switchgrass And Miscanthus RhizosphereMSEQTQTLTSAAAGRGPLAMEAISVSKDFRIGRGQTLHAVRHVSFNLYRGAVVALVGE
Ga0070707_10110312923300005468Corn, Switchgrass And Miscanthus RhizosphereVTEQATTLTSAAAARGPLAMEAISVSKDFKIGRGQIVHAVRDVSFNLYRGAVVALV
Ga0070699_10206631313300005518Corn, Switchgrass And Miscanthus RhizosphereVTEQATTLTSAAAARGPLAMEAISVSKDFKIGRGQIVHAVRDVSFNLYRSAV
Ga0070684_10226355313300005535Corn RhizosphereVTEHATTLTSAAAARGELAMEAISVSKDFKIGRGQIVHAVRDVSFNLYR
Ga0066698_1100982413300005558SoilMTEQASTLTSAAAARGPLAMEAISVSKDFKIGRGQ
Ga0066708_1011188133300005576SoilVSELATTLTSAAAARGPLAMEAISVSKDFKIGRGQ
Ga0070762_1057487123300005602SoilVTTTDAGVVSAAAARGPLAMEAAGLTKDFSLGRGQVVHAVRDVSFSLHAGAV
Ga0070762_1098102523300005602SoilMSEQTQTQSLTSAAAARGPLAMQAISMSKDFRIGRHQTLHAVRDVSFNLYR
Ga0068859_10023378933300005617Switchgrass RhizosphereVTEQATTLTSAAAARGELAMEAIALSKDFKIGRGQIVHAVRDVS
Ga0070766_1051307413300005921SoilMSEQTVRSAAAERGPLAMEAISVSKDFRLGRGEPLHAVRDVSFNLYRGAVVALV
Ga0075030_10060352823300006162WatershedsMTEQTLTSAAAGRGPLAMEAISVSKDFRIGRGQTLHAVRDVSFNLYQGA
Ga0070765_10112511713300006176SoilMTELTLTSAAAERGPLAMEAISISKDFRIGRGQILHAVRDVSFNLYR
Ga0075021_1096563323300006354WatershedsMTEQTTTLTSAAAARGPLAMEAISVSKDFKIGRGQILHAVRDVSFNLY
Ga0079222_1045455713300006755Agricultural SoilMSEHDGVEVVSVAGERGPLAMEAVSLDKDFRLGRGEVLHAVRGVSFGLYRGAV
Ga0079222_1144292423300006755Agricultural SoilVTEQTTTLTSAAAARGELAMEAIAVSKDFKIGRGQIVHAVRDVSF
Ga0079221_1181466923300006804Agricultural SoilVTEQATTLTSAAAARGELAMEAIAVSKDFKIGRGQIVHAVRDVSFNLYRGAVV
Ga0099827_1137590423300009090Vadose Zone SoilMTEQTLTLTSAAAARGPLAMEAISVSKDFKIGRGQI
Ga0105242_1294401013300009176Miscanthus RhizosphereVTEQATTLTSAAAARGELAMEAIAVSKDFKIGRGQIVHAVRDVSFNLYRGAVVALVGE
Ga0116217_1020732623300009700Peatlands SoilMSEQTLTSVAAERGPLAMEAISVSKDFRLGRGQTLHAVRDVSFNLYRGGVVA
Ga0126373_1041723613300010048Tropical Forest SoilMSEQTLTSAAAARGPLAMEAISVSKDFRIGRGRTLHAVRDASFNL
Ga0126373_1222557013300010048Tropical Forest SoilMSEQTLTSAAAPRGPLAMEAVSLSKDFRIGRGHTLHAVRDVSFNLYRGAVVALV
Ga0126318_1040318413300010152SoilVTEQATTLTSAAAARGELAMEAIAVSKDFKIGRGQIVHAVRDVSFNLYRGAVVAL
Ga0134084_1036145213300010322Grasslands SoilVTEQATTLTSAAAARGELAMEAIAVSKDFKIGRGQIVHAVRDVS
Ga0074045_1013305933300010341Bog Forest SoilMTEQTLTSAAAGRGPLAMEAISVSKDFRIGRGQVVHAVRDVSFNLY
Ga0134128_1304665023300010373Terrestrial SoilVTEQATTLTSAAAARGELAMEAIALSKDFKIGRGQIVHAVRDVSFNLYRGAVVALVGE
Ga0136449_10436081413300010379Peatlands SoilMSEQTLTSAAAARGPLAMEAISLSKDFRIGRGHTLHAVRDVSFNLYRGA
Ga0126345_112912113300010858Boreal Forest SoilMSEQTLTSAAAARGPLAMEAISLSKDFRIGRGNTLHAVRDVSFNLYRGAVVALVGES
Ga0126347_129129623300010867Boreal Forest SoilMSEQTLTSAAAARGPLAMEAISLSKDFRIGRGNTLHA
Ga0137364_1009237533300012198Vadose Zone SoilVTEQATTLTSAAATRGPLAMEAISVSKDFKIGRGQIV
Ga0137379_1157109923300012209Vadose Zone SoilMTEQATTLMSAAAARGPLAMEAISVSKDFKIGRGQ
Ga0137370_1034068123300012285Vadose Zone SoilMTEQATTLTSAAAARGELAMEAIAVSKDFRIGRGQILHAVRD
Ga0137375_1041740723300012360Vadose Zone SoilVTEQATTLTSAAAARGELAMEAISVSKDFKIGRGQIVHAVRDVSFNLYRGAVVALVGE
Ga0137397_1096659613300012685Vadose Zone SoilMTEQATTLTSAAAVRGPLAMEAISVSKDFKIGRGQIVHAVRDVSFNLYRGAVVALAAQ
Ga0164300_1027577713300012951SoilVTEQATTLTSAAAARGELAMEAIALSKDFKIGRGQIVHAVRDVSFNL
Ga0157374_1281950723300013296Miscanthus RhizosphereVTEQATTLTSAAAARGELAMEAIAVSKDFKIGRGQIVHAVRDVSFNLYR
Ga0181526_1096328123300014200BogMTEQTLTSAAARRGPLAMEAISVSKDFRIGRRQTL
Ga0182016_1022115923300014493BogMSEQTLTSAAAERGPLAMEAISVSKDFRIGRHQILHAVRDVSFNLYRGAVVALV
Ga0181522_1038533213300014657BogMSEQTLKSAAAERGPLAMEAISVSKDFRIGRGQPLHAVRDVSFNLYRGAVV
Ga0182041_1044359713300016294SoilMTEQATTLTSVAAARGTLAMEAISVSKDFRIGHGQTLHAVRDVSFT
Ga0182033_1079243723300016319SoilMSEQTLTSAAAPRGPLAMEAVSLSKDFRIGRGHTLHAVRDVSFDLYRGAVVAL
Ga0182032_1169690013300016357SoilMSEQTATLTSAAAARGPLAMEAVAVSKDFKIGHGQTLHAVRDVSFNLYRGAVVALV
Ga0182032_1182001423300016357SoilMTEQAITLTSAAAARGPLAMEAISVSKDFRIGRGQTLHAV
Ga0182034_1184052613300016371SoilMTEQATALISAAAARGPLAMEAISVSKDFRIGRGQTLHAV
Ga0182038_1135009723300016445SoilMTEQATTLTSAAAARGPLAMEAIAISKDFRIGHGQTL
Ga0134074_123298213300017657Grasslands SoilVSELATTLTSAAAARGPLAMEAISVSKDFKIGRGQIVHAVRDVSFNLYRSAVV
Ga0187807_132113313300017926Freshwater SedimentMSEQTLTSAAAARGPLAMEAISISRDFRIGRGQTLHAVRDVSF
Ga0187814_1005367413300017932Freshwater SedimentMSEQTLTSAAAARGPLAMEAISLSKEYRISRGHTL
Ga0187809_1017482623300017937Freshwater SedimentMSEQTLTSAAAARGPLAMEAISLGKDFRIGRGHTLHAVRDVSFNLYRG
Ga0187809_1030219713300017937Freshwater SedimentMSEQTLTSAAAARGPLAMEAISLSKDFRIGRGHTLHAV
Ga0187819_1073669623300017943Freshwater SedimentMTEQTLTSVAAGRGPLAMEAISVSKDFRIGRGQTLHA
Ga0187879_1033237413300017946PeatlandMTEQTLTSAAARRGPLAMEAISVSKDFRIGRRQTLHAVRDVSFNLYQ
Ga0187785_1041763223300017947Tropical PeatlandMTEQATTLTSAAAARGPLAMEAIAVSKDFRIGHGQTLHAVR
Ga0187810_1002054813300018012Freshwater SedimentMSEQTLISAAAERGPLAMEAISVSKDFRLGRGQTL
Ga0187810_1033642113300018012Freshwater SedimentMTVTSVTSVAAGRGPLAMEASGLGKDFRLVRGATLHAVRDVSFGLYRGAVVAL
Ga0187855_1014932533300018038PeatlandMSEQTQTQPLTSAAAARGPLAMQAISVSKDFRIGRHQTL
Ga0187766_1123947913300018058Tropical PeatlandVSEQTLTSAAAACGPLAMEAISISKDFRVGRGHTLHAVREASFNLYRGAVVAL
Ga0187772_1090300713300018085Tropical PeatlandVSEQTLTSAAAARGPLAMEAISISKDFRIGRGHTLHAVRE
Ga0187769_1004640243300018086Tropical PeatlandMSEPALTSAAAARGPLAMEAISLSKDFRIGRRRTL
Ga0187770_1061261723300018090Tropical PeatlandVSEQTLTSAAAARGPLAMEAISISKDFRIGRGHTLHAVREASFTLYRGAVVALV
Ga0181514_157789013300019268PeatlandMTEQAQVVTSAAAGRGPLAMEAISVSKDFRIGRGQTLHAVRD
Ga0210395_1018903233300020582SoilMSEQTLTSAAATRGPLAMEAISLSKDFRIGRGHTLHAVRDVSFNLYRGAVVALV
Ga0210400_1044530613300021170SoilMSEQTLTSAAVARGPLAMEAISLSKDFRIGRGNTLHA
Ga0210405_1027479113300021171SoilMTEQTTTLMSAAAARGPLAMEAISVSKDFKIGRGQILHAVRDASFN
Ga0210393_1139604313300021401SoilVSEQTLTSAAAARGPLAMEAISLSKDFRLGRGNTLH
Ga0210383_1110438013300021407SoilMSEQTLTSAAAARGPLAMEAISLSKDFRVGRGHTLHAVRDVSFN
Ga0210394_1148381213300021420SoilMSEQTLTSAAAERGPLAMEAISVSKDFRLGRGQTLHAVRD
Ga0210384_1113551623300021432SoilMSEQTLTSAAAARGPLAMEAISLSKDFRIGRGHTLHAVRDASFN
Ga0210384_1137919723300021432SoilMTEQTLALTSAAAERGPLAMEAVSVSKDFRIGRGQTLHAVRNVSFNLYRGAVVALVG
Ga0182009_1016888713300021445SoilVTEQATTLTSAAAARGELAMEAISVSKDFKIGRGQIVHAVRDVSFNLYR
Ga0210402_1065760623300021478SoilMSEQTLTSAAAARGPLAMEAISLSKDFRIGRGHALHAVRNVS
Ga0126371_1249093923300021560Tropical Forest SoilVSTDSVSQAPLQSVAAARGPLALEAVGLSKDFRLGRGKTLHAVR
Ga0213853_1088306613300021861WatershedsMTEQTLTSAAAGRGPLAMEAISVSKDFRIGRGQTLHAVRDVSFN
Ga0242659_102308433300022522SoilMSEDLRSAAADRGPLAMEATGLGKDFKLGRGAILHAVRDVS
Ga0242664_115880913300022527SoilMTEQTQALTSSAAERGPLAMEAVSVSKDFRIGRRQTLHAVRNVSFNLYRGAVVAL
Ga0242675_105878823300022718SoilNMSEQTLTSAAVARGPLAMEAISLSKDFRIGRGNTLHAVRDVSFNLYRVAVVALVG
Ga0224550_102118613300022873SoilMTELTVTSAAAERGPLAMEAISIGKDFRIGRGQIL
Ga0247687_104423213300024286SoilVTEQATTLTSAAAARGELAMEAIAVSKDFKIGRGQ
Ga0224556_113079513300024295SoilMSEQTQALTSAAAARGPLAMAAVSVSKDFRIGRHQTLHAVRDVSFNLYR
Ga0247666_103543413300024323SoilVTEQATTLTSAAAARGELAMEAIALSKDFKIGRGQIVHAVRDVSFNLYRGAVVALVGES
Ga0207692_1011605133300025898Corn, Switchgrass And Miscanthus RhizosphereVTEQATTLTSAAAARGELAMEAIALSKDFRIGRGQI
Ga0207680_1010401413300025903Switchgrass RhizosphereVTEQATTLTSAAAARGELAMEAIAVSKDFKIGRGQIV
Ga0207694_1080637123300025924Corn RhizosphereVTEQATTLTSAAAARGELAMEAIAVSKDFKIGRGQI
Ga0257146_102365223300026374SoilVTEQATTLTSAAAARGPLAMEAISVSKDFKIGRGQIVHAVRDVSFNLYR
Ga0257155_100460933300026481SoilMSEQTLTSAAAARGPLAMEAISVSKDFRIGRGNTLHAVRDVSFNLY
Ga0209648_1025802833300026551Grasslands SoilMSAAASEQPLTGGVESVAARRGPLAMEAISLTKDYRLGPGQTLHAV
Ga0209116_114117923300027590Forest SoilMSEQTQTQSLTSAAAARGPLAMQAISMSKDFRIGRHQTLHAVRDVSFNL
Ga0209221_116590413300027609Forest SoilMSEQTQTQPLTSAAAARGPLAMQAISVSKDFRIGRHQTLHAVRDVSFNLYRGAVVALV
Ga0209221_117331023300027609Forest SoilMSEQTLRSAAAERGPLAMEAISVSKDFRLGRSQKLH
Ga0209178_102404613300027725Agricultural SoilVTEQATTLTSAAAARGELAMEAISVSKDFKIGRGQIVH
Ga0209074_1016608813300027787Agricultural SoilVTEQATTLTSAAAARGELAMEAIAISKDFKIGRGQIVHAVRDVSFNLYRGAV
Ga0209773_1037852213300027829Bog Forest SoilMSEQTLTSAAAARGPLAMEAISLSKDFRIGRGNTLHAVRDVSFNLYRGAVVALVG
Ga0209580_1010903413300027842Surface SoilMSEQTLTSAAAERGPLAMEAISVSKDFKLGRGQTLHAVRDVS
Ga0209275_1065520423300027884SoilVTTTDAGVVSAAAARGPLAMEAAGLTKDFSLGRGQVVHAVRD
Ga0209415_1082885123300027905Peatlands SoilMSEQTLTSAAAERGPLAMEAISVSKDFRLGRGQTLHAVRDVSFNLYRGGVVALVG
Ga0209583_1057631813300027910WatershedsMSEQTLTSVAAERGPRAMEAISVSKDFRLGRGQTLHAVRD
Ga0302219_1023475523300028747PalsaMSEQAQAQPLTSAAAARGPLAMQAISVSKDFRIGRHQTL
Ga0302234_1024615913300028773PalsaMTEQTQVLTSAAAERGPLAMEAISVSKDFRIGRRQTLHAVRDVSFNLYRGAVVAL
Ga0302225_1049686613300028780PalsaMSEQAQAQPLTSAAAARGPLAMQAISVSKDFRIGRHQTLH
Ga0302235_1027667213300028877PalsaMSEQTQAQPLTSAAAARGPLAMQAISISKDFRIGRHQTLHAVRDVSFNLYRGAVVALVGE
Ga0302235_1033545613300028877PalsaMSEQTQTQSLTSAAAARGPLAMQAISVSKDFRIGRHQTLHA
Ga0311368_1009955313300029882PalsaMTEQTQVLTSAAAERGPLAMEAISVSKDFRIGRRQTLHAVRDVSFNLYRGAVVALV
Ga0311369_1123016223300029910PalsaMTEQTQVLTSAAAERGPLAMEAISVSKDFRIGRRQTLHA
Ga0311340_1129716123300029943PalsaMSEQTQTQSLTSAAAARGPLAMQAISVSKDFRIGRHQTLHAVRDVSFNLY
Ga0311371_1005292513300029951PalsaMSEQAQAQPLTSAAAARGPLAMQAISVSKDFRIGRHQTLHAVRDVS
Ga0302178_1031074013300030013PalsaMTEQTQVLTSAAAERGPLAMEAISVSKDFRIGRRQTLHAVR
Ga0302181_1051738323300030056PalsaMTEQTQLLTSAAADRGPLAMEAISVSKDFHIGRRQILHAVRDVSFNLYRGAVVAL
Ga0302179_1032341823300030058PalsaMTEQTQVLTSAAAERGPLAMEAISVNKDFRIGRRQILHAVRDVSFS
Ga0302179_1043282113300030058PalsaMSEQTQTQSLTSAAAARGPLAMQAISVSKDFRIGRHQTLHAVRDVSF
Ga0311372_1245171223300030520PalsaMSEQTQTQSLTSAAAARGPLAMQAISISKDFRIGRHQTLHAVRDVSF
Ga0311357_1103406023300030524PalsaMTEQTQVVTSAAAGRGALAMEAISVSKDFRIGRGKTLHAVRNVS
Ga0311355_1043898623300030580PalsaMTEQTLTSAAAERGPLAMEAISISKDFRIGRGQILHAVRDVSFNLYRGAV
Ga0311355_1184739013300030580PalsaMSEQTQAQPLTSAAAARGPLAMQAISISKDFRIGRHQTLHAVRDVSFNLYRGAVVAL
Ga0307498_1002699233300031170SoilVTEQATTLTSAAAARGELAMEAISLSKDFKIGRGEIVHAVR
Ga0302325_1274185413300031234PalsaMTEQTQVVTSAAAGRGPLAMEAISVSKDFRIGRGKSLHAVRDVSF
Ga0318516_1043537913300031543SoilMSEQTLTSAAAARGPLAMEAVSLSKDFRIGRGNTLRAVRDVSFNLYRGAVVA
Ga0310686_10310967213300031708SoilMSEQTLTSAAAARGPLAMEAISLSKDFRIGRGHTLHAVRDVSFNLYRGAVV
Ga0310686_11910267223300031708SoilMSEQTLTSAAAARGPLAMEAISLSKDFRIGRGHTLH
Ga0307476_1095328813300031715Hardwood Forest SoilVTEQATTLTSAAAARGELAMEAIAVSKDFKIGRGQIVH
Ga0318493_1023992323300031723SoilMSEQTLTSAAAARGPLAMEAISLSKDFRIGRGHTLHA
Ga0318493_1032019223300031723SoilMSEQTLTSAAAARGPLAMEAVALSKDFRIGRGHTLHAVRDVSFNLYRGAVVALVGE
Ga0318500_1070364023300031724SoilMSEQTLTSAAATRGPLAMEAVSVSKDFRIGRGHTLHAVRD
Ga0318501_1041721813300031736SoilMTEQATTLTSAAAARGPLAMEAISVSKDFRIGRGQTLHAVRDVSFNLH
Ga0307468_10250251213300031740Hardwood Forest SoilVTEQATTLTSAAAARGELAMEAIAVSKDFKIGRGQIVHAVRDVSFNLYRGAVVALVGES
Ga0306918_1070697723300031744SoilMTVTSVAADRGPLAMEAKGLGKDFRLGRGATLHAVKDVSFGLYRG
Ga0306918_1104486813300031744SoilMTEQATMLTSAAAARGPLAMEAIAVSKDFKIRHGQTLHAVRDVSFNLYR
Ga0318502_1004658533300031747SoilMTEQATTLTSAAAARGPLAMEAISVSKDFRIGRGQTLHAVRD
Ga0318498_1022842613300031778SoilMSEQTLTSAAAARGPLAMEAVSLSKDFRIGRGNTLRAVRD
Ga0318498_1040530523300031778SoilMTEQATTLTSAAAARGPLAMEAISVSKDFRIGRGQTLHAVRDVSFNLHRGAVV
Ga0318566_1034136223300031779SoilMSEQTATLTSAAAARGPLAMEAVSVSKDFKIGHGQTLHAVRDVSFNLYRGAVV
Ga0318508_120336513300031780SoilMTEQAITLTSAAAARGPLAMEAISVSKDFRIGRGQTLHAVRDVSFNL
Ga0318529_1032463513300031792SoilMTVTSVAADRGPLAMEAKGLGKDFRLGRGATLHAVKDVSFGLYRGA
Ga0318557_1037181123300031795SoilMSEQTLTSAAAMRGPLAMEAISVNKDFRIGHGQTLHA
Ga0318565_1064929223300031799SoilMSEQTLTSAAATRGPLAMEAISLSKDFRIGRGHTLHAVRDVSFNLYRGAVVALVGE
Ga0318567_1037484513300031821SoilMTEQAITLTSAAAARGPLAMEAISVSKDFRIGRGQTLHAVRDVSFNLHRGAVE
Ga0318522_1009086713300031894SoilMTVTSVAADRGPLAMEAKGLGKDFRLGRGATLHAVKDVSFGLYRGAAEPEVLA
Ga0318551_1051542813300031896SoilMTEQATTLNSAAAARGPLAMEAISVSKDFRIGRGQTLHAVRDVSF
Ga0318520_1010295633300031897SoilMSEQTATLTSAAAARGPLAMEAVSVSKDFKIGHGQTLHAVRDVSF
Ga0310912_1124620813300031941SoilMSEQTLTSAAAARGPLAMEAASLSKDFRIGRGQTLHAVRDVSFNLYRSAVVALVG
Ga0310885_1008962513300031943SoilVTEQATTLTSAAAARGELAMEAIALSKDFKIGRGQIVHAVRDVSFNLY
Ga0318562_1021406413300032008SoilMSEQTATLTSAAAARGPLAMEAVSVSKDFKIGHGQTLHAVRDVSFNLYRGAVVALVGES
Ga0318569_1028741313300032010SoilMSEQTATLTSAAAARGPLAMEAVSVSKDFKIGHGQ
Ga0318569_1056241813300032010SoilMSEQTLTSAAAMRGPLAMEAISVNKDFRIGHGQTLHAVRD
Ga0310911_1071729013300032035SoilMTGQVSTLESAAAARGPLAVEAIAISRDFMLGRGQTLHAVRDVSFNLYRG
Ga0318559_1043229723300032039SoilMTEQATMLTSAAAARGPLAMEAIAVSKDFKIGHGQTLHAVRDVSFNLYRGAVVALV
Ga0318549_1006839733300032041SoilMSEQTLTSAAATRGPLAMEAVSVSKDFRIGRGHTLHAVRDV
Ga0318556_1076739713300032043SoilMSEQTLTSAAAARGPLAMEAASLSKDFRIGRGQTLHAVRDVSFNLYRS
Ga0318558_1046430923300032044SoilMTEQATMLTSAAAARGPLAMEAIAVSKDFKIGHGQTLHAVRDVSFNLYRGGGGQHG
Ga0318506_1042670723300032052SoilMTEQATTLTSVAAARGTLAMEAISVSKDFRIGHGQTLHAVRD
Ga0318570_1049254213300032054SoilMSEQTLTSAAAARGPLAMEAVALSKDFRIGRGHTLHAVRDVSFNLY
Ga0318575_1069497423300032055SoilMTEQATTLTSAAAARGPLAMEAISVSKDFRIGRGQT
Ga0318504_1020105113300032063SoilMSEQTLTSAAAMRGPLAMEAISVNKDFRIGHGQTLHAVRDVSFN
Ga0318504_1037418513300032063SoilMTEQATMLTSAAAARGPLAMEAIAVSKDFKIRHGQTLHAVRDVSFNLYRGAMVALVGES
Ga0318510_1039566313300032064SoilMSEQTLTSAAAARGPLAMEAISLSKDFRIGRGHTLHAVRN
Ga0318513_1050526623300032065SoilMTEQATTLTSAAAARGPLAMEAISVSKDFRIGRGQ
Ga0318524_1065227523300032067SoilMSEQTLTSAAAARGPLAMEAVSLSKDFRIGRGNTLRAVRDVSFNLYR
Ga0318553_1056937313300032068SoilMSEQTLTSAAAARGPLAMEAASLSKDFRIGRGQTLH
Ga0318525_1047987523300032089SoilMTEQATTLTSAAAARGPLVMEAISVSKDFRIGRGQTLHAVRDVSFNLHRSAVV
Ga0318518_1040459613300032090SoilMTEQATTLTSAAAARGPLAMEAISVSKDFRIGRGQTLHAVRDVSFN
Ga0318518_1068844923300032090SoilMSEQALTSAAAARGPLAMEAISLSKDFRIGRGRTLHAVRDVSFNLY
Ga0311301_1105595223300032160Peatlands SoilMSEQTLTSAAAARGPLAMEAISLSKDFRIGRGHTLHAVRDVSFNLYRGAVVAL
Ga0307472_10124806213300032205Hardwood Forest SoilVTEQATTLTSAAAARGELAMEAIALSKDFKIGRGQ
Ga0306920_10254076713300032261SoilMSSEATLESAAAARGQLALSADGLGKDFRIGRGAVL
Ga0335085_1179077113300032770SoilMSEQAPTLTSAAAARGPLAMEAVSVSKDFKIGHGQTVQAVR
Ga0335085_1215387323300032770SoilVTEQATTLTSAAAARGELAMEAIAVSRDFKIGRGQIVHAVRDVSF
Ga0335085_1223936713300032770SoilMTEQATTLTSAAAARGPLAMEAISVSKDFRIGRGQTLHAV
Ga0335079_1009733443300032783SoilMSEQAPTLTSAAAARGPLAMEAVSVSKDFKIGHGQTVQAVRDVSFS
Ga0335078_1006722813300032805SoilMSEQAPTLTSAAAARGPLAMEAVSISKDFKIGHGQTVQAVRDVSFS
Ga0335070_1089457623300032829SoilMTEQATTLTSVAAARGTLAMEAISVSKDFRIGRGQ
Ga0335069_1182338623300032893SoilMTEQATTLTSVAAARGTLAMEAISVSKDFRIGRGQTLHAV
Ga0335072_1030038033300032898SoilVTEQATALNSAAAARGELAMEAIAVSKDFRIGRGQTLHAVRDVSFSLYR
Ga0335072_1166125423300032898SoilVTEQATTLTSAAAARGELAMEAIAVSKDFRIGRGQTLHAVRDVSFSLYR
Ga0335076_1015856433300032955SoilMSEQPPTLTSAAAARGPLAMEAVSISKDFKIGHGQTVQAVRDVSFS
Ga0335073_1087146013300033134SoilMSEQTLTSAAAARGPLAMQAISLSKDFRIGRGNTLHAVRDVS
Ga0335077_1168826223300033158SoilMSGQAATLTSAAAARGPLAMEAVSVSKDFKIGHGQTLHAVRDVSFHLYRGA
Ga0310914_1184335613300033289SoilMTVTSVAADRGPLAMEAKGLGKDFRLGRGATLHAVRDVS


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.