| Basic Information | |
|---|---|
| Family ID | F032341 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 180 |
| Average Sequence Length | 38 residues |
| Representative Sequence | MSNCHLVAGRSLIDLAASRLALRAPALRAATALTRPN |
| Number of Associated Samples | 113 |
| Number of Associated Scaffolds | 180 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 98.89 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 84.44 % |
| Associated GOLD sequencing projects | 104 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (87.222 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (30.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (56.111 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.77% β-sheet: 0.00% Coil/Unstructured: 49.23% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 180 Family Scaffolds |
|---|---|---|
| PF04392 | ABC_sub_bind | 76.67 |
| PF03401 | TctC | 3.89 |
| PF01925 | TauE | 1.11 |
| PF13545 | HTH_Crp_2 | 0.56 |
| PF00805 | Pentapeptide | 0.56 |
| PF08924 | DUF1906 | 0.56 |
| PF13586 | DDE_Tnp_1_2 | 0.56 |
| PF07045 | DUF1330 | 0.56 |
| PF02371 | Transposase_20 | 0.56 |
| PF09250 | Prim-Pol | 0.56 |
| PF11154 | DUF2934 | 0.56 |
| PF05572 | Peptidase_M43 | 0.56 |
| PF01425 | Amidase | 0.56 |
| PF00561 | Abhydrolase_1 | 0.56 |
| COG ID | Name | Functional Category | % Frequency in 180 Family Scaffolds |
|---|---|---|---|
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 76.67 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 3.89 |
| COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 1.11 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.56 |
| COG1357 | Uncharacterized conserved protein YjbI, contains pentapeptide repeats | Function unknown [S] | 0.56 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.56 |
| COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 0.56 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 87.78 % |
| Unclassified | root | N/A | 12.22 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005332|Ga0066388_103831958 | Not Available | 767 | Open in IMG/M |
| 3300005363|Ga0008090_10214364 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300005536|Ga0070697_100420441 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 1161 | Open in IMG/M |
| 3300005536|Ga0070697_100581581 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 983 | Open in IMG/M |
| 3300005598|Ga0066706_11285391 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 554 | Open in IMG/M |
| 3300005614|Ga0068856_101975543 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300005713|Ga0066905_100288371 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1282 | Open in IMG/M |
| 3300005713|Ga0066905_100824199 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 806 | Open in IMG/M |
| 3300005764|Ga0066903_100131973 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3517 | Open in IMG/M |
| 3300005764|Ga0066903_100132169 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 3515 | Open in IMG/M |
| 3300005764|Ga0066903_101326490 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1346 | Open in IMG/M |
| 3300005764|Ga0066903_102561364 | All Organisms → cellular organisms → Bacteria | 988 | Open in IMG/M |
| 3300005764|Ga0066903_103244032 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 879 | Open in IMG/M |
| 3300005764|Ga0066903_103685383 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
| 3300005764|Ga0066903_104805425 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 718 | Open in IMG/M |
| 3300005764|Ga0066903_105522985 | Not Available | 666 | Open in IMG/M |
| 3300006038|Ga0075365_10141903 | All Organisms → cellular organisms → Bacteria | 1667 | Open in IMG/M |
| 3300006177|Ga0075362_10372408 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300006844|Ga0075428_100105840 | All Organisms → cellular organisms → Bacteria | 3067 | Open in IMG/M |
| 3300006845|Ga0075421_100065363 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4593 | Open in IMG/M |
| 3300006847|Ga0075431_100218380 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1945 | Open in IMG/M |
| 3300006853|Ga0075420_100966742 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300009094|Ga0111539_12833879 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300009147|Ga0114129_13006254 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300009792|Ga0126374_11328119 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 582 | Open in IMG/M |
| 3300010037|Ga0126304_11229596 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 514 | Open in IMG/M |
| 3300010038|Ga0126315_10533626 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. JYMT SZCCT0428 | 751 | Open in IMG/M |
| 3300010046|Ga0126384_10312663 | Not Available | 1296 | Open in IMG/M |
| 3300010048|Ga0126373_10099840 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2682 | Open in IMG/M |
| 3300010159|Ga0099796_10330132 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300010358|Ga0126370_10513930 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
| 3300010358|Ga0126370_10590254 | All Organisms → cellular organisms → Bacteria | 957 | Open in IMG/M |
| 3300010360|Ga0126372_12069518 | Not Available | 617 | Open in IMG/M |
| 3300010361|Ga0126378_10394908 | All Organisms → cellular organisms → Bacteria | 1495 | Open in IMG/M |
| 3300010361|Ga0126378_10743955 | All Organisms → cellular organisms → Bacteria | 1091 | Open in IMG/M |
| 3300010362|Ga0126377_10625435 | Not Available | 1123 | Open in IMG/M |
| 3300010366|Ga0126379_12294706 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 640 | Open in IMG/M |
| 3300012204|Ga0137374_10121542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2401 | Open in IMG/M |
| 3300012205|Ga0137362_10027366 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4478 | Open in IMG/M |
| 3300012350|Ga0137372_10241790 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1424 | Open in IMG/M |
| 3300012361|Ga0137360_10099829 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2218 | Open in IMG/M |
| 3300012361|Ga0137360_11239134 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 645 | Open in IMG/M |
| 3300012362|Ga0137361_10391513 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1276 | Open in IMG/M |
| 3300012362|Ga0137361_10524457 | All Organisms → cellular organisms → Bacteria | 1088 | Open in IMG/M |
| 3300012362|Ga0137361_11095042 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 717 | Open in IMG/M |
| 3300012948|Ga0126375_10230665 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1239 | Open in IMG/M |
| 3300012971|Ga0126369_10544624 | Not Available | 1224 | Open in IMG/M |
| 3300016294|Ga0182041_10494995 | Not Available | 1059 | Open in IMG/M |
| 3300016319|Ga0182033_10408946 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1149 | Open in IMG/M |
| 3300016319|Ga0182033_10493880 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Bremerella → Bremerella volcania | 1050 | Open in IMG/M |
| 3300016341|Ga0182035_10633707 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 926 | Open in IMG/M |
| 3300016341|Ga0182035_10779490 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 838 | Open in IMG/M |
| 3300016341|Ga0182035_10872651 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 793 | Open in IMG/M |
| 3300016341|Ga0182035_10904398 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300016341|Ga0182035_11381933 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300016357|Ga0182032_10195135 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1537 | Open in IMG/M |
| 3300016357|Ga0182032_10200699 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 6(2017) | 1518 | Open in IMG/M |
| 3300016371|Ga0182034_10137786 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1814 | Open in IMG/M |
| 3300016387|Ga0182040_10365322 | All Organisms → cellular organisms → Bacteria | 1123 | Open in IMG/M |
| 3300016387|Ga0182040_11228722 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 631 | Open in IMG/M |
| 3300016387|Ga0182040_11662207 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 545 | Open in IMG/M |
| 3300016404|Ga0182037_11225432 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300016404|Ga0182037_11675277 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 566 | Open in IMG/M |
| 3300016422|Ga0182039_10056789 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2696 | Open in IMG/M |
| 3300016422|Ga0182039_12239130 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300016445|Ga0182038_10267726 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1382 | Open in IMG/M |
| 3300016445|Ga0182038_10397223 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1155 | Open in IMG/M |
| 3300016445|Ga0182038_10548362 | All Organisms → cellular organisms → Bacteria | 992 | Open in IMG/M |
| 3300016445|Ga0182038_11433104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 619 | Open in IMG/M |
| 3300016445|Ga0182038_12125768 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 509 | Open in IMG/M |
| 3300018028|Ga0184608_10116152 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1131 | Open in IMG/M |
| 3300018054|Ga0184621_10083454 | All Organisms → cellular organisms → Bacteria | 1114 | Open in IMG/M |
| 3300018066|Ga0184617_1033346 | All Organisms → cellular organisms → Bacteria | 1233 | Open in IMG/M |
| 3300018072|Ga0184635_10258583 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 688 | Open in IMG/M |
| 3300018081|Ga0184625_10256559 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
| 3300018081|Ga0184625_10317227 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 813 | Open in IMG/M |
| 3300019867|Ga0193704_1096266 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 522 | Open in IMG/M |
| 3300021078|Ga0210381_10250953 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300021478|Ga0210402_10896224 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 813 | Open in IMG/M |
| 3300021478|Ga0210402_11390694 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300021560|Ga0126371_11417281 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
| 3300022694|Ga0222623_10072550 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1334 | Open in IMG/M |
| 3300022694|Ga0222623_10084939 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1228 | Open in IMG/M |
| 3300022756|Ga0222622_11037556 | Not Available | 603 | Open in IMG/M |
| 3300025910|Ga0207684_10217327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1649 | Open in IMG/M |
| 3300025928|Ga0207700_11409326 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 619 | Open in IMG/M |
| 3300026555|Ga0179593_1156983 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1955 | Open in IMG/M |
| 3300028707|Ga0307291_1016742 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1638 | Open in IMG/M |
| 3300028708|Ga0307295_10174838 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 603 | Open in IMG/M |
| 3300028711|Ga0307293_10184173 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 665 | Open in IMG/M |
| 3300028715|Ga0307313_10051088 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1211 | Open in IMG/M |
| 3300028717|Ga0307298_10018643 | Not Available | 1787 | Open in IMG/M |
| 3300028755|Ga0307316_10055946 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1331 | Open in IMG/M |
| 3300028784|Ga0307282_10131169 | All Organisms → cellular organisms → Bacteria | 1179 | Open in IMG/M |
| 3300028790|Ga0307283_10158537 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 628 | Open in IMG/M |
| 3300028809|Ga0247824_10942829 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Pseudorhodoplanes → Pseudorhodoplanes sinuspersici | 542 | Open in IMG/M |
| 3300028824|Ga0307310_10461631 | Not Available | 636 | Open in IMG/M |
| 3300028876|Ga0307286_10172173 | Not Available | 780 | Open in IMG/M |
| 3300029999|Ga0311339_10422185 | All Organisms → cellular organisms → Bacteria | 1383 | Open in IMG/M |
| 3300031545|Ga0318541_10176620 | Not Available | 1178 | Open in IMG/M |
| 3300031545|Ga0318541_10265096 | Not Available | 955 | Open in IMG/M |
| 3300031561|Ga0318528_10251783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 947 | Open in IMG/M |
| 3300031564|Ga0318573_10029880 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 6(2017) | 2541 | Open in IMG/M |
| 3300031572|Ga0318515_10037808 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 6(2017) | 2386 | Open in IMG/M |
| 3300031573|Ga0310915_10040801 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2955 | Open in IMG/M |
| 3300031573|Ga0310915_10261958 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1217 | Open in IMG/M |
| 3300031573|Ga0310915_11170152 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300031680|Ga0318574_10005243 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 5466 | Open in IMG/M |
| 3300031719|Ga0306917_10215849 | Not Available | 1458 | Open in IMG/M |
| 3300031719|Ga0306917_10315426 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1210 | Open in IMG/M |
| 3300031719|Ga0306917_10911590 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300031720|Ga0307469_10727103 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 903 | Open in IMG/M |
| 3300031723|Ga0318493_10687938 | Not Available | 573 | Open in IMG/M |
| 3300031724|Ga0318500_10032724 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 6(2017) | 2098 | Open in IMG/M |
| 3300031724|Ga0318500_10129613 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1172 | Open in IMG/M |
| 3300031724|Ga0318500_10228363 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 898 | Open in IMG/M |
| 3300031744|Ga0306918_10008192 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. JGI PP 4-B12 | 5778 | Open in IMG/M |
| 3300031747|Ga0318502_10017833 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3380 | Open in IMG/M |
| 3300031763|Ga0318537_10158171 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 844 | Open in IMG/M |
| 3300031768|Ga0318509_10130303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1377 | Open in IMG/M |
| 3300031794|Ga0318503_10010740 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 6(2017) | 2403 | Open in IMG/M |
| 3300031805|Ga0318497_10159029 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1239 | Open in IMG/M |
| 3300031805|Ga0318497_10567134 | Not Available | 637 | Open in IMG/M |
| 3300031805|Ga0318497_10765202 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 541 | Open in IMG/M |
| 3300031821|Ga0318567_10193829 | Not Available | 1133 | Open in IMG/M |
| 3300031833|Ga0310917_10038112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 6(2017) | 2888 | Open in IMG/M |
| 3300031833|Ga0310917_10582312 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 760 | Open in IMG/M |
| 3300031846|Ga0318512_10110510 | All Organisms → Viruses → Predicted Viral | 1299 | Open in IMG/M |
| 3300031879|Ga0306919_10261523 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1304 | Open in IMG/M |
| 3300031879|Ga0306919_10744303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 754 | Open in IMG/M |
| 3300031890|Ga0306925_10074798 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3569 | Open in IMG/M |
| 3300031890|Ga0306925_10456625 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1365 | Open in IMG/M |
| 3300031897|Ga0318520_10440956 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 799 | Open in IMG/M |
| 3300031910|Ga0306923_10708523 | All Organisms → cellular organisms → Bacteria | 1120 | Open in IMG/M |
| 3300031912|Ga0306921_10253232 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 2063 | Open in IMG/M |
| 3300031912|Ga0306921_10554670 | All Organisms → cellular organisms → Bacteria | 1332 | Open in IMG/M |
| 3300031912|Ga0306921_10657589 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1207 | Open in IMG/M |
| 3300031912|Ga0306921_11393117 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
| 3300031941|Ga0310912_10057402 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 6(2017) | 2757 | Open in IMG/M |
| 3300031942|Ga0310916_10120555 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2132 | Open in IMG/M |
| 3300031942|Ga0310916_11141355 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 646 | Open in IMG/M |
| 3300031945|Ga0310913_10881069 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300031945|Ga0310913_11175327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 534 | Open in IMG/M |
| 3300031946|Ga0310910_10099744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2153 | Open in IMG/M |
| 3300031946|Ga0310910_10431060 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1045 | Open in IMG/M |
| 3300031947|Ga0310909_10346711 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1246 | Open in IMG/M |
| 3300031947|Ga0310909_10402090 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1150 | Open in IMG/M |
| 3300031947|Ga0310909_11499598 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300031954|Ga0306926_10123350 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 3195 | Open in IMG/M |
| 3300031954|Ga0306926_11658864 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300031954|Ga0306926_12108359 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 631 | Open in IMG/M |
| 3300031959|Ga0318530_10153241 | All Organisms → cellular organisms → Bacteria | 937 | Open in IMG/M |
| 3300032001|Ga0306922_11418415 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 697 | Open in IMG/M |
| 3300032010|Ga0318569_10018743 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 6(2017) | 2752 | Open in IMG/M |
| 3300032010|Ga0318569_10218140 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
| 3300032025|Ga0318507_10046922 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1683 | Open in IMG/M |
| 3300032035|Ga0310911_10131033 | All Organisms → cellular organisms → Bacteria | 1399 | Open in IMG/M |
| 3300032035|Ga0310911_10900280 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300032041|Ga0318549_10081818 | Not Available | 1385 | Open in IMG/M |
| 3300032042|Ga0318545_10114419 | All Organisms → cellular organisms → Bacteria | 949 | Open in IMG/M |
| 3300032051|Ga0318532_10055975 | Not Available | 1358 | Open in IMG/M |
| 3300032051|Ga0318532_10123500 | All Organisms → cellular organisms → Bacteria | 917 | Open in IMG/M |
| 3300032059|Ga0318533_10195839 | Not Available | 1445 | Open in IMG/M |
| 3300032060|Ga0318505_10082698 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1432 | Open in IMG/M |
| 3300032076|Ga0306924_10006920 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 11319 | Open in IMG/M |
| 3300032076|Ga0306924_12450299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 525 | Open in IMG/M |
| 3300032094|Ga0318540_10359907 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300032180|Ga0307471_100745678 | All Organisms → cellular organisms → Bacteria | 1145 | Open in IMG/M |
| 3300032180|Ga0307471_101040602 | All Organisms → cellular organisms → Bacteria | 985 | Open in IMG/M |
| 3300032261|Ga0306920_100269749 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 2537 | Open in IMG/M |
| 3300032261|Ga0306920_100657358 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1547 | Open in IMG/M |
| 3300032261|Ga0306920_100952089 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1253 | Open in IMG/M |
| 3300032261|Ga0306920_101201277 | Not Available | 1095 | Open in IMG/M |
| 3300032261|Ga0306920_102482532 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300032261|Ga0306920_102922586 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300032261|Ga0306920_103060858 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 629 | Open in IMG/M |
| 3300033289|Ga0310914_10080706 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 6(2017) | 2759 | Open in IMG/M |
| 3300033289|Ga0310914_10246058 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1606 | Open in IMG/M |
| 3300033289|Ga0310914_10309539 | Not Available | 1425 | Open in IMG/M |
| 3300033289|Ga0310914_11676925 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 30.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 27.22% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.22% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.11% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 6.11% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.56% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.33% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.33% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.22% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.67% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.67% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.11% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 1.11% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.56% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.56% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.56% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.56% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
| 3300006177 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Host-Associated | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018066 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1 | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300019867 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m1 | Environmental | Open in IMG/M |
| 3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300028707 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148 | Environmental | Open in IMG/M |
| 3300028708 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152 | Environmental | Open in IMG/M |
| 3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
| 3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
| 3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
| 3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028790 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_122 | Environmental | Open in IMG/M |
| 3300028809 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0066388_1038319581 | 3300005332 | Tropical Forest Soil | MSNCHLVAGRSLIDLVASRLALRAPALRAATTLIIQHDQR |
| Ga0008090_102143642 | 3300005363 | Tropical Rainforest Soil | MSNCHLVAGRSLIDWVASRLALRAPALRAATALTRPNRSA |
| Ga0070697_1004204412 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MSNCHLVAARSLIDLAASRLALRAPALRAATALTRPNRSA |
| Ga0070697_1005815811 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MSNCHLVAGRSLIDLTTSRLALRTPALRAATALTRPNRSA |
| Ga0066706_112853911 | 3300005598 | Soil | MSNCDLVAARSLIALAASRLALRAPALRAATALTR |
| Ga0068856_1019755432 | 3300005614 | Corn Rhizosphere | MKNCDSAAGRSLIDLIASRLALGAPALRAAAALTEPNRVFG |
| Ga0066905_1002883711 | 3300005713 | Tropical Forest Soil | MSNCHLVAGRSLIDLAASRLALRAPALRAATALTRPNRSAQRL |
| Ga0066905_1008241992 | 3300005713 | Tropical Forest Soil | MSNCHLVAATSLIDLAASRLALRAPALRAATALRRPNRS |
| Ga0066903_1001319733 | 3300005764 | Tropical Forest Soil | MSNCHLVAGRSLIDLGASRLALRAPALRAATVLTRPN |
| Ga0066903_1001321691 | 3300005764 | Tropical Forest Soil | MSNCHLVAGRSLIDLAASRLALRAPALRAAKTRPNRSA |
| Ga0066903_1013264901 | 3300005764 | Tropical Forest Soil | MSNCHLVAGRSLIDLVASRPALHAPARRAATALTRPNRS |
| Ga0066903_1025613641 | 3300005764 | Tropical Forest Soil | MSNCHLVAGRSLIDLAASRLALRAPALRAATALTRPN |
| Ga0066903_1032440322 | 3300005764 | Tropical Forest Soil | MSNCDFMAAKSLIDLAASRLALRAPALRAATALTRPNQ |
| Ga0066903_1036853831 | 3300005764 | Tropical Forest Soil | MSNCDFVAGRSLIDLVASRLALRAPAHRAASALTRPNQSAQW |
| Ga0066903_1048054251 | 3300005764 | Tropical Forest Soil | MSNCHLVAVRSLSDLAASRLALRAPALRAATVLTR |
| Ga0066903_1055229851 | 3300005764 | Tropical Forest Soil | MSNCHLVAGRSLIDLVASRLALRAPALRAATTLTRP |
| Ga0075365_101419031 | 3300006038 | Populus Endosphere | MTIRIQFLGSNCHLVAGRSLIDLVASRLALRAPAQRAAT |
| Ga0075362_103724081 | 3300006177 | Populus Endosphere | MSNCDLVAARSLIHLAASRLALRAPALRAATALTR |
| Ga0075428_1001058405 | 3300006844 | Populus Rhizosphere | MSNCHLVAGRSLIDLVTSRLALRAPAQRAATALTRPNR |
| Ga0075421_1000653635 | 3300006845 | Populus Rhizosphere | MSNCHLVAGRSLIDLVASRLALRAPAQRAATALTRPNR |
| Ga0075431_1002183804 | 3300006847 | Populus Rhizosphere | MSNCDLVAARSLIHLAASRLALRAPALRAATALTRPDG |
| Ga0075420_1009667421 | 3300006853 | Populus Rhizosphere | MSNCHLVAGRSLIDLVASRLALRAPAQRAATALTRPNRSVPR |
| Ga0111539_128338792 | 3300009094 | Populus Rhizosphere | MSNCHVVAGQLLIDLVASRLALRAPALRAATALTRPNG |
| Ga0114129_130062541 | 3300009147 | Populus Rhizosphere | MSNCHVVAGQLLIDLVASRLALRAPALRAATALTRPNGSARGLA |
| Ga0126374_113281191 | 3300009792 | Tropical Forest Soil | MSNCHLVAGRSLIDLTASRLALRTPALRAATALTRPNR |
| Ga0126304_112295961 | 3300010037 | Serpentine Soil | MSNCDVVAGGSLIDLAASRLALRAPALRAATALTRPNR |
| Ga0126315_105336261 | 3300010038 | Serpentine Soil | MSNCDVVAGGSRLDLAASRLALPAPALRAATALTRPNRSAR |
| Ga0126384_103126633 | 3300010046 | Tropical Forest Soil | MSNCDLVAARSLIVLAASRLALRAPALRAATALTRP |
| Ga0126373_100998405 | 3300010048 | Tropical Forest Soil | VSNCDFMTAKSLIDLPTSRLALRAPALRAATALTRP |
| Ga0099796_103301322 | 3300010159 | Vadose Zone Soil | MSNCHLVAARPLIDLVASRLALRAPALRAATALTR |
| Ga0126370_105139301 | 3300010358 | Tropical Forest Soil | MSNCHLVAVRSLSDLAASRLALRAPALRAATVLTRPNR |
| Ga0126370_105902542 | 3300010358 | Tropical Forest Soil | MSNCHLVAGRSLIDLVASKLALRAPALRAATALTRPNRSAQ |
| Ga0126372_120695181 | 3300010360 | Tropical Forest Soil | MSNCHVAAGRSLIDLAASRLALRAPALRAATALTRPNQSA |
| Ga0126378_103949081 | 3300010361 | Tropical Forest Soil | MSNCDLVAARSLIVLAASRLALRAPALRAATALTR |
| Ga0126378_107439553 | 3300010361 | Tropical Forest Soil | MSNCHLVAGRSPIDLAASRLALRAPALRAATALTRPNRSAQRLPCG |
| Ga0126377_106254351 | 3300010362 | Tropical Forest Soil | MSNCDLVAARSLIVLAASRLALRAPALRAATALTRPNRSAR |
| Ga0126379_122947062 | 3300010366 | Tropical Forest Soil | MSNCDFVAGGSLIALAASRLALRAPALRAATALTRPN |
| Ga0137374_101215421 | 3300012204 | Vadose Zone Soil | VSNCHLVAGRSLTDLVASRLALRAPALRAATALTR |
| Ga0137362_100273661 | 3300012205 | Vadose Zone Soil | VSNCDLVAARSLIDWAASRLALRAPALRAATALTR |
| Ga0137372_102417902 | 3300012350 | Vadose Zone Soil | MSNCHLVAGRSLTDLVASRLALRAPALRAATALTRPNRSAQ |
| Ga0137360_100998291 | 3300012361 | Vadose Zone Soil | VSNCDLVAARSLMDWAASRLALRAPALRAATALTR |
| Ga0137360_112391341 | 3300012361 | Vadose Zone Soil | MSNCHLVAGRSLIDLVASRLALRAPALRAATALTRPNRS |
| Ga0137361_103915131 | 3300012362 | Vadose Zone Soil | MSNCHLVAGRSLIDLVASRLALRAPALRAATALTRPNRSA |
| Ga0137361_105244572 | 3300012362 | Vadose Zone Soil | MSNCHLVAARSLIDLTASRLALRAPALRAATALTRPNRSA |
| Ga0137361_110950421 | 3300012362 | Vadose Zone Soil | MSNCDFVAGRSLIDLVASRLALRAPALRAASALTRPNQSAQ |
| Ga0126375_102306651 | 3300012948 | Tropical Forest Soil | MSNCHLVAGRSLIDWAASRLALRAPALRAATALTR |
| Ga0126369_105446242 | 3300012971 | Tropical Forest Soil | MSNCDFMAAKSLIDLAASRLALRAPALRAATALTRPNHG |
| Ga0182041_104949951 | 3300016294 | Soil | MSNCNFMSGKSLIALAASRLALRAPALRAATALTRPNQSAQR |
| Ga0182033_104089462 | 3300016319 | Soil | VSNCDFMAAKSLIDLATSRLALRAPALRAATALTRPN |
| Ga0182033_104938804 | 3300016319 | Soil | VSNCDLIAAKSLIDLVASRLALRAPARRAATALTRP |
| Ga0182035_106337071 | 3300016341 | Soil | VSNCDFIAAKSLIDLATSRLALRAPALRAATALTR |
| Ga0182035_107794901 | 3300016341 | Soil | MSNCDFMAAKSLIDLATSRLALRAPALRAATALTR |
| Ga0182035_108726511 | 3300016341 | Soil | MSNCDFVAGGSLIALAASRLALRAPALRAATTLTRPNRPAQR |
| Ga0182035_109043981 | 3300016341 | Soil | MSNCDLVAARSLIHLATSRLALRAPALRAATALTR |
| Ga0182035_113819331 | 3300016341 | Soil | MSNCDFMAAKSLIDLATSRLALRAPALRAATALTRPNQSAQ |
| Ga0182032_101951353 | 3300016357 | Soil | MSNCDFMAAKSLIDLAASRLALRAPALRAATALTQPNQSAQ |
| Ga0182032_102006991 | 3300016357 | Soil | VSNCDFMAAKSLIDLAASRLALRAPALRAATALTQPNQSAQ |
| Ga0182034_101377864 | 3300016371 | Soil | MGNCHLVAGRSLIDLVASRLALRAPALRAATTLTR |
| Ga0182040_103653222 | 3300016387 | Soil | MSNCHFVSGRSLIDLIASRLAIRTPALRAATALTRPNQLA |
| Ga0182040_112287221 | 3300016387 | Soil | VSNCDFMAGKSLIDLAALRLALRAPALRAATALTRPNQSAQRLPR |
| Ga0182040_116622073 | 3300016387 | Soil | MSNCHLVAGRSLIDLVASKLALRAPALRAATALTRPNRSA |
| Ga0182037_112254321 | 3300016404 | Soil | MSNCDFMAGKSLIDLATTRLALRAPALRAATALTRPNQ |
| Ga0182037_116752772 | 3300016404 | Soil | VSNCDFMAGKSLIDLAASRLALRAPALRAATALTRP |
| Ga0182039_100567894 | 3300016422 | Soil | MSNCHLVAARSLIDLAASRLALRAPALRAATALTR |
| Ga0182039_122391302 | 3300016422 | Soil | MSNCHVVAGRSLIDLAASRLALRAPALRAATALTQPNQSAQWL |
| Ga0182038_102677263 | 3300016445 | Soil | MSNCDFMAGKSLIDLAASRLALRAPALRAATALTR |
| Ga0182038_103972232 | 3300016445 | Soil | VSNCDFMAAKSLIDLATSRLALRAPALRAATALTRPNQS |
| Ga0182038_105483622 | 3300016445 | Soil | MSNCDFVAGRLLIDLVASRLALRAPALRAASALTRPN |
| Ga0182038_114331042 | 3300016445 | Soil | VSNCDFMAGKSLIDLAASRLALRAPALRAATALTRPNQSAQ |
| Ga0182038_121257681 | 3300016445 | Soil | MSNCHLVAARSLIDLAASRLALRAPALRAATALTRPNRSAQ |
| Ga0184608_101161521 | 3300018028 | Groundwater Sediment | MSNCHLVAGRSLIDLVASRLALRAPALRAATALTR |
| Ga0184621_100834542 | 3300018054 | Groundwater Sediment | MSNCDLVAARSLIDLAASRLALRTPALRAATASTRP |
| Ga0184617_10333463 | 3300018066 | Groundwater Sediment | MSNCDLVAARSLIDLAASRLALRTPALRAATASTRPNR |
| Ga0184635_102585832 | 3300018072 | Groundwater Sediment | MSNCDFVAGRSPIALAASRLALRAPALGAATALTRPKRSAQ |
| Ga0184625_102565592 | 3300018081 | Groundwater Sediment | MSNCDFVAGGSLIDLVTSRLALRAPALRAATALTR |
| Ga0184625_103172271 | 3300018081 | Groundwater Sediment | MSNCDFVAGGSLIDLVTSRLALRAPALRAATALTRPNR |
| Ga0193704_10962662 | 3300019867 | Soil | MSNCHLVAGRSLIDLVASRLALRAPALRAATALTRP |
| Ga0210381_102509532 | 3300021078 | Groundwater Sediment | MSNCHRVAGGSLIDLAASRLALRAPALRAAATLTRLNR |
| Ga0210402_108962242 | 3300021478 | Soil | MSNCHSVAGRSLIDLAASRLALRAPALRAATALTRPNQSAQWL |
| Ga0210402_113906942 | 3300021478 | Soil | MSNCHVAAGRSLIDLVASRLALRAPALRAAMALTQPAPCS |
| Ga0126371_114172812 | 3300021560 | Tropical Forest Soil | MSNCHLVAGRSLIDLVASRLALRAPALRAATTLTRPT |
| Ga0222623_100725503 | 3300022694 | Groundwater Sediment | VSNCHRVAGGSLIDLAASRLALRAPALRAAATLTRL |
| Ga0222623_100849391 | 3300022694 | Groundwater Sediment | MSNCDFVAGGSLIDFVTSRLALRAPALRAATALTRPNRSAQ |
| Ga0222622_110375562 | 3300022756 | Groundwater Sediment | MEFLGSNCDLVAARSLIDLVASSLALGAPVLRAATA |
| Ga0207684_102173273 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MSNCHLVAGRSLIDLTTSRLALRTPALRAATALTR |
| Ga0207700_114093262 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MSNCHLVAGRSLIDLVASKLALRAPTLRVATALTRPDRSAQRL |
| Ga0179593_11569834 | 3300026555 | Vadose Zone Soil | VSNCLFVAARSLIDLAASRLALRAPALRAAATLTRLNRSAQRLP |
| Ga0307291_10167421 | 3300028707 | Soil | MSNCDLVAARSLIDLAASRLALRTPALRAATASTRPN |
| Ga0307295_101748382 | 3300028708 | Soil | MSNCHRVAGGSLIDLATSRLALRAPALRAAATLTRLN |
| Ga0307293_101841731 | 3300028711 | Soil | MSNCHRVAGGSLIDLAASRLALRAPALRAAATLTR |
| Ga0307313_100510883 | 3300028715 | Soil | VSNCHRVAGGSLIDLAASRLALRAPALRAAATLTR |
| Ga0307298_100186433 | 3300028717 | Soil | MSNCLFVAARSLIDLAASRLALRAPALRAAATLTRLNRSAQR |
| Ga0307316_100559461 | 3300028755 | Soil | MSNCHLVAARSLIDLAASRLALRAPALRAATALTRPNRPAQR |
| Ga0307282_101311691 | 3300028784 | Soil | MSNCDLVAARSLIDLATSRLALRAPALRAATALTRPNR |
| Ga0307283_101585371 | 3300028790 | Soil | VSNCHRVAGGSLIDLAASRLALRAPALRAAATLTRLNR |
| Ga0247824_109428292 | 3300028809 | Soil | MSNCHRVAGGSLIDLAASRLALRAPALRAAATLTRLN |
| Ga0307310_104616312 | 3300028824 | Soil | MEFLGSNCDLVAARSLIDLVASRLALGAPVLRAATALTRPNRPAQR |
| Ga0307286_101721732 | 3300028876 | Soil | MEFLGSNCDLVAARSLIDLVASRLALGAPALRAATALTRPNRPAQRLPC |
| Ga0311339_104221852 | 3300029999 | Palsa | MSNCDFVAGGSLIDLATSRLALRAPALRAATALTRPNQSA |
| Ga0318541_101766202 | 3300031545 | Soil | MSNCNFMAGKSLIDLAASRLALRAPALRAATALTR |
| Ga0318541_102650961 | 3300031545 | Soil | MILGLGVSNCHLVAARSLIDLAASRLALRAPALRAATALTR |
| Ga0318528_102517831 | 3300031561 | Soil | MSNCHLVAGRSLIDLTTSRLALRTPALRAATALTRP |
| Ga0318573_100298807 | 3300031564 | Soil | VSNCDFMAAKSLIDLAASRLALRAPALRAATALTRPN |
| Ga0318515_100378081 | 3300031572 | Soil | VSNCDFMAAKSLIDLAASRLALRAPALRAATALTRPNQSAQ |
| Ga0310915_100408015 | 3300031573 | Soil | VSNCDLVAARSLIALPAPRLALRAPALRAAAALTR |
| Ga0310915_102619581 | 3300031573 | Soil | MSNCDFMAAKSLIDLAASRLALRAPALRAATALTQPNQSAQR |
| Ga0310915_111701522 | 3300031573 | Soil | MSNCDFVAGRSLFDLVASRLALRAPALRAASALTRPNQAAQRLASGRHS |
| Ga0318574_100052431 | 3300031680 | Soil | VSNCHLVAARSLIDLAASRLALRAPALRAATALTRP |
| Ga0306917_102158493 | 3300031719 | Soil | MSNCNFMAGKSLIDLAASRLALRAPALRAATALTRPNQS |
| Ga0306917_103154263 | 3300031719 | Soil | VSNCNLVAGRSLIDLTTSRLALRTPALRAATALTRPNRS |
| Ga0306917_109115902 | 3300031719 | Soil | MSNCDFMAAKSLIDLAASRLALRAPALRAATALTQ |
| Ga0307469_107271031 | 3300031720 | Hardwood Forest Soil | MSNCHLVAGRWLIDLTASRLALRTPALRAATALTRPNRS |
| Ga0318493_106879382 | 3300031723 | Soil | VSNCDFMAAKSLIDLAASRLALRAPALRAATALTQ |
| Ga0318500_100327246 | 3300031724 | Soil | VSNCDFMAAKSLIDLAASRLALRAPALRAATALTQPNQSA |
| Ga0318500_101296131 | 3300031724 | Soil | MSNCHLVAARSLIDLAASRVALRAPALRAATALTR |
| Ga0318500_102283631 | 3300031724 | Soil | MAGKSLIDLAASRLALRAPALRAATALTRPNQSTQ |
| Ga0306918_1000819210 | 3300031744 | Soil | MSNCDFMAAKSLIDLATSRLALRAPALRAATALTRPNQS |
| Ga0318502_100178336 | 3300031747 | Soil | MSNCHLVAGRSLIDLAASRLALRAPALRAATALTRP |
| Ga0318537_101581711 | 3300031763 | Soil | VSNCDFMAAKSLIDLATSRLALRAPALRAATALTRPNQ |
| Ga0318509_101303033 | 3300031768 | Soil | MSNCDFMAAKSLIDLATSRLALRAPALRAATALTRPN |
| Ga0318503_100107401 | 3300031794 | Soil | VSNCDFMAAKSLIDLAASRLALRAPALRAATALTRPNQSAQRLPRGR |
| Ga0318497_101590293 | 3300031805 | Soil | MSNCHLVAARSLIDLAASRLALRAPALRAATVLTRPNRSAQRL |
| Ga0318497_105671342 | 3300031805 | Soil | VSNCDFMAAKSLIDLAASRLALRAPALRAATALTQPNQ |
| Ga0318497_107652022 | 3300031805 | Soil | MSNCDFMAGKSLIDLAALRLALRAPALRAATALTRPN |
| Ga0318567_101938291 | 3300031821 | Soil | MSNCHLVAGRSLIDLTASRLALRAPALRAATALTRPNRSAQRL |
| Ga0310917_100381127 | 3300031833 | Soil | VSNCDFMAAKSLIDLAASRLALRAPALRAATALTQPNQSAQRLPRG |
| Ga0310917_105823121 | 3300031833 | Soil | MSNCHLVAGRSLIDLAASRLALRAPAQRAATALTR |
| Ga0318512_101105101 | 3300031846 | Soil | MSNCHLVAARSLIDLAASRLALRAPALRAATALTRPNRSAQR |
| Ga0306919_102615233 | 3300031879 | Soil | VSNCDFVAWGSLIDLATSRLPLRAPALRAALTRPNR |
| Ga0306919_107443031 | 3300031879 | Soil | VSNCDFIAAKSLIDLATSRLALRAPALRAATALTRP |
| Ga0306925_100747987 | 3300031890 | Soil | MSNRDFVAGGSLIALAASRLALRAPALRAATALTRP |
| Ga0306925_104566251 | 3300031890 | Soil | MSNCHFVAGRSLIDLVASRLALRAPALRAATALTRP |
| Ga0318520_104409561 | 3300031897 | Soil | MSNCDFVAGGSLIALAASRLALRAPALRAATTLTRPNRPAQRL |
| Ga0306923_107085231 | 3300031910 | Soil | VSNCDLVAARSLIALPAPRLALRAPALRAAAALTRP |
| Ga0306921_102532323 | 3300031912 | Soil | MSNCHLVAGGSLIPLAASRLALRASALCAATALTR |
| Ga0306921_105546703 | 3300031912 | Soil | MSNCHLVAARSLIDLAASRVALRAPALRAATALTRPNRSAQR |
| Ga0306921_106575893 | 3300031912 | Soil | MSNCDFMAAKSLIDLATSRLALRAPALRAATALTRPNQ |
| Ga0306921_113931172 | 3300031912 | Soil | MSNCDFVAGRLLIDLVASRVALRAPALRAASALTR |
| Ga0310912_100574027 | 3300031941 | Soil | VSNCDFMAAKSLIDLAASRLALRAPALRAATALTRPNQ |
| Ga0310916_101205551 | 3300031942 | Soil | MSNCHLVAGGSLIDLVASRLALRAPAQRAATALTRPNRSAQR |
| Ga0310916_111413551 | 3300031942 | Soil | MSNCHLVAGRSLIDLVASRLALRAPALRAATAVTRPNRSA |
| Ga0310913_108810692 | 3300031945 | Soil | VSDCDFMAAKSLIDLAASRLALRAPALRAATALTQ |
| Ga0310913_111753272 | 3300031945 | Soil | VSNCDFMAAKSLIDLAASGLALRVPALRAATALTRPNQS |
| Ga0310910_100997444 | 3300031946 | Soil | MSNCHLVAARSLIDLAASRVALRAPALRAATALTRPNR |
| Ga0310910_104310603 | 3300031946 | Soil | MSNCHLVAGRSLIDLAASRLALRAPAQRAATAMTR |
| Ga0310909_103467111 | 3300031947 | Soil | MSNCHLVAGRSLIDLTASRLALRAPALRAATALTR |
| Ga0310909_104020901 | 3300031947 | Soil | VSNCNLVAGRSLIDLTTSRLALRTPALRAATALTRPNRSAQR |
| Ga0310909_114995981 | 3300031947 | Soil | MSNCHVVAGRSLIDLVASRLALRAPALRAAMALTQ |
| Ga0306926_101233506 | 3300031954 | Soil | VSNCDLVAARSLIALPAPRLALRAPALRAAAALTRPNRSA |
| Ga0306926_116588641 | 3300031954 | Soil | MSNCHLVAGRSLIDLVASRLALRAPALRAATTLTR |
| Ga0306926_121083591 | 3300031954 | Soil | MSNCHVVAGRSLIDLVASRLALRAPALRAATALTQPNQSA |
| Ga0318530_101532411 | 3300031959 | Soil | MSNCHLVAGRSLIDLTASRLALRTPALRAATALTRP |
| Ga0306922_114184151 | 3300032001 | Soil | VSNCDFMAGKSLIDLAALRLALRAPALRAATALTRPNQSAQR |
| Ga0318569_100187431 | 3300032010 | Soil | VSNCDFMAAKSLIDLAASRLALRTPALRAATALTQ |
| Ga0318569_102181401 | 3300032010 | Soil | MSNCHLVAGRSLIDLAASRLALRAPALPAATALTRPK |
| Ga0318507_100469221 | 3300032025 | Soil | MSNCHLVAGRSLIDLTASRLALRAPALRAATALTRPNQSAQQLP |
| Ga0310911_101310334 | 3300032035 | Soil | MSNCDFVAGGSLIALAASRLALRAPALRAATTLTR |
| Ga0310911_109002801 | 3300032035 | Soil | VSNCDFMAGKSLIDLAASRLALRAPALRAATALTRPNQ |
| Ga0318549_100818181 | 3300032041 | Soil | MAAKSLIDLAASRLALRAPALRAATALTQPNQSAQR |
| Ga0318545_101144192 | 3300032042 | Soil | MSNCNFMAGKSLIDLAASRLALRAPALRAATALTRPN |
| Ga0318532_100559752 | 3300032051 | Soil | MSNCHLVAARSLIDLAASRLALRAPALRAATVLTRPNR |
| Ga0318532_101235002 | 3300032051 | Soil | MSNCDFMAAKSLIDLATSRLALRAPALRAATALAR |
| Ga0318533_101958393 | 3300032059 | Soil | MSNCNFMAGKSLIDLAASRLALRAPALRAATALTRPNQSAQRLPRG |
| Ga0318505_100826981 | 3300032060 | Soil | MSNCDFMAAKSLIDLATSRLALRAPALRAATALTRPNQSA |
| Ga0306924_1000692019 | 3300032076 | Soil | VSNCHLVAGRSLIDWVASRLALRAPALRAATALTRP |
| Ga0306924_124502992 | 3300032076 | Soil | MSNCHFAAGRSLIDLAASRLALRAPALRAATALTRPNQSAQ |
| Ga0318540_103599071 | 3300032094 | Soil | VSNCDFMAAKSLIDLATSRLALRAPALRAATALTH |
| Ga0307471_1007456782 | 3300032180 | Hardwood Forest Soil | MSNCDFVAARSLIHLVASRLALRAPALRAATALTRP |
| Ga0307471_1010406022 | 3300032180 | Hardwood Forest Soil | MSNCHLVAGGSLIDLVASRLALRAPALRAATALTRP |
| Ga0306920_1002697495 | 3300032261 | Soil | MSNCHLVAGRSLIDLAASRLALRAPAQRAATALTRPN |
| Ga0306920_1006573581 | 3300032261 | Soil | VSNCHLVAGRSLIDLAASRLALRAPALRAATALTRP |
| Ga0306920_1009520891 | 3300032261 | Soil | MSNCDFVAGRSLIDLLASRLALRAPALRAASALTRPNQSAQW |
| Ga0306920_1012012772 | 3300032261 | Soil | VSNGHLVAGRSLIDLAASRLALRAPALRAATALTR |
| Ga0306920_1024825321 | 3300032261 | Soil | MSNCDLVAARSLIHLATSRLALRAPALRAATALTRPTGSA |
| Ga0306920_1029225861 | 3300032261 | Soil | MSNCDFVAGRSLIDLVASRLALRAPALRAASTLTPPNQSAQWLPSG |
| Ga0306920_1030608581 | 3300032261 | Soil | VSNCDFMAGKSLIDLAASRLALRAPALRAATALTRPNQSAQR |
| Ga0310914_100807067 | 3300033289 | Soil | VSNCDFMAAKSLIDLAASRLALRAPALRAATALTQPN |
| Ga0310914_102460582 | 3300033289 | Soil | MSTCHVVAGRSLIDLVASRLALRAPALRAAMALTQPNQSAQ |
| Ga0310914_103095393 | 3300033289 | Soil | MSNCNFMAGKSLIDLAASRLALRAPALRAATALTRPNQSA |
| Ga0310914_116769251 | 3300033289 | Soil | MSNCDFMAGKSLIDLAALRLALRAPALRAATALTRP |
| ⦗Top⦘ |