| Basic Information | |
|---|---|
| Family ID | F032342 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 180 |
| Average Sequence Length | 38 residues |
| Representative Sequence | MKKVALALALVVAALSLGGCFVGKGKAPAPIVTKG |
| Number of Associated Samples | 118 |
| Number of Associated Scaffolds | 180 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 66.86 % |
| % of genes near scaffold ends (potentially truncated) | 29.44 % |
| % of genes from short scaffolds (< 2000 bps) | 88.33 % |
| Associated GOLD sequencing projects | 114 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (61.667 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (21.111 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.667 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (55.556 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 31.75% β-sheet: 0.00% Coil/Unstructured: 68.25% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 180 Family Scaffolds |
|---|---|---|
| PF13505 | OMP_b-brl | 12.78 |
| PF03734 | YkuD | 7.22 |
| PF13472 | Lipase_GDSL_2 | 2.22 |
| PF03401 | TctC | 1.67 |
| PF12695 | Abhydrolase_5 | 1.11 |
| PF02685 | Glucokinase | 0.56 |
| PF01068 | DNA_ligase_A_M | 0.56 |
| PF00857 | Isochorismatase | 0.56 |
| PF13450 | NAD_binding_8 | 0.56 |
| PF13533 | Biotin_lipoyl_2 | 0.56 |
| PF04909 | Amidohydro_2 | 0.56 |
| PF01381 | HTH_3 | 0.56 |
| PF00355 | Rieske | 0.56 |
| PF01702 | TGT | 0.56 |
| PF01494 | FAD_binding_3 | 0.56 |
| PF04226 | Transgly_assoc | 0.56 |
| PF00486 | Trans_reg_C | 0.56 |
| PF07992 | Pyr_redox_2 | 0.56 |
| PF00155 | Aminotran_1_2 | 0.56 |
| PF02775 | TPP_enzyme_C | 0.56 |
| PF06411 | HdeA | 0.56 |
| PF03703 | bPH_2 | 0.56 |
| PF01979 | Amidohydro_1 | 0.56 |
| PF06186 | DUF992 | 0.56 |
| COG ID | Name | Functional Category | % Frequency in 180 Family Scaffolds |
|---|---|---|---|
| COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 7.22 |
| COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 7.22 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 1.67 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.11 |
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 0.56 |
| COG3428 | Uncharacterized membrane protein YdbT, contains bPH2 (bacterial pleckstrin homology) domain | Function unknown [S] | 0.56 |
| COG3402 | Uncharacterized membrane protein YdbS, contains bPH2 (bacterial pleckstrin homology) domain | Function unknown [S] | 0.56 |
| COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 0.56 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.56 |
| COG1549 | Archaeosine tRNA-ribosyltransferase, contains uracil-DNA-glycosylase and PUA domains | Translation, ribosomal structure and biogenesis [J] | 0.56 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.56 |
| COG0343 | Queuine/archaeosine tRNA-ribosyltransferase | Translation, ribosomal structure and biogenesis [J] | 0.56 |
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.56 |
| COG0837 | Glucokinase | Carbohydrate transport and metabolism [G] | 0.56 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.56 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.56 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.56 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 61.67 % |
| Unclassified | root | N/A | 38.33 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459003|FZ032L002JF82W | Not Available | 531 | Open in IMG/M |
| 2170459019|G14TP7Y01EC1TQ | Not Available | 704 | Open in IMG/M |
| 2170459021|G14TP7Y02HYHWK | Not Available | 537 | Open in IMG/M |
| 3300000033|ICChiseqgaiiDRAFT_c1889831 | Not Available | 532 | Open in IMG/M |
| 3300000033|ICChiseqgaiiDRAFT_c2179110 | All Organisms → cellular organisms → Bacteria | 1353 | Open in IMG/M |
| 3300000956|JGI10216J12902_101366092 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2979 | Open in IMG/M |
| 3300000956|JGI10216J12902_102533453 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2162 | Open in IMG/M |
| 3300000956|JGI10216J12902_104404072 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1515 | Open in IMG/M |
| 3300004479|Ga0062595_100558650 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 879 | Open in IMG/M |
| 3300004479|Ga0062595_100948306 | Not Available | 732 | Open in IMG/M |
| 3300004798|Ga0058859_11676486 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 894 | Open in IMG/M |
| 3300005334|Ga0068869_100281244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1338 | Open in IMG/M |
| 3300005438|Ga0070701_11185556 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 541 | Open in IMG/M |
| 3300005441|Ga0070700_100360122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1081 | Open in IMG/M |
| 3300005466|Ga0070685_10553369 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 822 | Open in IMG/M |
| 3300005569|Ga0066705_10562049 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 706 | Open in IMG/M |
| 3300005713|Ga0066905_100400541 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1113 | Open in IMG/M |
| 3300005718|Ga0068866_10874974 | Not Available | 630 | Open in IMG/M |
| 3300005718|Ga0068866_11304357 | Not Available | 528 | Open in IMG/M |
| 3300005719|Ga0068861_101614407 | Not Available | 639 | Open in IMG/M |
| 3300005764|Ga0066903_100102402 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 3876 | Open in IMG/M |
| 3300005764|Ga0066903_106162497 | Not Available | 627 | Open in IMG/M |
| 3300005840|Ga0068870_11357300 | Not Available | 519 | Open in IMG/M |
| 3300005841|Ga0068863_100422290 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1306 | Open in IMG/M |
| 3300005842|Ga0068858_100336625 | Not Available | 1444 | Open in IMG/M |
| 3300005844|Ga0068862_102005838 | Not Available | 589 | Open in IMG/M |
| 3300006028|Ga0070717_11330448 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 653 | Open in IMG/M |
| 3300006038|Ga0075365_10558066 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 810 | Open in IMG/M |
| 3300006041|Ga0075023_100115780 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 946 | Open in IMG/M |
| 3300006195|Ga0075366_10490134 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
| 3300006237|Ga0097621_100579544 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1024 | Open in IMG/M |
| 3300006358|Ga0068871_102398047 | Not Available | 503 | Open in IMG/M |
| 3300006844|Ga0075428_102725248 | Not Available | 503 | Open in IMG/M |
| 3300006880|Ga0075429_101810481 | Not Available | 530 | Open in IMG/M |
| 3300009087|Ga0105107_10665951 | Not Available | 724 | Open in IMG/M |
| 3300009098|Ga0105245_12790574 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 541 | Open in IMG/M |
| 3300009101|Ga0105247_10248336 | Not Available | 1215 | Open in IMG/M |
| 3300009101|Ga0105247_10326159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1073 | Open in IMG/M |
| 3300009101|Ga0105247_11279452 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 588 | Open in IMG/M |
| 3300009147|Ga0114129_11760986 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 754 | Open in IMG/M |
| 3300009148|Ga0105243_11431421 | Not Available | 713 | Open in IMG/M |
| 3300009156|Ga0111538_11075961 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1017 | Open in IMG/M |
| 3300009156|Ga0111538_12027368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 723 | Open in IMG/M |
| 3300009168|Ga0105104_10406566 | Not Available | 757 | Open in IMG/M |
| 3300009174|Ga0105241_11035472 | Not Available | 770 | Open in IMG/M |
| 3300009177|Ga0105248_10821719 | Not Available | 1049 | Open in IMG/M |
| 3300009177|Ga0105248_12644312 | Not Available | 572 | Open in IMG/M |
| 3300009551|Ga0105238_10537051 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1173 | Open in IMG/M |
| 3300009551|Ga0105238_11414729 | Not Available | 723 | Open in IMG/M |
| 3300009553|Ga0105249_11429424 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 764 | Open in IMG/M |
| 3300009662|Ga0105856_1050234 | Not Available | 1171 | Open in IMG/M |
| 3300009789|Ga0126307_11238545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 604 | Open in IMG/M |
| 3300010038|Ga0126315_10286917 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1013 | Open in IMG/M |
| 3300010041|Ga0126312_10660300 | Not Available | 754 | Open in IMG/M |
| 3300010166|Ga0126306_10514461 | Not Available | 948 | Open in IMG/M |
| 3300010166|Ga0126306_11884701 | Not Available | 501 | Open in IMG/M |
| 3300010361|Ga0126378_10057977 | All Organisms → cellular organisms → Bacteria | 3647 | Open in IMG/M |
| 3300010362|Ga0126377_12771437 | Not Available | 565 | Open in IMG/M |
| 3300010373|Ga0134128_12322424 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 591 | Open in IMG/M |
| 3300010373|Ga0134128_13200408 | Not Available | 503 | Open in IMG/M |
| 3300010397|Ga0134124_10101147 | All Organisms → cellular organisms → Bacteria | 2509 | Open in IMG/M |
| 3300010397|Ga0134124_10719213 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 990 | Open in IMG/M |
| 3300010400|Ga0134122_12570524 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 559 | Open in IMG/M |
| 3300010401|Ga0134121_10202297 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1718 | Open in IMG/M |
| 3300010403|Ga0134123_10029596 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3974 | Open in IMG/M |
| 3300010865|Ga0126346_1441429 | Not Available | 608 | Open in IMG/M |
| 3300011119|Ga0105246_10955972 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 772 | Open in IMG/M |
| 3300011332|Ga0126317_10572289 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 940 | Open in IMG/M |
| 3300011412|Ga0137424_1113264 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 563 | Open in IMG/M |
| 3300012200|Ga0137382_10605748 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 782 | Open in IMG/M |
| 3300012212|Ga0150985_104947965 | Not Available | 634 | Open in IMG/M |
| 3300012212|Ga0150985_105222872 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1031 | Open in IMG/M |
| 3300012212|Ga0150985_105601781 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 580 | Open in IMG/M |
| 3300012212|Ga0150985_107434629 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae | 1429 | Open in IMG/M |
| 3300012212|Ga0150985_108513325 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 720 | Open in IMG/M |
| 3300012212|Ga0150985_109180027 | Not Available | 525 | Open in IMG/M |
| 3300012212|Ga0150985_110869138 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2177 | Open in IMG/M |
| 3300012212|Ga0150985_113045898 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1027 | Open in IMG/M |
| 3300012212|Ga0150985_113292850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1019 | Open in IMG/M |
| 3300012212|Ga0150985_118978436 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 551 | Open in IMG/M |
| 3300012212|Ga0150985_122775104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 851 | Open in IMG/M |
| 3300012469|Ga0150984_103414667 | Not Available | 1310 | Open in IMG/M |
| 3300012469|Ga0150984_108060386 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 617 | Open in IMG/M |
| 3300012469|Ga0150984_109177423 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. | 769 | Open in IMG/M |
| 3300012469|Ga0150984_110341414 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae | 1360 | Open in IMG/M |
| 3300012469|Ga0150984_111261392 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1121 | Open in IMG/M |
| 3300012469|Ga0150984_118268792 | Not Available | 502 | Open in IMG/M |
| 3300012469|Ga0150984_119748196 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1817 | Open in IMG/M |
| 3300012469|Ga0150984_119962404 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 558 | Open in IMG/M |
| 3300012469|Ga0150984_120628675 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 652 | Open in IMG/M |
| 3300012469|Ga0150984_120950580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1212 | Open in IMG/M |
| 3300012891|Ga0157305_10076222 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 779 | Open in IMG/M |
| 3300012892|Ga0157294_10018602 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1324 | Open in IMG/M |
| 3300012900|Ga0157292_10316885 | Not Available | 565 | Open in IMG/M |
| 3300012906|Ga0157295_10333707 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 542 | Open in IMG/M |
| 3300012914|Ga0157297_10381241 | Not Available | 559 | Open in IMG/M |
| 3300012930|Ga0137407_11411226 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 662 | Open in IMG/M |
| 3300012958|Ga0164299_10395803 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 886 | Open in IMG/M |
| 3300012958|Ga0164299_11134208 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 587 | Open in IMG/M |
| 3300012960|Ga0164301_10489963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes | 884 | Open in IMG/M |
| 3300012961|Ga0164302_11319152 | Not Available | 584 | Open in IMG/M |
| 3300014325|Ga0163163_10186794 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes | 2120 | Open in IMG/M |
| 3300014325|Ga0163163_11729747 | Not Available | 686 | Open in IMG/M |
| 3300014325|Ga0163163_12198573 | Not Available | 611 | Open in IMG/M |
| 3300014325|Ga0163163_12602374 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 563 | Open in IMG/M |
| 3300014326|Ga0157380_10652077 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1050 | Open in IMG/M |
| 3300014969|Ga0157376_10779574 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 967 | Open in IMG/M |
| 3300014969|Ga0157376_11900576 | Not Available | 632 | Open in IMG/M |
| 3300015200|Ga0173480_10439758 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 767 | Open in IMG/M |
| 3300017792|Ga0163161_12040045 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 510 | Open in IMG/M |
| 3300017965|Ga0190266_11073508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 546 | Open in IMG/M |
| 3300018422|Ga0190265_11804095 | Not Available | 720 | Open in IMG/M |
| 3300018429|Ga0190272_10650762 | All Organisms → cellular organisms → Bacteria | 937 | Open in IMG/M |
| 3300018432|Ga0190275_11045017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 889 | Open in IMG/M |
| 3300018466|Ga0190268_10398227 | Not Available | 884 | Open in IMG/M |
| 3300018469|Ga0190270_10000981 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 12989 | Open in IMG/M |
| 3300018469|Ga0190270_10042417 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 3086 | Open in IMG/M |
| 3300018469|Ga0190270_10238816 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1570 | Open in IMG/M |
| 3300018469|Ga0190270_10977772 | Not Available | 871 | Open in IMG/M |
| 3300018469|Ga0190270_11023863 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 854 | Open in IMG/M |
| 3300018469|Ga0190270_11397880 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 746 | Open in IMG/M |
| 3300018469|Ga0190270_12678854 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 561 | Open in IMG/M |
| 3300018476|Ga0190274_10004854 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 8077 | Open in IMG/M |
| 3300018476|Ga0190274_10018587 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae | 4508 | Open in IMG/M |
| 3300018476|Ga0190274_10432734 | All Organisms → cellular organisms → Bacteria | 1289 | Open in IMG/M |
| 3300018476|Ga0190274_11371720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 795 | Open in IMG/M |
| 3300018476|Ga0190274_11378983 | Not Available | 794 | Open in IMG/M |
| 3300018476|Ga0190274_12340366 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 631 | Open in IMG/M |
| 3300018481|Ga0190271_10259758 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1775 | Open in IMG/M |
| 3300018481|Ga0190271_11300442 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 848 | Open in IMG/M |
| 3300018481|Ga0190271_11566994 | Not Available | 775 | Open in IMG/M |
| 3300018481|Ga0190271_11913206 | Not Available | 703 | Open in IMG/M |
| 3300019356|Ga0173481_10186577 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 888 | Open in IMG/M |
| 3300019356|Ga0173481_10503234 | Not Available | 617 | Open in IMG/M |
| 3300019356|Ga0173481_10866865 | Not Available | 506 | Open in IMG/M |
| 3300019377|Ga0190264_11531323 | Not Available | 582 | Open in IMG/M |
| 3300019458|Ga0187892_10183670 | Not Available | 1133 | Open in IMG/M |
| 3300021082|Ga0210380_10005680 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 5168 | Open in IMG/M |
| 3300021560|Ga0126371_10069290 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3427 | Open in IMG/M |
| 3300022724|Ga0242665_10294212 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 566 | Open in IMG/M |
| 3300022901|Ga0247788_1105932 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 558 | Open in IMG/M |
| 3300022911|Ga0247783_1132189 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 695 | Open in IMG/M |
| 3300022917|Ga0247777_1257974 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 558 | Open in IMG/M |
| 3300023102|Ga0247754_1084073 | Not Available | 760 | Open in IMG/M |
| 3300024246|Ga0247680_1034960 | Not Available | 727 | Open in IMG/M |
| 3300024347|Ga0179591_1006967 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1891 | Open in IMG/M |
| 3300024347|Ga0179591_1009875 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1717 | Open in IMG/M |
| 3300025903|Ga0207680_10725152 | Not Available | 712 | Open in IMG/M |
| 3300025907|Ga0207645_11102418 | Not Available | 535 | Open in IMG/M |
| 3300025918|Ga0207662_11103740 | Not Available | 564 | Open in IMG/M |
| 3300025941|Ga0207711_12141383 | Not Available | 502 | Open in IMG/M |
| 3300026121|Ga0207683_10048181 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3732 | Open in IMG/M |
| 3300026316|Ga0209155_1167948 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300027907|Ga0207428_11319187 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300027910|Ga0209583_10151803 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 948 | Open in IMG/M |
| 3300027915|Ga0209069_10805479 | Not Available | 561 | Open in IMG/M |
| 3300028812|Ga0247825_11123756 | Not Available | 572 | Open in IMG/M |
| 3300031250|Ga0265331_10560801 | Not Available | 515 | Open in IMG/M |
| 3300031421|Ga0308194_10043255 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1121 | Open in IMG/M |
| 3300031421|Ga0308194_10385622 | Not Available | 507 | Open in IMG/M |
| 3300031538|Ga0310888_10015631 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3052 | Open in IMG/M |
| 3300031547|Ga0310887_10866702 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 570 | Open in IMG/M |
| 3300031726|Ga0302321_103588782 | Not Available | 504 | Open in IMG/M |
| 3300031847|Ga0310907_10329830 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 777 | Open in IMG/M |
| 3300031847|Ga0310907_10516674 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. dw_411 | 641 | Open in IMG/M |
| 3300031847|Ga0310907_10840282 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 516 | Open in IMG/M |
| 3300031902|Ga0302322_101515093 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 819 | Open in IMG/M |
| 3300031908|Ga0310900_10977017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 695 | Open in IMG/M |
| 3300031908|Ga0310900_11419328 | Not Available | 583 | Open in IMG/M |
| 3300031940|Ga0310901_10130027 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 944 | Open in IMG/M |
| 3300032000|Ga0310903_10553279 | Not Available | 607 | Open in IMG/M |
| 3300032003|Ga0310897_10240253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 807 | Open in IMG/M |
| 3300033433|Ga0326726_10511330 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1150 | Open in IMG/M |
| 3300034672|Ga0314797_059828 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 711 | Open in IMG/M |
| 3300034673|Ga0314798_080968 | Not Available | 659 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 21.11% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 7.22% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 6.67% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 6.11% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 3.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.33% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.33% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.78% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.78% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.22% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.22% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 2.22% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.67% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.67% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.67% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.67% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 1.67% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.67% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.67% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.11% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.11% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.11% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.11% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.11% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.11% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.11% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 1.11% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.11% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.11% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 1.11% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.56% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.56% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.56% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.56% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.56% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.56% |
| Bio-Ooze | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze | 0.56% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.56% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.56% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.56% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.56% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.56% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.56% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.56% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.56% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459003 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 2170459019 | Litter degradation MG4 | Engineered | Open in IMG/M |
| 2170459021 | Litter degradation NP4 | Engineered | Open in IMG/M |
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006177 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Host-Associated | Open in IMG/M |
| 3300006195 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Host-Associated | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300009087 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009662 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-060 | Environmental | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300010865 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011332 | Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011412 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT620_2 | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012891 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S148-409B-2 | Environmental | Open in IMG/M |
| 3300012892 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 | Environmental | Open in IMG/M |
| 3300012900 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S179-409R-1 | Environmental | Open in IMG/M |
| 3300012906 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1 | Environmental | Open in IMG/M |
| 3300012914 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2 | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300019458 | Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaG | Environmental | Open in IMG/M |
| 3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022901 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S156-409C-4 | Environmental | Open in IMG/M |
| 3300022911 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L064-202C-5 | Environmental | Open in IMG/M |
| 3300022917 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L154-409C-5 | Environmental | Open in IMG/M |
| 3300023102 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S184-509B-5 | Environmental | Open in IMG/M |
| 3300024246 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK21 | Environmental | Open in IMG/M |
| 3300024347 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
| 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Host-Associated | Open in IMG/M |
| 3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
| 3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
| 3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031940 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2 | Environmental | Open in IMG/M |
| 3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
| 3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300034672 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034673 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E4A_00891400 | 2170459003 | Grass Soil | MKKVALALALVITALSLGGCFVGKGKAPAPVITKG |
| 4MG_03139210 | 2170459019 | Switchgrass, Maize And Mischanthus Litter | VQEPAFEQGYSVKKAALALALVVASLSLGGCFVGKGKAPAPIVTKG |
| 4NP_00393460 | 2170459021 | Switchgrass, Maize And Mischanthus Litter | SVKKVALAMALVVAALSLGGCFVGKGKAPAPIVTKG |
| ICChiseqgaiiDRAFT_18898311 | 3300000033 | Soil | MKKTALALALVVASLSLAGCFVGKGKAPAPIVTKG* |
| ICChiseqgaiiDRAFT_21791102 | 3300000033 | Soil | VKKVAVALALVVVSLSLAGCFVGKGKAPAPIVTKG* |
| JGI10216J12902_1013660921 | 3300000956 | Soil | MKKVALALALVVTALSLGGCFVGKGKAPAPVITKG* |
| JGI10216J12902_1025334533 | 3300000956 | Soil | VKKLALAVALVVAGLSLGGCFVGKGKAPAPVITKG* |
| JGI10216J12902_1044040723 | 3300000956 | Soil | MKRLALAVALVVAGLSLGGCFVGKGKAPAPVITKG* |
| Ga0063455_1004613082 | 3300004153 | Soil | MVCFFVYRPGQGQKMKKLVLALVLVVAGVSLGGCFVGKAPAPVITKG* |
| Ga0062595_1005586501 | 3300004479 | Soil | LYVRKQGNVMKKVALAFVLVVAGLSLGGCFVGKGKAPAPIVTKG* |
| Ga0062595_1009483061 | 3300004479 | Soil | MKQGCSVKKAALALALVVAALSLGGCFVGKGKAPTPIVTKG* |
| Ga0058859_116764861 | 3300004798 | Host-Associated | NRENAGGVNDEEAALAVALVVASLSLGGCFVGKGKAPAPIVTKG* |
| Ga0068869_1002664222 | 3300005334 | Miscanthus Rhizosphere | MLPSSPLTSNSGAEMKKVALALALVVAGLSLGGCFVGKGKAPAPVITKG* |
| Ga0068869_1002812442 | 3300005334 | Miscanthus Rhizosphere | MGCSVKKIALALALVVAGLSLGGCFVGKGKAPAPVITKG* |
| Ga0070701_111855561 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | LEKKGDSMKKVALALALVVTALSLGGCFVGKGKAPAPVITKG* |
| Ga0070700_1003601222 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MGDSVKKVALAMALVVAALSLGGCFVGKGKAPAPIVTKG* |
| Ga0070685_105533692 | 3300005466 | Switchgrass Rhizosphere | MKKVALALALVVTALSLGGCFVGKGKAPAPIVTKGRLNASGAVRS |
| Ga0066705_105620492 | 3300005569 | Soil | SSMKKAALAIALVVAALSLGGCFVGKGKAPAPIVTKG* |
| Ga0066905_1004005412 | 3300005713 | Tropical Forest Soil | VKKIAVAVALIVASMSLMGCFVGKGKTPPPVVTKG* |
| Ga0068866_108749742 | 3300005718 | Miscanthus Rhizosphere | VKKVAVALALVVASLSLAGCFVGKGKAPAPIVTKG* |
| Ga0068866_113043571 | 3300005718 | Miscanthus Rhizosphere | MKKTALALALVIASLSLAGCFVGKGKAPAPIVTKG* |
| Ga0068861_1016144071 | 3300005719 | Switchgrass Rhizosphere | VKKIALALALVVASLSLGGCFVGKGKAPAPIVTKG* |
| Ga0066903_1001024026 | 3300005764 | Tropical Forest Soil | MKKIALALALVVAGLSLGGCFVGKGKAPAPVVTKG* |
| Ga0066903_1061624972 | 3300005764 | Tropical Forest Soil | MKKLALALALVVAGLSLGGCFVGKGKAPAPVVTKG* |
| Ga0068870_113573002 | 3300005840 | Miscanthus Rhizosphere | MKKVALALALVVTALSLGGCFVGKGKAPTPIVTKG* |
| Ga0068863_1004222902 | 3300005841 | Switchgrass Rhizosphere | MKKVALALALVVAGLSLGGCFVGKGKAPAPVITKG* |
| Ga0068858_1003366253 | 3300005842 | Switchgrass Rhizosphere | MKKVALAFVLVVAGLSLGGCFVGKGKAPAPIVTKG* |
| Ga0068862_1020058382 | 3300005844 | Switchgrass Rhizosphere | NRGHSVKKAALALALVVAALSLGGCFVGKGKAPAPIVTKG* |
| Ga0070717_113304481 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | NRENAGGVTMRKLALAVALVVASLSLAGCFVGKGKAPAPIVTKG* |
| Ga0075365_105580662 | 3300006038 | Populus Endosphere | MKKVALALALVVAALSLGGCFVGKGKAPAPIVTKG* |
| Ga0075023_1001157801 | 3300006041 | Watersheds | MRKLAVAVALVVAALSLGGCFVGKGKSPAPVITKG* |
| Ga0075362_100652561 | 3300006177 | Populus Endosphere | MRALTIQNSSQGAGMKKVALALALVVAGLSLGGCFVGKGKAPAPVVTKG* |
| Ga0075366_104901341 | 3300006195 | Populus Endosphere | MRKFALAIALVITSLSLGGCFVGKGKAPAPVTVKG* |
| Ga0097621_1005795443 | 3300006237 | Miscanthus Rhizosphere | RKQGNVMKKVALAFVLVVAGLSLGGCFVGKGKAPAPIVTKG* |
| Ga0068871_1023980472 | 3300006358 | Miscanthus Rhizosphere | LESSMKKAALAIALVVAALSLGGCFVGKGKAPAPIVTKG* |
| Ga0075428_1027252481 | 3300006844 | Populus Rhizosphere | MKKVALALALVVAGLSLGGCFVGKGKAPAPVVTKG* |
| Ga0075429_1018104812 | 3300006880 | Populus Rhizosphere | MGRSMKKVALALALVVAGLSLGGCFVGKGKAPAPVVTKG* |
| Ga0105107_106659512 | 3300009087 | Freshwater Sediment | LGAVQVKGRSVKKVALALALVVAGLSLGGCFVGKGKAPAPIVTKG* |
| Ga0105245_127905742 | 3300009098 | Miscanthus Rhizosphere | MKKVALALALVIAGLSLGGCFIGKGKAPAPVVTKG* |
| Ga0105247_102483362 | 3300009101 | Switchgrass Rhizosphere | MKKVALALALVVAGLSLGGCFVGKGKAPAPIVTKG* |
| Ga0105247_103261591 | 3300009101 | Switchgrass Rhizosphere | MKKLVLAMALVVAGLSLGGCFVGKGKAPAPVVTKG* |
| Ga0105247_112794522 | 3300009101 | Switchgrass Rhizosphere | MKKVALALALVVTALSLGGCFVGKGKAPAPVVTKG* |
| Ga0114129_117609861 | 3300009147 | Populus Rhizosphere | MKKFALALALVVAGLSLGGCFVGKGKAPAPIVTKG* |
| Ga0105243_114314212 | 3300009148 | Miscanthus Rhizosphere | MKKFALALALVVAGLSLGGCFVGKGKAPAPVITKG* |
| Ga0111538_110759612 | 3300009156 | Populus Rhizosphere | MKKVALALALVVATLSLGGCFVGKGKAPAPIVTKG* |
| Ga0111538_120273681 | 3300009156 | Populus Rhizosphere | VKKIALALVLVVTSLSLGGCFVGKGKGKAPAPVTVKG* |
| Ga0105104_104065662 | 3300009168 | Freshwater Sediment | MKKVALALALVVTALSLGGCFVGKGKAPAPIVTKG* |
| Ga0105241_110354722 | 3300009174 | Corn Rhizosphere | MKKVALALVLVVAGLSLGGCFVGKGKAPAPVVTKG* |
| Ga0105248_108217191 | 3300009177 | Switchgrass Rhizosphere | EPAFEQGYSVKKAALALALVVASLSLGGCFVGKGKAPAPIVTKG* |
| Ga0105248_126443121 | 3300009177 | Switchgrass Rhizosphere | MKKAALAIALVMAALSLGGCFVGKGKAPAPIVTKG* |
| Ga0105238_105370512 | 3300009551 | Corn Rhizosphere | MKKVALALALVVAALSLGGCFVGKGKAPTPIVTKG* |
| Ga0105238_114147291 | 3300009551 | Corn Rhizosphere | MKKVALAFVLVVAGLSLGGCFVGKGKAPAPVVTKG* |
| Ga0105249_114294242 | 3300009553 | Switchgrass Rhizosphere | MKKAALALALVVTALSLGGCFVGKGKAPAPIVTKG* |
| Ga0105856_10502341 | 3300009662 | Permafrost Soil | MKKFALAIALVVTALSLGGCFVGKGKGKTPAPISTRN* |
| Ga0126307_112385452 | 3300009789 | Serpentine Soil | MGDSVKKVALAMALVVAALSLGGCFVGKGKAPTPIITKG* |
| Ga0126315_102869171 | 3300010038 | Serpentine Soil | VKKIALALVLVVAGLSLGGCFVGKGKAPAPVITKG* |
| Ga0126312_106603001 | 3300010041 | Serpentine Soil | MKNLALGLALMVAGLSLGGCFVGKGKAPAPVITKG* |
| Ga0126306_105144611 | 3300010166 | Serpentine Soil | MKQGCSVKKAALALALVVAALSLGGCFVGKGKTPTPIVTKG* |
| Ga0126306_118847012 | 3300010166 | Serpentine Soil | VKKIALAMVLVVAGLSLGGCFVGKGKAPAPVITKG* |
| Ga0126378_100579774 | 3300010361 | Tropical Forest Soil | VKKVALAFALVVASLSLTGCFVGKGKAPPPPVVTKG* |
| Ga0126377_127714372 | 3300010362 | Tropical Forest Soil | MKKFAVAMALVIASLSLGGCFVGKGKAPAPVITKG* |
| Ga0134128_123224241 | 3300010373 | Terrestrial Soil | MGFINGERVMKKFALALALVVAGLSLGGCFVGKGKAPAPVVTKG* |
| Ga0134128_132004082 | 3300010373 | Terrestrial Soil | CSRQKEGDDMKKVALALVLVVAGLSLGGCFVGKGKAPAPVVTKG* |
| Ga0134124_101011474 | 3300010397 | Terrestrial Soil | MKKVALALVLVVAGLSLGGCFVGKDKAPAPIVTKG* |
| Ga0134124_107192132 | 3300010397 | Terrestrial Soil | MKKVALALALVIAGLSLGGCFVGKGKAPAPVVTKG* |
| Ga0134122_125705242 | 3300010400 | Terrestrial Soil | SMRKLALAVALVVASLSLAGCFVGKGKAPAPIVTKG* |
| Ga0134121_102022972 | 3300010401 | Terrestrial Soil | MKKVALALALVVAGLSLGGCFVGKGKAPSPIVTKG* |
| Ga0134123_100295961 | 3300010403 | Terrestrial Soil | MRKLALAVALVVASLSLGGCFVGKGKAPAPLVTTG* |
| Ga0126346_14414291 | 3300010865 | Boreal Forest Soil | KAGDLPMKKAALALALVVASLSLAGCFVGKGKTPAPAPIVTKG* |
| Ga0105246_109559722 | 3300011119 | Miscanthus Rhizosphere | MKKAALAIALVVAALSLGGCFVGKGKAPAPIVTKG* |
| Ga0126317_105722891 | 3300011332 | Soil | MKKVALALALVVTALSLSGCFVGKGKAPTPIVTKG* |
| Ga0137424_11132641 | 3300011412 | Soil | MKKLAVVIALVVTSLSLAGCFVGKGKGKAPPPPVVTKG* |
| Ga0137382_106057482 | 3300012200 | Vadose Zone Soil | MKKVALALVLVVAGLILGGCFVGKGKAPAPIVTKG* |
| Ga0150985_1049479651 | 3300012212 | Avena Fatua Rhizosphere | HWHTGNVMKKAALALALVVAGLSLGGCFVGKGKAPAPIVTKG* |
| Ga0150985_1052228722 | 3300012212 | Avena Fatua Rhizosphere | MKKLAVAIALVVASLSLTGCFVGKGKAPAPVITKG* |
| Ga0150985_1056017811 | 3300012212 | Avena Fatua Rhizosphere | GISMNKVALALALVVTGLSLGGCFVGKGKAPAPIVTKG* |
| Ga0150985_1074346291 | 3300012212 | Avena Fatua Rhizosphere | MKKVALALALVVAGLSLAGCFVGKGKAPAPVVTKG* |
| Ga0150985_1085133252 | 3300012212 | Avena Fatua Rhizosphere | MKKVALALALVVIALSLGGCFVGKGKAPAPIVTKG* |
| Ga0150985_1091800271 | 3300012212 | Avena Fatua Rhizosphere | KKVALALVLVVAGLSLGGCFVGKGKAPAPIVTKG* |
| Ga0150985_1108691384 | 3300012212 | Avena Fatua Rhizosphere | VKQGDVMKKVALALALVVAGLSLGGCFVGKGKAPAPIVTKG* |
| Ga0150985_1130458981 | 3300012212 | Avena Fatua Rhizosphere | LEGTVKKIALALVVTVTALSLGGCFVGKGKAPAPIATRG* |
| Ga0150985_1132928502 | 3300012212 | Avena Fatua Rhizosphere | MNKIALAVALVVTALSLGGCFVGKGKAPAPIVTKG* |
| Ga0150985_1189784362 | 3300012212 | Avena Fatua Rhizosphere | ARKTGRESMKKLALALALVVTSLSLGGCFVGKGKAPAPVVTKG* |
| Ga0150985_1227751041 | 3300012212 | Avena Fatua Rhizosphere | QEPAFEQGYSVKKAALALALVVASLSLGGCFVGKGKAPAPIVTKG* |
| Ga0150984_1034146673 | 3300012469 | Avena Fatua Rhizosphere | MKQIALALVLVVAGLSLGGCFVGKGKAPAPIVTTG* |
| Ga0150984_1056145542 | 3300012469 | Avena Fatua Rhizosphere | MVESIRCNNGLEGTVKKIALALVVTVTALSLGGCFVGKGKAPAPIATRG* |
| Ga0150984_1080603861 | 3300012469 | Avena Fatua Rhizosphere | MKKAALALTLVVTALSLGGCFVGKGKAPAPIVTKG* |
| Ga0150984_1091774231 | 3300012469 | Avena Fatua Rhizosphere | TVEDDMRKLAVAVALVIAGLSLGGCFVGKGKAPAPVVTKG* |
| Ga0150984_1103414142 | 3300012469 | Avena Fatua Rhizosphere | GDSMKKVALALALVVTTLSLGGCFVGKGKAPAPIVTKG* |
| Ga0150984_1112613923 | 3300012469 | Avena Fatua Rhizosphere | MKKVALALALVVAGLSLAGCFVGKGKAPAPIVTKG* |
| Ga0150984_1180275502 | 3300012469 | Avena Fatua Rhizosphere | LIRSRPNKGRLVKKIALAMALVVVGLSLGGCFVGKGKAPAPIVTKG* |
| Ga0150984_1182687921 | 3300012469 | Avena Fatua Rhizosphere | KTGRESMKKLALALALVVTSLSLGGCFVGKGKAPAPVVTKG* |
| Ga0150984_1197481961 | 3300012469 | Avena Fatua Rhizosphere | AYWGISMKKVALALALVVAALSLGGCFVGKGKAPAPIVTKG* |
| Ga0150984_1199624041 | 3300012469 | Avena Fatua Rhizosphere | IHWHTGNVMKKAALALALVVAGLSLGGCFVGKGKAPAPIVTKG* |
| Ga0150984_1206286752 | 3300012469 | Avena Fatua Rhizosphere | VLFRSQGQKMKKLVLALVLVVAGVSLGGCFVGKAPAPVITKG* |
| Ga0150984_1209505801 | 3300012469 | Avena Fatua Rhizosphere | ENTVKRGYSMKKLAVAIALVVASLSLTGCFVGKGKAPAPVITKG* |
| Ga0157305_100762222 | 3300012891 | Soil | MKKFALALALVITSLSLGGCFVGKGKTPAPVITRG* |
| Ga0157294_100186022 | 3300012892 | Soil | MDMKKVALALALVVTALSLGGCFVGKGKAPAPVITKG* |
| Ga0157292_103168852 | 3300012900 | Soil | VKKVAVALALVVASLSLAGCYVGKGKAPAPIVTKG* |
| Ga0157295_103337072 | 3300012906 | Soil | KENPMKKIALALALVVASLSLAGCFVGKGKAPAPIVTKG* |
| Ga0157297_103812411 | 3300012914 | Soil | GYSVKKAALALALVVASLSLGGCFVGKGKAPAPIVTKG* |
| Ga0137407_114112261 | 3300012930 | Vadose Zone Soil | MKSFALAVALVVAGLSLGGCFVGKGKAPAPVITKG* |
| Ga0164299_103958032 | 3300012958 | Soil | FLIVRLQFAYWEISMKKVALAFALVVVALSLGGCFVGKGKAPAPIVTKG* |
| Ga0164299_111342082 | 3300012958 | Soil | MKKVALALVLVVAGLCLGGCFVGKGKAPAPIVTKG* |
| Ga0164301_104899632 | 3300012960 | Soil | MKKVALAFVLVVAGLSLGGCFVGKGKAPASIVTKG* |
| Ga0164302_113191521 | 3300012961 | Soil | MRSNKRRAYVKKLALAVALVVGSLRLVGCFVGNGKAPPPVVTKG* |
| Ga0163163_101867944 | 3300014325 | Switchgrass Rhizosphere | SVKKVALAMALVVAALSLGGCFVGKGKAPAPIVTKG* |
| Ga0163163_117297472 | 3300014325 | Switchgrass Rhizosphere | MKKIALALALVVASLSLGGGFVGKGKAPAPIVTKG* |
| Ga0163163_121985732 | 3300014325 | Switchgrass Rhizosphere | SNSGAEMKKVALALALVVAGLSLGGCFVGKGKAPAPVITKG* |
| Ga0163163_126023742 | 3300014325 | Switchgrass Rhizosphere | GDTMKKVALALALVVAALSLGGCFVGKGKAPAPIVTKG* |
| Ga0157380_106520772 | 3300014326 | Switchgrass Rhizosphere | MGDSVKKVALAMALVVAALSLGGCFVGKGKATAPIVTKG* |
| Ga0157376_107795742 | 3300014969 | Miscanthus Rhizosphere | MKKTALVLALVIASLSLAGCFVGKGKAPAPIVTKG* |
| Ga0157376_119005761 | 3300014969 | Miscanthus Rhizosphere | GNYMKKVALALALVVTALSLGGCFVGKGKAPAPIVTKG* |
| Ga0173480_104397582 | 3300015200 | Soil | MKNVALALALLVAALSLGGCFVGKGKAPAPIVTKG* |
| Ga0163161_120400451 | 3300017792 | Switchgrass Rhizosphere | AIKSQSGRKITKRGSSMKKFALALALVVAGLSLGGCFVGKGKAPAPVITKG |
| Ga0190266_110735082 | 3300017965 | Soil | MKKVALALALVVTALSLGGCFVGKGKAPAPVITKG |
| Ga0190265_118040951 | 3300018422 | Soil | MKKVTIALALVVASLSLAGCFVGKGKGKAPAPVVTKG |
| Ga0190272_106507622 | 3300018429 | Soil | MKKLVIAVALVVTALSLGGCFVGKGKGKAPAPVVTKG |
| Ga0190275_110450172 | 3300018432 | Soil | MKKLAVVIALVVTSLSLAGCFVGKGKGKAPPPPVVTKG |
| Ga0190268_103982271 | 3300018466 | Soil | VKKLALAVALVVAGLSLGGCFVGKGKAPAPVITKG |
| Ga0190270_100009819 | 3300018469 | Soil | MKKVAVAMALIVASLSLAGCFVGKGKGKAPAPVVTKG |
| Ga0190270_100424173 | 3300018469 | Soil | MKRLALAVALVVAGLSLGGCFVGKGKAPAPVITKG |
| Ga0190270_102388162 | 3300018469 | Soil | MKKLAAVIALVVTSLSLAGCFVGKGKGKAPPPPVVTKG |
| Ga0190270_109777721 | 3300018469 | Soil | MKKFALAIALVVTSLSLAGCFVGKGKGKAPPPVVTKG |
| Ga0190270_110238632 | 3300018469 | Soil | LDEDWSVKKAALALALVVASLSLGGCFVGKGKAPPPVVTKG |
| Ga0190270_113978802 | 3300018469 | Soil | MKKFALALALVITSLSLGGCFVGKGKTPAPVITRG |
| Ga0190270_126788542 | 3300018469 | Soil | DMKKVALALALVVTALSLGGCFVGKGKAPAPVITKG |
| Ga0190274_100048544 | 3300018476 | Soil | MKQGCSVKKAALALALVVAALSLGGCFVGKGKAPTPIVTKG |
| Ga0190274_100185872 | 3300018476 | Soil | MKKLAVAMALIVASLSLGGCFVGKGKGKAPPPVVTKG |
| Ga0190274_104327343 | 3300018476 | Soil | MKKVALALALVFTALSLGGCFVGKGKAPTPIVTKG |
| Ga0190274_113717201 | 3300018476 | Soil | MFMKKVALALALVVTALSLGGCFVGKGKAPAPVITKG |
| Ga0190274_113789832 | 3300018476 | Soil | MKKVVLALALVVTTLSLGGCFVGKGKAPAPVITKG |
| Ga0190274_123403662 | 3300018476 | Soil | MKKFALAMALVITSLSLGGCFVGKGKAPAPVITKG |
| Ga0190271_102597582 | 3300018481 | Soil | MKKVALALALLVTALSLGGCFVGKGKAPTPIVTKG |
| Ga0190271_113004422 | 3300018481 | Soil | MDMKKVALALALVVTALSLGGCFVGKGKAPAPVITKG |
| Ga0190271_115669941 | 3300018481 | Soil | SNREGLRMKKVAVAMALIVASLSLAGCFVGKGKGKAPAPVVTKG |
| Ga0190271_119132061 | 3300018481 | Soil | KGGYSMKKVALALALVVTALSLGGCFVGKGKAPAPVITKG |
| Ga0173481_101865772 | 3300019356 | Soil | MKKVALALALVVTALSLGGCFVGKGKAPAPIVTKG |
| Ga0173481_105032342 | 3300019356 | Soil | VKKVAVALALVVASLSLAGCFVGKGKAPAPIVTKG |
| Ga0173481_108668651 | 3300019356 | Soil | MKKVALALALVVATLSLGGCFVGKGKAPAPIVTKG |
| Ga0190264_115313231 | 3300019377 | Soil | MRNRDVNFTRKVGRRTMKRLALAVALVVAGLSLGGCFVGKGKAPAPVVTKG |
| Ga0187892_101836701 | 3300019458 | Bio-Ooze | MKKVALALALVVAGLSLGGCFVGKGKAPAPVVTKG |
| Ga0210380_100056806 | 3300021082 | Groundwater Sediment | MGDSVKKVALAMALVVAALSLGGCFVGKGKAPAPIVTKG |
| Ga0126371_100692903 | 3300021560 | Tropical Forest Soil | VKKVALAFALVVASLSLTGCFVGKGKAPPPPVVTKG |
| Ga0242665_102942122 | 3300022724 | Soil | GFSVKKVALAFALVVASLSLAGCFVGKGKAPPPPVITKG |
| Ga0247788_11059322 | 3300022901 | Soil | MGDSVKKVALAMALVVAALSLGGCFVGKGKAPAPI |
| Ga0247783_11321891 | 3300022911 | Plant Litter | VRFLFIYKQEAGMKKLAVAMALIVASLSLGGCFVGKGKGKAPPPVVTKG |
| Ga0247777_12579741 | 3300022917 | Plant Litter | YKQEAGMKKLAVAMALIVASLSLGGCFVGKGKGKAPPPVVTKG |
| Ga0247754_10840732 | 3300023102 | Soil | MKQGCSVKKAALALALVVAALSLGGCFVGKGKTPTPIVT |
| Ga0247680_10349602 | 3300024246 | Soil | MKKVALALVLVVAGLSLGGCFVGKGKAPAPVITKG |
| Ga0179591_10069672 | 3300024347 | Vadose Zone Soil | MKSFALAVALVVAGLSLGGCFVGKGKAPAPVITKG |
| Ga0179591_10098752 | 3300024347 | Vadose Zone Soil | MKKAALAIALVVAALSLGGCFVGKGKAPAPIVTKG |
| Ga0207680_107251521 | 3300025903 | Switchgrass Rhizosphere | MKKAALAIALVVSALSLGGCFVGKGKAPAPIVTKG |
| Ga0207645_111024181 | 3300025907 | Miscanthus Rhizosphere | MKKIALALALVVTALSLGGCFVGKGKAPAPVVTKG |
| Ga0207662_111037402 | 3300025918 | Switchgrass Rhizosphere | MKKVALALALVVTALSLGGCFVGKGKAPAPVVTKG |
| Ga0207711_121413831 | 3300025941 | Switchgrass Rhizosphere | EQGYSVKKAALALALVVASLSLGGCFVGKGKAPAPIVTKG |
| Ga0207683_100481816 | 3300026121 | Miscanthus Rhizosphere | MKKVALALALVVTALSLGGCFVGKGKAPAPIITKG |
| Ga0209155_11679482 | 3300026316 | Soil | MLSFWFKQGNIMKKVAVAFVLVVAALSLGGCFVGKGKAPAPIVTKG |
| Ga0207428_113191871 | 3300027907 | Populus Rhizosphere | MGRSMKKVALALALVVAGLSLGGCFVGKGKAPAPVVTKG |
| Ga0209583_101518032 | 3300027910 | Watersheds | MRKLAVAVALVVAALSLGGCFVGKGKSPAPVITKG |
| Ga0209069_108054792 | 3300027915 | Watersheds | VKKVAIALALVVVSLSLAGCFVGKGKAPAPIVTKG |
| Ga0247825_111237561 | 3300028812 | Soil | VKKVAIALALVVASMSLAGCFVGKGKAPAPAPVVTKG |
| Ga0265331_105608012 | 3300031250 | Rhizosphere | MKKVAVALALVVVSLSLAGCFVGKGKAPAPIVTKG |
| Ga0308194_100432551 | 3300031421 | Soil | LVKKVALALALVVASLSLGGCFVGKGKTPAPVISPRG |
| Ga0308194_103856222 | 3300031421 | Soil | SVKKAALALALVVAALSLGGCFVGKGKAPAPIVTKG |
| Ga0310888_100156313 | 3300031538 | Soil | MKKLAVVVALVVTSLSLGGCFVGKGKAPPPVVTKG |
| Ga0310887_108667021 | 3300031547 | Soil | VKKLALALALVVVGLSLGGCFVGKGKAPPPVVTKG |
| Ga0302321_1035887821 | 3300031726 | Fen | FSRGTDFQEGGLIMKKVALALALVAASLSLAGCFVGKGKAPPAPIVTKG |
| Ga0310907_103298302 | 3300031847 | Soil | MKKVALALALVVTTLSLGGCFVGKGKAPAPVVTKG |
| Ga0310907_105166742 | 3300031847 | Soil | MKKAALALALVVTALSLGGCFVGKGKAPAPIVTKG |
| Ga0310907_108402822 | 3300031847 | Soil | MGDSVKKVALAMALVVAALSLGGCFVGKGKAPAPIVTK |
| Ga0302322_1015150931 | 3300031902 | Fen | EVLVKKIAVALALVVVSMSLAGCFVGKGKAPAPIVTKG |
| Ga0310900_109770171 | 3300031908 | Soil | MKKFVLAMALVITSLSLGGCFVGKGKAPAPVVTKG |
| Ga0310900_114193282 | 3300031908 | Soil | MKNLAVAFALVVVSLSLAGCFVGKGKAPAPIVTKG |
| Ga0310901_101300273 | 3300031940 | Soil | GYSVKKAALALALVVASLSLGGCFVGKGKAPAPIVTKG |
| Ga0310903_105532793 | 3300032000 | Soil | TKGRKKTGDSMKKVALALALVVTALSLGGCFVGKGKAPAPIVTKG |
| Ga0310897_102402531 | 3300032003 | Soil | RLQFAHLESSMKKAALAIALVVAALSLGGCFVGKGKAPAPIVTKG |
| Ga0326726_105113301 | 3300033433 | Peat Soil | MSNTFVKKVALALVLVVATLSLGGCFVGKGKGKGPAPISTRG |
| Ga0314797_059828_483_590 | 3300034672 | Soil | MKKVALALALVITALSLGGCFVGKGKAPAPIVTKG |
| Ga0314798_080968_339_446 | 3300034673 | Soil | MTKVALALALVVAALSLGGCFVGKGKAPAPIVTKG |
| ⦗Top⦘ |