| Basic Information | |
|---|---|
| Family ID | F032340 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 180 |
| Average Sequence Length | 44 residues |
| Representative Sequence | LGFPMPSRSELDAYVVYVGFDEIGDKNEKKPPAKKTATRQQ |
| Number of Associated Samples | 143 |
| Number of Associated Scaffolds | 180 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.25 % |
| % of genes near scaffold ends (potentially truncated) | 98.33 % |
| % of genes from short scaffolds (< 2000 bps) | 93.33 % |
| Associated GOLD sequencing projects | 138 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.23 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.333 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (27.778 % of family members) |
| Environment Ontology (ENVO) | Unclassified (40.556 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.111 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 7.25% β-sheet: 0.00% Coil/Unstructured: 92.75% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.23 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 180 Family Scaffolds |
|---|---|---|
| PF13419 | HAD_2 | 38.89 |
| PF00430 | ATP-synt_B | 17.22 |
| PF00034 | Cytochrom_C | 4.44 |
| PF04347 | FliO | 2.78 |
| PF05199 | GMC_oxred_C | 2.22 |
| PF03401 | TctC | 1.11 |
| PF12729 | 4HB_MCP_1 | 1.11 |
| PF13683 | rve_3 | 1.11 |
| PF01695 | IstB_IS21 | 0.56 |
| PF00239 | Resolvase | 0.56 |
| PF04480 | DUF559 | 0.56 |
| PF11799 | IMS_C | 0.56 |
| PF14681 | UPRTase | 0.56 |
| PF16657 | Malt_amylase_C | 0.56 |
| PF03734 | YkuD | 0.56 |
| PF00119 | ATP-synt_A | 0.56 |
| COG ID | Name | Functional Category | % Frequency in 180 Family Scaffolds |
|---|---|---|---|
| COG0711 | FoF1-type ATP synthase, membrane subunit b or b' | Energy production and conversion [C] | 17.22 |
| COG3190 | Flagellar biogenesis protein FliO | Cell motility [N] | 2.78 |
| COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 2.22 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 1.11 |
| COG0356 | FoF1-type ATP synthase, membrane subunit a | Energy production and conversion [C] | 0.56 |
| COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 0.56 |
| COG1484 | DNA replication protein DnaC | Replication, recombination and repair [L] | 0.56 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.56 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.56 |
| COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 0.56 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.33 % |
| Unclassified | root | N/A | 1.67 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459003|FZ032L002GX8WB | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10179342 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 501 | Open in IMG/M |
| 3300000651|AP72_2010_repI_A10DRAFT_1005895 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1649 | Open in IMG/M |
| 3300000955|JGI1027J12803_101390859 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 572 | Open in IMG/M |
| 3300001661|JGI12053J15887_10276294 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 827 | Open in IMG/M |
| 3300002568|C688J35102_118676879 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 584 | Open in IMG/M |
| 3300002568|C688J35102_119102888 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 638 | Open in IMG/M |
| 3300004152|Ga0062386_100956498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 709 | Open in IMG/M |
| 3300004281|Ga0066397_10138819 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10 | 546 | Open in IMG/M |
| 3300004643|Ga0062591_101875164 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 614 | Open in IMG/M |
| 3300005147|Ga0066821_1018868 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 568 | Open in IMG/M |
| 3300005162|Ga0066814_10059292 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 648 | Open in IMG/M |
| 3300005174|Ga0066680_10416070 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 853 | Open in IMG/M |
| 3300005179|Ga0066684_10828907 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 609 | Open in IMG/M |
| 3300005184|Ga0066671_10451869 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 824 | Open in IMG/M |
| 3300005332|Ga0066388_100916327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1452 | Open in IMG/M |
| 3300005332|Ga0066388_104058670 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 746 | Open in IMG/M |
| 3300005332|Ga0066388_104421354 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 716 | Open in IMG/M |
| 3300005434|Ga0070709_10712833 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 781 | Open in IMG/M |
| 3300005435|Ga0070714_101142000 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 760 | Open in IMG/M |
| 3300005437|Ga0070710_11148252 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 572 | Open in IMG/M |
| 3300005764|Ga0066903_100946165 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1566 | Open in IMG/M |
| 3300005764|Ga0066903_106131108 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 629 | Open in IMG/M |
| 3300005764|Ga0066903_107509672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 562 | Open in IMG/M |
| 3300005764|Ga0066903_107674671 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 555 | Open in IMG/M |
| 3300005834|Ga0068851_10833706 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 574 | Open in IMG/M |
| 3300006050|Ga0075028_100940086 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300006177|Ga0075362_10484564 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 631 | Open in IMG/M |
| 3300006178|Ga0075367_10993260 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 536 | Open in IMG/M |
| 3300006572|Ga0074051_11282650 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 816 | Open in IMG/M |
| 3300006603|Ga0074064_11435019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 561 | Open in IMG/M |
| 3300006806|Ga0079220_11133932 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 637 | Open in IMG/M |
| 3300009089|Ga0099828_10217644 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1707 | Open in IMG/M |
| 3300009092|Ga0105250_10054154 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1609 | Open in IMG/M |
| 3300009094|Ga0111539_10462422 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1478 | Open in IMG/M |
| 3300009101|Ga0105247_10262186 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1185 | Open in IMG/M |
| 3300009147|Ga0114129_12668257 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 595 | Open in IMG/M |
| 3300010046|Ga0126384_11211591 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 697 | Open in IMG/M |
| 3300010046|Ga0126384_11719302 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 594 | Open in IMG/M |
| 3300010047|Ga0126382_12536604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 501 | Open in IMG/M |
| 3300010325|Ga0134064_10342289 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 581 | Open in IMG/M |
| 3300010339|Ga0074046_10746228 | Not Available | 574 | Open in IMG/M |
| 3300010358|Ga0126370_10231721 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1419 | Open in IMG/M |
| 3300010358|Ga0126370_10305744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1263 | Open in IMG/M |
| 3300010358|Ga0126370_12043972 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 561 | Open in IMG/M |
| 3300010359|Ga0126376_10844252 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 899 | Open in IMG/M |
| 3300010366|Ga0126379_10773618 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1058 | Open in IMG/M |
| 3300010366|Ga0126379_13148025 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 552 | Open in IMG/M |
| 3300010371|Ga0134125_12723582 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 537 | Open in IMG/M |
| 3300010376|Ga0126381_103526168 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 614 | Open in IMG/M |
| 3300010376|Ga0126381_104250695 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300010398|Ga0126383_12627685 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 587 | Open in IMG/M |
| 3300010403|Ga0134123_10344431 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1343 | Open in IMG/M |
| 3300011106|Ga0151489_1336893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 813 | Open in IMG/M |
| 3300012212|Ga0150985_113592937 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 526 | Open in IMG/M |
| 3300012212|Ga0150985_113594980 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 670 | Open in IMG/M |
| 3300012361|Ga0137360_10984689 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 727 | Open in IMG/M |
| 3300012908|Ga0157286_10117197 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 806 | Open in IMG/M |
| 3300012917|Ga0137395_10088860 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2032 | Open in IMG/M |
| 3300012923|Ga0137359_11280185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 621 | Open in IMG/M |
| 3300012929|Ga0137404_11453713 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 634 | Open in IMG/M |
| 3300012948|Ga0126375_10279909 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1146 | Open in IMG/M |
| 3300012948|Ga0126375_11115455 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 651 | Open in IMG/M |
| 3300012951|Ga0164300_10543746 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 673 | Open in IMG/M |
| 3300012951|Ga0164300_10787403 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 588 | Open in IMG/M |
| 3300012971|Ga0126369_10387620 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1431 | Open in IMG/M |
| 3300012971|Ga0126369_11357440 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 801 | Open in IMG/M |
| 3300012971|Ga0126369_12347291 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 620 | Open in IMG/M |
| 3300012986|Ga0164304_10090773 | All Organisms → cellular organisms → Bacteria | 1795 | Open in IMG/M |
| 3300013306|Ga0163162_12501745 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 594 | Open in IMG/M |
| 3300013307|Ga0157372_13451611 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 502 | Open in IMG/M |
| 3300013308|Ga0157375_10692516 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1173 | Open in IMG/M |
| 3300015242|Ga0137412_11100255 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 563 | Open in IMG/M |
| 3300015359|Ga0134085_10603635 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 510 | Open in IMG/M |
| 3300016270|Ga0182036_10242767 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1344 | Open in IMG/M |
| 3300016270|Ga0182036_10784070 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 776 | Open in IMG/M |
| 3300016319|Ga0182033_10320784 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1286 | Open in IMG/M |
| 3300016319|Ga0182033_12100945 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 515 | Open in IMG/M |
| 3300016357|Ga0182032_10544797 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 959 | Open in IMG/M |
| 3300016371|Ga0182034_10571740 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 951 | Open in IMG/M |
| 3300016371|Ga0182034_11332652 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 627 | Open in IMG/M |
| 3300016387|Ga0182040_11160413 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 649 | Open in IMG/M |
| 3300016404|Ga0182037_11539561 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 590 | Open in IMG/M |
| 3300017972|Ga0187781_10770408 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 698 | Open in IMG/M |
| 3300018067|Ga0184611_1258906 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 613 | Open in IMG/M |
| 3300018073|Ga0184624_10018454 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2568 | Open in IMG/M |
| 3300018469|Ga0190270_12924695 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 540 | Open in IMG/M |
| 3300021082|Ga0210380_10037473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2083 | Open in IMG/M |
| 3300021082|Ga0210380_10585910 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 511 | Open in IMG/M |
| 3300021344|Ga0193719_10238489 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 771 | Open in IMG/M |
| 3300021439|Ga0213879_10026279 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1432 | Open in IMG/M |
| 3300021559|Ga0210409_11630421 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 521 | Open in IMG/M |
| 3300025315|Ga0207697_10524517 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 522 | Open in IMG/M |
| 3300025961|Ga0207712_11131043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 698 | Open in IMG/M |
| 3300025986|Ga0207658_10143720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1934 | Open in IMG/M |
| 3300026330|Ga0209473_1251049 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 610 | Open in IMG/M |
| 3300026547|Ga0209156_10041571 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2505 | Open in IMG/M |
| 3300026979|Ga0207817_1029012 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 590 | Open in IMG/M |
| 3300027383|Ga0209213_1001166 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4147 | Open in IMG/M |
| 3300027812|Ga0209656_10093490 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1592 | Open in IMG/M |
| 3300028710|Ga0307322_10072222 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 864 | Open in IMG/M |
| 3300028715|Ga0307313_10260739 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 539 | Open in IMG/M |
| 3300028720|Ga0307317_10172233 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 729 | Open in IMG/M |
| 3300028771|Ga0307320_10273771 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 668 | Open in IMG/M |
| 3300028784|Ga0307282_10534888 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 569 | Open in IMG/M |
| 3300028787|Ga0307323_10047777 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1506 | Open in IMG/M |
| 3300028791|Ga0307290_10382877 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 515 | Open in IMG/M |
| 3300028875|Ga0307289_10041191 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1837 | Open in IMG/M |
| 3300028884|Ga0307308_10080640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1542 | Open in IMG/M |
| 3300031058|Ga0308189_10365043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 586 | Open in IMG/M |
| 3300031184|Ga0307499_10296176 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 531 | Open in IMG/M |
| 3300031199|Ga0307495_10021563 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1094 | Open in IMG/M |
| 3300031543|Ga0318516_10401684 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 789 | Open in IMG/M |
| 3300031544|Ga0318534_10380120 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 812 | Open in IMG/M |
| 3300031561|Ga0318528_10260483 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 930 | Open in IMG/M |
| 3300031561|Ga0318528_10508509 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 647 | Open in IMG/M |
| 3300031668|Ga0318542_10311846 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 806 | Open in IMG/M |
| 3300031668|Ga0318542_10735122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 516 | Open in IMG/M |
| 3300031681|Ga0318572_10377529 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 842 | Open in IMG/M |
| 3300031682|Ga0318560_10732035 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 534 | Open in IMG/M |
| 3300031713|Ga0318496_10788451 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 524 | Open in IMG/M |
| 3300031719|Ga0306917_10005877 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 6652 | Open in IMG/M |
| 3300031719|Ga0306917_10062509 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 2550 | Open in IMG/M |
| 3300031719|Ga0306917_10529847 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 925 | Open in IMG/M |
| 3300031724|Ga0318500_10427852 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 660 | Open in IMG/M |
| 3300031736|Ga0318501_10263371 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 914 | Open in IMG/M |
| 3300031747|Ga0318502_10196147 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1166 | Open in IMG/M |
| 3300031747|Ga0318502_10422577 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 794 | Open in IMG/M |
| 3300031763|Ga0318537_10368931 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 529 | Open in IMG/M |
| 3300031768|Ga0318509_10093175 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1614 | Open in IMG/M |
| 3300031769|Ga0318526_10437890 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300031778|Ga0318498_10427519 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300031781|Ga0318547_10369026 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 878 | Open in IMG/M |
| 3300031792|Ga0318529_10295353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 754 | Open in IMG/M |
| 3300031793|Ga0318548_10433909 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 643 | Open in IMG/M |
| 3300031793|Ga0318548_10493650 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 598 | Open in IMG/M |
| 3300031794|Ga0318503_10028283 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1628 | Open in IMG/M |
| 3300031796|Ga0318576_10495489 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 576 | Open in IMG/M |
| 3300031799|Ga0318565_10288826 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 797 | Open in IMG/M |
| 3300031833|Ga0310917_10161190 | All Organisms → cellular organisms → Bacteria | 1485 | Open in IMG/M |
| 3300031833|Ga0310917_10300544 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1085 | Open in IMG/M |
| 3300031845|Ga0318511_10362149 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 661 | Open in IMG/M |
| 3300031846|Ga0318512_10388703 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 700 | Open in IMG/M |
| 3300031880|Ga0318544_10167075 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 846 | Open in IMG/M |
| 3300031893|Ga0318536_10325775 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 778 | Open in IMG/M |
| 3300031910|Ga0306923_12398288 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 523 | Open in IMG/M |
| 3300031912|Ga0306921_10754641 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1114 | Open in IMG/M |
| 3300031912|Ga0306921_11094251 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 894 | Open in IMG/M |
| 3300031912|Ga0306921_11383755 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 774 | Open in IMG/M |
| 3300031941|Ga0310912_10080382 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2366 | Open in IMG/M |
| 3300031941|Ga0310912_10987313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 646 | Open in IMG/M |
| 3300031942|Ga0310916_10700166 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 857 | Open in IMG/M |
| 3300031946|Ga0310910_11123207 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 611 | Open in IMG/M |
| 3300031947|Ga0310909_10019578 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4854 | Open in IMG/M |
| 3300031947|Ga0310909_10690596 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 848 | Open in IMG/M |
| 3300031949|Ga0214473_10786742 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1027 | Open in IMG/M |
| 3300031954|Ga0306926_10016388 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 8394 | Open in IMG/M |
| 3300031954|Ga0306926_11917274 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 669 | Open in IMG/M |
| 3300031981|Ga0318531_10153705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1031 | Open in IMG/M |
| 3300032001|Ga0306922_12275924 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 520 | Open in IMG/M |
| 3300032008|Ga0318562_10692876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 586 | Open in IMG/M |
| 3300032010|Ga0318569_10418146 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 625 | Open in IMG/M |
| 3300032035|Ga0310911_10314163 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 902 | Open in IMG/M |
| 3300032041|Ga0318549_10504874 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 544 | Open in IMG/M |
| 3300032054|Ga0318570_10061896 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1576 | Open in IMG/M |
| 3300032054|Ga0318570_10537070 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 534 | Open in IMG/M |
| 3300032055|Ga0318575_10053358 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1861 | Open in IMG/M |
| 3300032063|Ga0318504_10340216 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 712 | Open in IMG/M |
| 3300032064|Ga0318510_10240061 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 742 | Open in IMG/M |
| 3300032066|Ga0318514_10575693 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 599 | Open in IMG/M |
| 3300032076|Ga0306924_10296327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1856 | Open in IMG/M |
| 3300032076|Ga0306924_10702960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1135 | Open in IMG/M |
| 3300032076|Ga0306924_11078991 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 876 | Open in IMG/M |
| 3300032076|Ga0306924_12367371 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 536 | Open in IMG/M |
| 3300032094|Ga0318540_10665552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 501 | Open in IMG/M |
| 3300032174|Ga0307470_10681110 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 781 | Open in IMG/M |
| 3300032261|Ga0306920_103059101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 630 | Open in IMG/M |
| 3300034147|Ga0364925_0215862 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 708 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 27.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 10.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 9.44% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.00% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.67% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.11% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.11% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.11% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.11% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.11% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.11% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.11% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.11% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.11% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.11% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 1.11% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.11% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.56% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.56% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.56% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.56% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.56% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.56% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.56% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.56% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.56% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.56% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.56% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.56% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.56% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.56% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.56% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.56% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459003 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300000651 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A10 | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004281 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005147 | Soil and rhizosphere microbial communities from Laval, Canada - mgLMC | Environmental | Open in IMG/M |
| 3300005162 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAB | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006177 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Host-Associated | Open in IMG/M |
| 3300006178 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Host-Associated | Open in IMG/M |
| 3300006572 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006603 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011106 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMC (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012908 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1 | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018067 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex | Environmental | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021439 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03 | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026979 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 13 (SPAdes) | Environmental | Open in IMG/M |
| 3300027383 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028710 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380 | Environmental | Open in IMG/M |
| 3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
| 3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
| 3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
| 3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300031058 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
| 3300031199 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_S | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300034147 | Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E4A_02996560 | 2170459003 | Grass Soil | FRRAQTHVQFVDIEEGLAFPMPSRSELDTYVVYVGFDEIGDKNEKKPPKTARKTTTRQQ |
| AF_2010_repII_A1DRAFT_101793421 | 3300000597 | Forest Soil | SRSELDAYVVYVGFDEIGDKNEKKPPAKKTATRQQ* |
| AP72_2010_repI_A10DRAFT_10058954 | 3300000651 | Forest Soil | MPSRSELDAYVVYVGFDEIGDKNEKKPPAKKTATRQ |
| JGI1027J12803_1013908591 | 3300000955 | Soil | FPMPSRSELDTYVVYVGFDEIGDKNEKKPPKTARKTTTRQQ* |
| JGI12053J15887_102762941 | 3300001661 | Forest Soil | SFPMPSSAELDAYVVYVGFDEIGDKNEKRPAKSSKKPAQRQQ* |
| C688J35102_1186768791 | 3300002568 | Soil | LTFPVPSRSEVDAYVIYVGFDEIGDKNEKKTAKSARKLAPRQQ* |
| C688J35102_1191028882 | 3300002568 | Soil | EEGLSFPLPPAKELEAYVVYVGFDELGDPKEKKPARTARKPKT* |
| Ga0062386_1009564981 | 3300004152 | Bog Forest Soil | LSFPLPSAAELEAYVVYVGFDEMGDKNEKKPARSAKKTAPRQQ* |
| Ga0066397_101388191 | 3300004281 | Tropical Forest Soil | IEEGLAFPMPSKSELDAYVVYVGLDEIGDKNEKKPPAKKTATRQQ* |
| Ga0062591_1018751641 | 3300004643 | Soil | QFVDVEEGLSFPVPPRSEIDAYVIYVGFDEIGDKNEKKPARSAKKLAPRQQ* |
| Ga0066821_10188682 | 3300005147 | Soil | HVQFVDVEEGLTFPVPSRSEVDAYVIYVGFDEIGDKNEKKTAKSARKLAPRQQ* |
| Ga0066814_100592921 | 3300005162 | Soil | DVEEGLTFPVPSRSEVDAYVIYVGFDEIGDKNEKKTAKSARKLAPRQQ* |
| Ga0066680_104160703 | 3300005174 | Soil | FVDVEEGLIFPVPPKPELDAYVVYVGFDEISEQNEKKPPRSAKRPAARQQ* |
| Ga0066684_108289072 | 3300005179 | Soil | LPSSSELSAYVIYVGFDEIGDRNEKRPAKSAKKPAPRQP* |
| Ga0066671_104518691 | 3300005184 | Soil | EEGLTFPLPSRSELDAYVVYVGFDEIGDKNEKKAPKTAKKTTTRQQ* |
| Ga0066388_1009163272 | 3300005332 | Tropical Forest Soil | THIKFVDIEDGLNFPLPSSSELEAYVVYVGFDELGDKNDKRPLKPSVRAN* |
| Ga0066388_1040586702 | 3300005332 | Tropical Forest Soil | FPMPSKSELDAYVVYVGFDEIGDKNEKKPPKTARKTATRQQ* |
| Ga0066388_1044213542 | 3300005332 | Tropical Forest Soil | QTHVQFVDVEEGLTFPLPDTIELAAYVIYVGFDEIGDKNEKRPPKAAKKSSQR* |
| Ga0070709_107128331 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | DVEEGLNFPLPPRAELEAYIIYVGFDEIGDKNEKRSPKNAKRPAPRQQ* |
| Ga0070714_1011420001 | 3300005435 | Agricultural Soil | HVQFVDIEEGLAFPMPSRSELDTYVVYVGFDEIGDKNEKKPPKTARKTTTRQQ* |
| Ga0070710_111482522 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | QTHVQFVDIEEGLGFPMPSRSELDTYVVYVGFDEIGDKNEKKPPKTARKTTTRQQ* |
| Ga0066903_1009461651 | 3300005764 | Tropical Forest Soil | RSELDAYVVYVGFDEIGDKNEKKPPAKKTATRQQ* |
| Ga0066903_1061311081 | 3300005764 | Tropical Forest Soil | DQTHVQFVDIEEGLSFPLPSSSELSTYVVYVGFDEIGDRNEKKPPAKGAKKPAQRQP* |
| Ga0066903_1075096722 | 3300005764 | Tropical Forest Soil | RSELDAYVVYVGFDEIGDKNEKKPPKTARKTAPRQQ* |
| Ga0066903_1076746711 | 3300005764 | Tropical Forest Soil | HIPFVDVEEGLTFPLPSRSELDAYVVYVGFDEIGDKNEKRAPKTAKKTTTRQQ* |
| Ga0068851_108337062 | 3300005834 | Corn Rhizosphere | SRSEVDAYVIYVGFDEIGDKNEKKTAKSARKLAPRQQ* |
| Ga0075028_1009400861 | 3300006050 | Watersheds | AYMVYVGFDEIGEGTEKKPAAKKPATKQPAVKRQ* |
| Ga0075362_104845641 | 3300006177 | Populus Endosphere | PAKSELGAYVVYVGFDEIGDKNEKKPAKSGRKLAPRPQ* |
| Ga0075367_109932601 | 3300006178 | Populus Endosphere | PVPSRSEVDAYVIYVGFDEIGDKNEKKTAKSARKLTPRQQ* |
| Ga0074051_112826502 | 3300006572 | Soil | FPVPSRSEVDAYVIYVGFDEIGDKNEKKTAKSARKLAPRQQ* |
| Ga0074064_114350191 | 3300006603 | Soil | VDVEEGLTFPVPSRSEVDAYVIYVGFDEIGDKNEKKTAKSARKLAPRQQ* |
| Ga0079220_111339321 | 3300006806 | Agricultural Soil | SRSELDAYVVYVGFDEIGDKNEKKAPKTAKKTTTRQQ* |
| Ga0099828_102176441 | 3300009089 | Vadose Zone Soil | FPMPSLAELEAYVVYVGFDPVGEKPEKKPPPKTAKKSAR* |
| Ga0105250_100541541 | 3300009092 | Switchgrass Rhizosphere | QFVDVEDGLTFPVPSRSEVDAYVIYVGFDEIGDKNEKKTAKSARKVAPRQQ* |
| Ga0111539_104624221 | 3300009094 | Populus Rhizosphere | VPPRSEIDAYVIYVGFDEIGDKNEKKPAKSAKKLAPRQQ* |
| Ga0105247_102621863 | 3300009101 | Switchgrass Rhizosphere | EEGLSFPVPPRSEIDAYVIYVGFDEIGDKNEKKPAKSAKKLAPRQQ* |
| Ga0114129_126682572 | 3300009147 | Populus Rhizosphere | DGLSFPMPSLAELEAYVVYVGFDPVGEKPEKKKPPKTAKKSAR* |
| Ga0126384_112115911 | 3300010046 | Tropical Forest Soil | RDLEAYVVYVGFDEIGDRNEKRPPAKSTKRPTQRQQ* |
| Ga0126384_117193022 | 3300010046 | Tropical Forest Soil | TFPIPSGTEIDAYVVYVGFDEIGDRNEKKAPPPKTAKKPAPRQQ* |
| Ga0126382_125366042 | 3300010047 | Tropical Forest Soil | EEGLTFPLPSRSELDAYVVYVGFDEIGDKNEKRAPKTAKKTTTRQQ* |
| Ga0134064_103422891 | 3300010325 | Grasslands Soil | RSELDAYVVYVGFDEIGDKNEKKAPKTAKKTTTRQQ* |
| Ga0074046_107462281 | 3300010339 | Bog Forest Soil | KTRVQFVDIEGGLNFPPPSSAELAAYVVYVGFEEIGHKKEKKQTAATKKQVARQ* |
| Ga0126370_102317211 | 3300010358 | Tropical Forest Soil | PMPSRSELDAYVVYVGFDEIGDKNEKKPPKTARKTTTRQQ* |
| Ga0126370_103057443 | 3300010358 | Tropical Forest Soil | QTHVQFIDIEEGLSFPMPSRSELDAYVVYVGFDEIGDKNEKKPPAKKTATRQQ* |
| Ga0126370_120439722 | 3300010358 | Tropical Forest Soil | THVQFVDIEEGLGFPMPSRSDLDAYVVYVGFDEIGDKNEKKPSAKKTATRQQ* |
| Ga0126376_108442521 | 3300010359 | Tropical Forest Soil | ELDAYVVYVGFDEIGDKNEKKAPKTAKKTTTRQQ* |
| Ga0126379_107736183 | 3300010366 | Tropical Forest Soil | SELDAYVVYVGFDEIGDKNEKKPPKTARKTTTRQQ* |
| Ga0126379_131480251 | 3300010366 | Tropical Forest Soil | HVQFVDIEEGLSFPMPSKSELDAYVVYVGFDEIGDKNEKKQPAKKTATRQQ* |
| Ga0134125_127235822 | 3300010371 | Terrestrial Soil | EEGLSFPVPSRSEVDAYVIYVGFDEIGDKNEKKPAKSARKVTPRQQ* |
| Ga0126381_1035261682 | 3300010376 | Tropical Forest Soil | MPSRSELDAYVVYVGFDEIGDKNEKKPPKTARKTTTRQQ* |
| Ga0126381_1042506951 | 3300010376 | Tropical Forest Soil | HVQFVDIEEGLSFPMPSRSELDAYVVYVGFDEIGDKNEKKPPAKKTATRQQ* |
| Ga0126383_126276851 | 3300010398 | Tropical Forest Soil | EGLAFPMPSKSELDAYVVYVGFDEIGDKNEKKPPKTARKTTTRQQ* |
| Ga0134123_103444313 | 3300010403 | Terrestrial Soil | LTFPVPSRSEVDAYVIYVGFDEIGDKNEKKTATSARKLAPRQQ* |
| Ga0151489_13368932 | 3300011106 | Soil | LAAYVIYVGFDEIGDRNEKNEKKPARPGKHSAQR* |
| Ga0150985_1135929372 | 3300012212 | Avena Fatua Rhizosphere | VEEGLTFPVPSRSEVDAYVIYVGFDEIGDKNEKKTAKSARKVAPRQQ* |
| Ga0150985_1135949802 | 3300012212 | Avena Fatua Rhizosphere | VEEGLTFPVPSRSEVDAYVIYVGFDEIGDKNEKKTAKSARKLAPRQQ* |
| Ga0137360_109846891 | 3300012361 | Vadose Zone Soil | THVQFVDIEEGLSFPLPSAAELSAYVVYVGFDEIGDRNEKKPARSANRPAGRQQ* |
| Ga0157286_101171972 | 3300012908 | Soil | FVDVEEGLTFPVPSRSEVDAYVIYVGFDEIGDKNEKKTAKSARKVAPRQQ* |
| Ga0137395_100888601 | 3300012917 | Vadose Zone Soil | EGLSFPVPPKPELDAYVVYVGFDEIGDKNEKMPKSAKKPTTRQQ* |
| Ga0137359_112801851 | 3300012923 | Vadose Zone Soil | DIEEGLAFPMPSRSELDTYVVYVGFDEIGDKNEKKPPKTARKTTTRQQ* |
| Ga0137404_114537131 | 3300012929 | Vadose Zone Soil | HIQFVDIEDGLNFPLPSSAELAAYVVYVGFDEVGDKNEKKPPKSPKPPNMRTTHHQ* |
| Ga0126375_102799093 | 3300012948 | Tropical Forest Soil | DIEEGLTFPMPSKSELDAYVVYVGFDEIGDKNEKKPPKTARKTTTRQQ* |
| Ga0126375_111154551 | 3300012948 | Tropical Forest Soil | QFVDIEEGLGFPMPSRSELDAYVVYVGFDEIGDKNEKKPPAKKTATRQQ* |
| Ga0164300_105437461 | 3300012951 | Soil | EIDAYVIYVGFDEIGDKNEKKPARSAKKLAPRQQ* |
| Ga0164300_107874031 | 3300012951 | Soil | FPLPAPTELDAYVVYVGFDEIGDSSEKKPVRAAKKPAKRQQ* |
| Ga0126369_103876201 | 3300012971 | Tropical Forest Soil | QTHVQFADIEEGLGFPMPSRSDLDAYVVYVGFDEIGDKNEKKPSAKKTATRQQ* |
| Ga0126369_113574401 | 3300012971 | Tropical Forest Soil | ELDAYVVYVGFDEIGDKNEKKPPKTARKTATRQQ* |
| Ga0126369_123472911 | 3300012971 | Tropical Forest Soil | EGLGFPMPSRSELDAYVVYVGFDEIGDKNEKKPPVKKTATRQQ* |
| Ga0164304_100907734 | 3300012986 | Soil | RSEVDAYVIYVGFDEIGDKNEKKTAKSARKLAPRQQ* |
| Ga0163162_125017451 | 3300013306 | Switchgrass Rhizosphere | LTFPVPSRSEVAASVIYVGFDEIGDKNEKKTAKSARKVAPRQQ* |
| Ga0157372_134516112 | 3300013307 | Corn Rhizosphere | EIDAYVIYVGFDEIGDKNEKKPAKSAKKLAPRQQ* |
| Ga0157375_106925163 | 3300013308 | Miscanthus Rhizosphere | EVEAYVIYVGFDEIGDKNEKKPAKSARKVTPRQQ* |
| Ga0137412_111002552 | 3300015242 | Vadose Zone Soil | MPSGTELGAYVVYVGFDEIGDKNEKKPPPKTAKRPAQRQP* |
| Ga0134085_106036351 | 3300015359 | Grasslands Soil | VDVEEGLTFPVPPKPELDAYVVYVGFDEISEQNEKKPPRSAKRPAARQQ* |
| Ga0132257_1002813584 | 3300015373 | Arabidopsis Rhizosphere | PSAKEIEAYVVYVGFDEYGDPKEKKPARPAKKPKS* |
| Ga0182036_102427671 | 3300016270 | Soil | GLAFPMPSRSELDTYVVYVGFDEIGDKNEKKPPKTARKTTTRQQ |
| Ga0182036_107840702 | 3300016270 | Soil | DIEEGLSFPLPPTAELEAYVVYVGFDEIGDRSEKKPARSAKRPASRQQ |
| Ga0182033_103207843 | 3300016319 | Soil | LAFPMPSRSELDTYVVYVGFDEIGDKNEKKPPKTARKTTTRQQ |
| Ga0182033_121009452 | 3300016319 | Soil | PTKELDAYVVYVGFDELGIKNDKKPPKPPKRSAASQ |
| Ga0182032_105447971 | 3300016357 | Soil | DIEEGLAFPMPSRSELDAYVVYVGFDEIGDKNEKKPPKTARKTTTRQQ |
| Ga0182034_105717401 | 3300016371 | Soil | EGLAFPMPSRSELDAYVVYVGFDEIGDKNEKKPPKTARKTTTRQQ |
| Ga0182034_113326521 | 3300016371 | Soil | TYVQFVDIEEGLNFPLPSKSELDAYVVYVGFDEIGDKNEKKPPRTAKKTTTRQ |
| Ga0182040_111604131 | 3300016387 | Soil | LGFPMPSRSELDAYVVYVGFDEIGDKNEKKPPAKKTATRQQ |
| Ga0182037_115395611 | 3300016404 | Soil | EEGLGFPMPSRSDLDAYVVYVGFDEIGDKNEKKPSAKKTATRQQ |
| Ga0187781_107704081 | 3300017972 | Tropical Peatland | LSFPLPSSRELDAYVVYVGFDELGDAGDKKPAKKPAPKRK |
| Ga0184611_12589062 | 3300018067 | Groundwater Sediment | VDVEEGLSFPVPSRSEVDAYVIYVGFDEIGDKNEKKTAKSARKLAPRQQ |
| Ga0184624_100184541 | 3300018073 | Groundwater Sediment | PSRSEVDAYVIYVGFDEIGDKNEKKTAKSARKLAPRQQ |
| Ga0190270_129246951 | 3300018469 | Soil | PSGAELDAYVIYVGFDEIGDKNEKKPAKSAKKTTQRQQ |
| Ga0210380_100374731 | 3300021082 | Groundwater Sediment | PLPPRSEIDAYVIYVGFDEIGDKNEKKPAKSAKKLTPRQQ |
| Ga0210380_105859101 | 3300021082 | Groundwater Sediment | FVDVEEGLAFPVPSRSEVDAYVIYVGFDEIGDKNEKKTAKSARKLTPRQQ |
| Ga0193719_102384892 | 3300021344 | Soil | PVPSRSEIDAYVIYVGFDEIGDKNEKKPAKSAKKLTPRQQ |
| Ga0213879_100262793 | 3300021439 | Bulk Soil | SRSELDTYVVYVGFDEIGDKNEKKPPKTARKTTTRQQ |
| Ga0210409_116304212 | 3300021559 | Soil | HVQFVDIEEGLAFPMPSRSELDTYVVYVGFDEIGDKNEKKPPKTARKTTTRQQ |
| Ga0207697_105245171 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | VQFVDVEEGLSFPVPPRSEIDAYVIYVGFDEIGDKNEKKPAKSAKKLAPRQQ |
| Ga0207712_111310431 | 3300025961 | Switchgrass Rhizosphere | RSEVDAYVIYVGFDEIGDKNEKKTAKSARKLAPRQQ |
| Ga0207658_101437204 | 3300025986 | Switchgrass Rhizosphere | PVPSRSEVDAYVIYVGFDEIGDKNEKKTAKSARKLAPRQQ |
| Ga0209473_12510492 | 3300026330 | Soil | PLPSSSELSAYVIYVGFDEIGDRNEKRPAKSAKKPAPRQP |
| Ga0209156_100415716 | 3300026547 | Soil | VEEGLTFPLPSRSELDAYVVYVGFDEIGDKNEKKAPKTAKKTTTRQQ |
| Ga0207817_10290121 | 3300026979 | Tropical Forest Soil | ASELEAYVIYVGFDEIGEKNEKKPARAARKSAQSQQ |
| Ga0209213_10011661 | 3300027383 | Forest Soil | VQFVDVEEGLTFPVPSRSEIDAYVIYVGFDEIGDKNEKKPAKSAKKLAPRQQ |
| Ga0209656_100934901 | 3300027812 | Bog Forest Soil | FPPPSSAELAAYVVYVGFEEIGDKKEKKQTAATKKQVARQ |
| Ga0307322_100722222 | 3300028710 | Soil | TFPVPSRSEIDAYVIYVGFDEIGDKNEKKPAKSAKKLTPRQQ |
| Ga0307313_102607391 | 3300028715 | Soil | LTFPIPSGAELDAYVVYVGFDEIGDKNEKRPAKSSKKPAQRQQ |
| Ga0307317_101722331 | 3300028720 | Soil | EEGLNFPMPSGAELDAYVVYVGFDEIGDKNEKRPAKSSKKPAQRQQ |
| Ga0307320_102737711 | 3300028771 | Soil | RSEIDAYVIYVGFDEIGDKNEKKPAKSAKKLTPRQQ |
| Ga0307282_105348881 | 3300028784 | Soil | LTFPLPSRSELDAYVVYVGFDEIGDKNEKKPPKTAKKTTTRQ |
| Ga0307323_100477773 | 3300028787 | Soil | QFVDVEEGLTFPVPSRSEVDAYVIYVGFDEIGDKNEKKTAKSARKLTPRQQ |
| Ga0307290_103828772 | 3300028791 | Soil | LSFPVPSRSEVDAYVIYVGFDEIGDKNEKKTAKSARKLTPRQQ |
| Ga0307289_100411914 | 3300028875 | Soil | SRSEVDAYVIYVGFDEIGDKNEKKTAKSARKLTPRQQ |
| Ga0307308_100806401 | 3300028884 | Soil | VEEGLTFPVPSRSEIDAYVIYVGFDEIGDKNEKKPAKSAKKLTPRQQ |
| Ga0308189_103650432 | 3300031058 | Soil | FPVPSRSEVDAYVIYVGFDEIGDKNEKKTAKSARKLTPRQQ |
| Ga0307499_102961762 | 3300031184 | Soil | DVEEGLTFPVPSRSEVDAYVIYVGFDEIGDKNEKKTAKSARKLAPRQQ |
| Ga0307495_100215633 | 3300031199 | Soil | EGLTFPMPSSTELTAYVVYVGFDELGDRNEKKAPPPKTAKKPAPRQQ |
| Ga0318516_104016842 | 3300031543 | Soil | FVDIEEGLGFPMPSRSDLDAYVVYVGFDEIGDKNEKKPSAKTTATRQQ |
| Ga0318534_103801201 | 3300031544 | Soil | PFVDIEEGLAFPMPSRSELDAYVVYVGFDEIGDKNEKKPPKTARKTTTRQQ |
| Ga0318528_102604832 | 3300031561 | Soil | THVQFVDIEEGLGFPMPSRSELDAYVVYVGFDEIGDKNEKKPPAKKTATRQQ |
| Ga0318528_105085091 | 3300031561 | Soil | DIEEGLGFPMPSRSDLDAYVVYVGFDEIGDKNEKKPSAKKTATRQQ |
| Ga0318542_103118461 | 3300031668 | Soil | FIDIEEGLSFPMPSKSELDAYVVYVGFDEIGDRNEKKPPARKTATRQK |
| Ga0318542_107351221 | 3300031668 | Soil | QFVDIEEGLAFPMPSRSELDTYVVYVGFDEIGDKNEKKPPKTARKTTTRQQ |
| Ga0318572_103775291 | 3300031681 | Soil | VDIEEGLGFLMPSRSELDAYVVYVGFDEMGDKNEKKPPAKKTATRQQ |
| Ga0318560_105101161 | 3300031682 | Soil | DGLSFPLPLAAELEAYVVYVGFDEIGDKSEKKPARSAKKSAPRQQ |
| Ga0318560_107320351 | 3300031682 | Soil | MPSRLELDAYVVYVGFDEIGDKNEKKPPAKKTATRQQ |
| Ga0318496_107884511 | 3300031713 | Soil | VQFVDIEEGLGFPMPSRSDLDAYVVYVGFDEIGDKNEKKPSAKTRATRQQ |
| Ga0306917_1000587712 | 3300031719 | Soil | PSRSELDAYVVYVGFDEMGDKNEKKPPAKKTATRQQ |
| Ga0306917_100625091 | 3300031719 | Soil | HVQFVDIEEGLSFPMPSRSELDAYVVYVGFDEIGGKNEKKPPARKTATRQQ |
| Ga0306917_105298471 | 3300031719 | Soil | IEEGLAFPMPSRSELDAYVVYVGFDEIGDKNEKKPPKTARKTTTRQQ |
| Ga0318500_104278521 | 3300031724 | Soil | VQFVDVEEGLGFPMPSRSELDAYIVYVGFDEIGDKNEKKPPAKKTATRQQ |
| Ga0318501_102633711 | 3300031736 | Soil | FPLPLAAELEAYVVYVGFDEIGDKSEKKPARSAKKSAPRQQ |
| Ga0318502_101961471 | 3300031747 | Soil | EKLGFPMPSRSDLDAYVVYVGFDEIGDKNEKKPSAKKTATRQQ |
| Ga0318502_104225771 | 3300031747 | Soil | IEEGLGFPMPSRLELDAYVVYVGFDEIGDKNEKKPPAKKTATRQQ |
| Ga0318537_103689312 | 3300031763 | Soil | PMPSRSELDAYVVYVGFDEIGDKNEKKPPKTARKTTTRQQ |
| Ga0318509_100931753 | 3300031768 | Soil | MPSKSELDAYVVYVGFDEIGDRNEKKPPARKTATRQK |
| Ga0318526_104378901 | 3300031769 | Soil | THVQFVDIEEGLGFPMPSRSDLDAYVVYVGFDEIGDKNEKKPSAKKTATRQQ |
| Ga0318498_104275191 | 3300031778 | Soil | SFPMPSRSELDAYVVYVGFDEIGGKNEKKPPARKTATRQQ |
| Ga0318547_103690261 | 3300031781 | Soil | FVDIEEGLGFPMPSRLELDAYVVYVGFDEIGDKNEKKPPAKKTATRQQ |
| Ga0318529_102953532 | 3300031792 | Soil | FPMPSRSDLDAYVVYVGFDEIGDKNEKKPSAKTRATRQQ |
| Ga0318548_104339091 | 3300031793 | Soil | VEEGLGFPMPSRSELDAYIVYVGFDEIGDKNEKKPPAKKTATRQQ |
| Ga0318548_104936502 | 3300031793 | Soil | DIEEGLGFPMPSRSDLDAYVVYVGFDEIGDKNEKKPSAKTRATRQQ |
| Ga0318503_100282834 | 3300031794 | Soil | KSELDAYVVYVGFDEIGDKNEKKPPKTARKTTTRQQ |
| Ga0318576_104954892 | 3300031796 | Soil | HVQFVDIEEGLGFPMPSRSDLDAYVVYVGFDEIGDKNEKKPSAKTRATRQQ |
| Ga0318565_102888263 | 3300031799 | Soil | SRSELDAYVVYVGFDEIGGKNEKKSPARKTATRQQ |
| Ga0310917_101611902 | 3300031833 | Soil | GLSFPMPSRSELDAYVVYVGFDEIGGKNEKKPLARKTATRQQ |
| Ga0310917_103005443 | 3300031833 | Soil | DIEEGLSFPMPSRLELDAYVVYVGFDEIGDKNEKKPPAKKTATRQQ |
| Ga0318511_103621491 | 3300031845 | Soil | FPMPSKSELDAYVVYVGFDEIGDRNEKKPPARKTATRQK |
| Ga0318512_103887031 | 3300031846 | Soil | HVQFVDIEEKLGFPMPSRSDLDAYVVYVGFDEIGDKNEKKPSAKKTATRQQ |
| Ga0318544_101670751 | 3300031880 | Soil | DIEEGLGFPMPSRSELDAYVVYVGFDEIGDKNEKKPPAKKTATRQQ |
| Ga0318536_103257753 | 3300031893 | Soil | FVDIEEGLGFPMPSRSDLDAYVVYVGFDEIGDKNEKKPSAKTRATRQQ |
| Ga0306923_123982882 | 3300031910 | Soil | GAELGAYVIYVGFDEIGDRNEKRPAKSTKRPAQRQQ |
| Ga0306921_107546412 | 3300031912 | Soil | HVQFVDIEEGLGFPMPSRSELDAYVVYVGFDEIGDKNEKKPPAKKTATRQQ |
| Ga0306921_110942511 | 3300031912 | Soil | VAQGESHVQFIDIEERLGFPMPSRSELDAYVAYVGFDEIGDKNEKKPPAKKTATRQQ |
| Ga0306921_113837551 | 3300031912 | Soil | SRSDLDAYVVYVGFDEIGDKNEKKPSAKKTATRQQ |
| Ga0310912_100803823 | 3300031941 | Soil | PSRSELDAYVVYVGFDEIGDKNEKKPPAKKTATRQQ |
| Ga0310912_109873132 | 3300031941 | Soil | EEGLGFPMPSRSELDAYVAYVGFDEIGDKNEKKPPAKKTATRQQ |
| Ga0310916_107001661 | 3300031942 | Soil | KFKRISVTVAPGESHVQFIDIEEGLGFPMPSRSELDAYVAYVGFDEIGDKNEKKPPAKKTATRQQ |
| Ga0310910_111232072 | 3300031946 | Soil | SRSELDAYVVYVGFDEIGDKNEKKQPAKKTATRQQ |
| Ga0310909_100195788 | 3300031947 | Soil | SRSELDAYVVYVGFDEMGDKNEKKPPAKKTATRQQ |
| Ga0310909_106905961 | 3300031947 | Soil | THVQFVDIEEGLSFPMPSRSELDAYVVYVGFDEIGGKNEKKPPARKTATRQQ |
| Ga0214473_107867422 | 3300031949 | Soil | EDGLTFPIPSAYELSTYIVYVGFDEIGDPNEKKKPAKTAKKKQPR |
| Ga0306926_100163881 | 3300031954 | Soil | IEDGLSFPLPLAAELEAYVVYVGFDEIGDKSEKKPARSAKKSAPRQQ |
| Ga0306926_119172743 | 3300031954 | Soil | GESHVQFIDIEEGLGFPMPSRSELDAYVAYVGFDEIGDKNEKKPPAKKTATRQQ |
| Ga0318531_101537052 | 3300031981 | Soil | VQIVDIEEGLAFPMPSRSELDTYVVYVGFDEIGDKNEKKPPKTARKTTTRQQ |
| Ga0306922_122759241 | 3300032001 | Soil | GFPMPSRSDLDAYVVYVGFDEIGDKNEKKPSAKKTATRQQ |
| Ga0318562_106928761 | 3300032008 | Soil | IEEGLAFPMPSKSELDAYVVYVGFDEIGDKNEKKPPKTARKTATRQQ |
| Ga0318569_104181461 | 3300032010 | Soil | ALPSASELEAYVIYVGFDEIGEKNEKKPARAPRKSAQSQQ |
| Ga0310911_103141633 | 3300032035 | Soil | MPSRSELDAYVVYVGFDEIGDKNEKKQPAKKTATRQQ |
| Ga0318549_105048742 | 3300032041 | Soil | DIEEGLNFPLPSKSELDAYVVYVGFDEIGDKNEKKPPRTAKKTTTRQ |
| Ga0318570_100618963 | 3300032054 | Soil | FIDIEEGLSFPMPSRSELDAYVVYVGFDEIGGKNEKKPPARKTATRQQ |
| Ga0318570_105370702 | 3300032054 | Soil | FVDIEEGLNFPLPSSSELSTYVIYVGFDEVGDRNEKRPAKSTKKPAQKQP |
| Ga0318575_100533583 | 3300032055 | Soil | DIEEGLGFPMPSRSDLDAYVVYVGFDEIGDKNEKKPSAKTTATRQQ |
| Ga0318504_103402161 | 3300032063 | Soil | PHVQFVDIEEGLGFPMPSRSELDAYVVYVGFDEIGDKNEKKPPAKKTATRQQ |
| Ga0318510_102400612 | 3300032064 | Soil | PMPSRSELDAYVVYVGFDEIGDKNEKKPPAKKTATRQQ |
| Ga0318514_105756932 | 3300032066 | Soil | VQFVDIEEGLSFPMPSRSELDAYVVYVGFDEIGGKNEKKPLARKTATRQQ |
| Ga0306924_102963271 | 3300032076 | Soil | EGLSFPMPSRSELDAYVVYVGFDEIGGKNEKKPPARKTATRQQ |
| Ga0306924_107029604 | 3300032076 | Soil | MPSRSDLDAYVVYVGFDEIGDKNEKKPSAKKTATRQQ |
| Ga0306924_110789912 | 3300032076 | Soil | PMPSRSELDTYVVYVGFDEIGDKNEKKPPKTARKTTIRQQ |
| Ga0306924_123673711 | 3300032076 | Soil | DIEEKLGFPMPSRSDLDAYVVYVGFDEIGDKNEKKPSAKKTATRQQ |
| Ga0318540_106655522 | 3300032094 | Soil | FVDIEEGLAFPMPSRSELDTYVVYVGFDEIGDKNEKKPPKTARKTTTRQQ |
| Ga0307470_106811103 | 3300032174 | Hardwood Forest Soil | PSGSEIDAYVVYVGFDEIGDKNEKKPAAKTAKKPAQRQQ |
| Ga0306920_1030591012 | 3300032261 | Soil | PQGSELEAYVVYVGFDDMGDKSEKKPAKTAKKPAHRQ |
| Ga0364925_0215862_566_706 | 3300034147 | Sediment | EEGLTFPVPSRSEVDAYVIYVGFDEIGDKNEKKTAKSARKLAPRQQ |
| ⦗Top⦘ |