Basic Information | |
---|---|
Family ID | F032334 |
Family Type | Metagenome |
Number of Sequences | 180 |
Average Sequence Length | 37 residues |
Representative Sequence | MTRCNYLDGWFDAKSKELDEAEKKQKKDLITGEKK |
Number of Associated Samples | 111 |
Number of Associated Scaffolds | 180 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 69.44 % |
% of genes near scaffold ends (potentially truncated) | 11.11 % |
% of genes from short scaffolds (< 2000 bps) | 66.67 % |
Associated GOLD sequencing projects | 92 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.42 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (63.333 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (45.556 % of family members) |
Environment Ontology (ENVO) | Unclassified (87.222 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (96.667 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 36.51% β-sheet: 0.00% Coil/Unstructured: 63.49% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 180 Family Scaffolds |
---|---|---|
PF02037 | SAP | 6.67 |
PF00682 | HMGL-like | 3.33 |
PF01391 | Collagen | 2.22 |
PF03237 | Terminase_6N | 1.67 |
PF10145 | PhageMin_Tail | 1.67 |
PF04860 | Phage_portal | 1.11 |
PF12850 | Metallophos_2 | 0.56 |
PF00004 | AAA | 0.56 |
PF05835 | Synaphin | 0.56 |
PF06094 | GGACT | 0.56 |
PF00271 | Helicase_C | 0.56 |
PF12518 | DUF3721 | 0.56 |
PF00136 | DNA_pol_B | 0.56 |
PF13361 | UvrD_C | 0.56 |
PF08211 | dCMP_cyt_deam_2 | 0.56 |
PF00386 | C1q | 0.56 |
COG ID | Name | Functional Category | % Frequency in 180 Family Scaffolds |
---|---|---|---|
COG0295 | Cytidine deaminase | Nucleotide transport and metabolism [F] | 0.56 |
COG0417 | DNA polymerase B elongation subunit | Replication, recombination and repair [L] | 0.56 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 63.33 % |
All Organisms | root | All Organisms | 36.67 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000115|DelMOSum2011_c10100951 | All Organisms → Viruses | 946 | Open in IMG/M |
3300000116|DelMOSpr2010_c10006268 | Not Available | 6492 | Open in IMG/M |
3300000117|DelMOWin2010_c10000290 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 30605 | Open in IMG/M |
3300001450|JGI24006J15134_10000688 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 20557 | Open in IMG/M |
3300001450|JGI24006J15134_10023549 | Not Available | 2793 | Open in IMG/M |
3300001450|JGI24006J15134_10054018 | All Organisms → Viruses → Predicted Viral | 1622 | Open in IMG/M |
3300002483|JGI25132J35274_1002833 | Not Available | 4497 | Open in IMG/M |
3300002483|JGI25132J35274_1004156 | All Organisms → Viruses → Predicted Viral | 3692 | Open in IMG/M |
3300002488|JGI25128J35275_1075693 | Not Available | 696 | Open in IMG/M |
3300004097|Ga0055584_100201808 | Not Available | 2019 | Open in IMG/M |
3300004097|Ga0055584_101656968 | Not Available | 661 | Open in IMG/M |
3300004457|Ga0066224_1067815 | All Organisms → Viruses → Predicted Viral | 2616 | Open in IMG/M |
3300005837|Ga0078893_10870618 | All Organisms → cellular organisms → Bacteria | 3606 | Open in IMG/M |
3300005837|Ga0078893_11040117 | Not Available | 16027 | Open in IMG/M |
3300006026|Ga0075478_10000248 | Not Available | 20041 | Open in IMG/M |
3300006027|Ga0075462_10001442 | Not Available | 7654 | Open in IMG/M |
3300006191|Ga0075447_10001989 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 9432 | Open in IMG/M |
3300006735|Ga0098038_1004452 | Not Available | 5768 | Open in IMG/M |
3300006735|Ga0098038_1008898 | All Organisms → Viruses → Predicted Viral | 3981 | Open in IMG/M |
3300006735|Ga0098038_1016002 | All Organisms → Viruses → Predicted Viral | 2895 | Open in IMG/M |
3300006735|Ga0098038_1017266 | Not Available | 2777 | Open in IMG/M |
3300006735|Ga0098038_1044184 | Not Available | 1624 | Open in IMG/M |
3300006735|Ga0098038_1056712 | Not Available | 1405 | Open in IMG/M |
3300006735|Ga0098038_1078633 | All Organisms → Viruses → Predicted Viral | 1158 | Open in IMG/M |
3300006735|Ga0098038_1154440 | Not Available | 763 | Open in IMG/M |
3300006735|Ga0098038_1159599 | Not Available | 747 | Open in IMG/M |
3300006737|Ga0098037_1124408 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 880 | Open in IMG/M |
3300006737|Ga0098037_1140020 | Not Available | 817 | Open in IMG/M |
3300006737|Ga0098037_1179792 | Not Available | 699 | Open in IMG/M |
3300006749|Ga0098042_1015181 | Not Available | 2338 | Open in IMG/M |
3300006749|Ga0098042_1020510 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1949 | Open in IMG/M |
3300006749|Ga0098042_1053334 | Not Available | 1092 | Open in IMG/M |
3300006749|Ga0098042_1089352 | Not Available | 789 | Open in IMG/M |
3300006752|Ga0098048_1009539 | All Organisms → Viruses → Predicted Viral | 3490 | Open in IMG/M |
3300006752|Ga0098048_1071329 | Not Available | 1070 | Open in IMG/M |
3300006793|Ga0098055_1042745 | All Organisms → Viruses → Predicted Viral | 1848 | Open in IMG/M |
3300006793|Ga0098055_1115859 | Not Available | 1042 | Open in IMG/M |
3300006793|Ga0098055_1191820 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 778 | Open in IMG/M |
3300006802|Ga0070749_10008321 | Not Available | 6760 | Open in IMG/M |
3300006802|Ga0070749_10027187 | Not Available | 3589 | Open in IMG/M |
3300006922|Ga0098045_1019782 | All Organisms → Viruses → Predicted Viral | 1803 | Open in IMG/M |
3300006924|Ga0098051_1121590 | Not Available | 696 | Open in IMG/M |
3300006925|Ga0098050_1035472 | Not Available | 1344 | Open in IMG/M |
3300006928|Ga0098041_1056724 | All Organisms → Viruses → Predicted Viral | 1266 | Open in IMG/M |
3300006928|Ga0098041_1210230 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 622 | Open in IMG/M |
3300006990|Ga0098046_1076725 | Not Available | 756 | Open in IMG/M |
3300006990|Ga0098046_1101844 | Not Available | 638 | Open in IMG/M |
3300007234|Ga0075460_10296803 | Not Available | 531 | Open in IMG/M |
3300007538|Ga0099851_1045967 | Not Available | 1720 | Open in IMG/M |
3300007538|Ga0099851_1058293 | Not Available | 1509 | Open in IMG/M |
3300007538|Ga0099851_1073691 | Not Available | 1320 | Open in IMG/M |
3300007963|Ga0110931_1094048 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alteromonas/Salinimonas group → Alteromonas → Alteromonas australica | 905 | Open in IMG/M |
3300008219|Ga0114905_1162108 | Not Available | 739 | Open in IMG/M |
3300009423|Ga0115548_1134519 | Not Available | 786 | Open in IMG/M |
3300009550|Ga0115013_10714479 | Not Available | 682 | Open in IMG/M |
3300009705|Ga0115000_10072085 | All Organisms → Viruses → Predicted Viral | 2341 | Open in IMG/M |
3300009705|Ga0115000_10946880 | Not Available | 525 | Open in IMG/M |
3300010148|Ga0098043_1030005 | Not Available | 1713 | Open in IMG/M |
3300010148|Ga0098043_1034395 | Not Available | 1586 | Open in IMG/M |
3300010148|Ga0098043_1173478 | Not Available | 604 | Open in IMG/M |
3300010149|Ga0098049_1036782 | All Organisms → Viruses → Predicted Viral | 1581 | Open in IMG/M |
3300010150|Ga0098056_1013134 | Not Available | 3013 | Open in IMG/M |
3300010150|Ga0098056_1218844 | Not Available | 634 | Open in IMG/M |
3300010151|Ga0098061_1000220 | Not Available | 25883 | Open in IMG/M |
3300010300|Ga0129351_1139591 | Not Available | 960 | Open in IMG/M |
3300012919|Ga0160422_10123619 | All Organisms → Viruses → Predicted Viral | 1536 | Open in IMG/M |
3300012920|Ga0160423_10002592 | Not Available | 15110 | Open in IMG/M |
3300012920|Ga0160423_10114837 | Not Available | 1898 | Open in IMG/M |
3300012920|Ga0160423_10369896 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 982 | Open in IMG/M |
3300012920|Ga0160423_10860366 | Not Available | 609 | Open in IMG/M |
3300012920|Ga0160423_10958466 | Not Available | 573 | Open in IMG/M |
3300013253|Ga0116813_1049418 | Not Available | 709 | Open in IMG/M |
3300013253|Ga0116813_1074228 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 592 | Open in IMG/M |
3300017709|Ga0181387_1017226 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1398 | Open in IMG/M |
3300017709|Ga0181387_1079841 | Not Available | 662 | Open in IMG/M |
3300017713|Ga0181391_1099863 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 656 | Open in IMG/M |
3300017719|Ga0181390_1000864 | Not Available | 13758 | Open in IMG/M |
3300017719|Ga0181390_1004414 | Not Available | 5490 | Open in IMG/M |
3300017719|Ga0181390_1045915 | All Organisms → Viruses → Predicted Viral | 1300 | Open in IMG/M |
3300017724|Ga0181388_1000150 | Not Available | 22366 | Open in IMG/M |
3300017727|Ga0181401_1066091 | Not Available | 963 | Open in IMG/M |
3300017730|Ga0181417_1029992 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1345 | Open in IMG/M |
3300017731|Ga0181416_1175194 | Not Available | 519 | Open in IMG/M |
3300017738|Ga0181428_1170109 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 509 | Open in IMG/M |
3300017743|Ga0181402_1063681 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 980 | Open in IMG/M |
3300017749|Ga0181392_1203104 | Not Available | 569 | Open in IMG/M |
3300017756|Ga0181382_1082261 | Not Available | 888 | Open in IMG/M |
3300017759|Ga0181414_1073553 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 906 | Open in IMG/M |
3300017760|Ga0181408_1000002 | Not Available | 66801 | Open in IMG/M |
3300017767|Ga0181406_1220698 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 560 | Open in IMG/M |
3300017770|Ga0187217_1262023 | Not Available | 562 | Open in IMG/M |
3300017771|Ga0181425_1000756 | Not Available | 12603 | Open in IMG/M |
3300017771|Ga0181425_1113602 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 865 | Open in IMG/M |
3300017771|Ga0181425_1187466 | Not Available | 652 | Open in IMG/M |
3300017781|Ga0181423_1009248 | All Organisms → Viruses → Predicted Viral | 4196 | Open in IMG/M |
3300017781|Ga0181423_1293149 | Not Available | 601 | Open in IMG/M |
3300017783|Ga0181379_1234994 | Not Available | 636 | Open in IMG/M |
3300017786|Ga0181424_10300037 | Not Available | 667 | Open in IMG/M |
3300017786|Ga0181424_10410376 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 550 | Open in IMG/M |
3300017949|Ga0181584_10531668 | Not Available | 719 | Open in IMG/M |
3300017964|Ga0181589_10668941 | Not Available | 654 | Open in IMG/M |
3300018421|Ga0181592_10094955 | Not Available | 2323 | Open in IMG/M |
3300018421|Ga0181592_10463610 | Not Available | 882 | Open in IMG/M |
3300018424|Ga0181591_10116381 | Not Available | 2171 | Open in IMG/M |
3300018426|Ga0181566_10711850 | Not Available | 690 | Open in IMG/M |
3300020246|Ga0211707_1020022 | Not Available | 939 | Open in IMG/M |
3300020282|Ga0211667_1094904 | Not Available | 728 | Open in IMG/M |
3300020392|Ga0211666_10012365 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 4241 | Open in IMG/M |
3300020394|Ga0211497_10012346 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp. | 4663 | Open in IMG/M |
3300020403|Ga0211532_10008108 | Not Available | 6825 | Open in IMG/M |
3300020403|Ga0211532_10081341 | Not Available | 1427 | Open in IMG/M |
3300020403|Ga0211532_10240999 | Not Available | 709 | Open in IMG/M |
3300020403|Ga0211532_10287040 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp. | 636 | Open in IMG/M |
3300020406|Ga0211668_10002142 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales → unclassified Legionellales → Legionellales bacterium | 11484 | Open in IMG/M |
3300020421|Ga0211653_10046828 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1968 | Open in IMG/M |
3300020437|Ga0211539_10217852 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp. | 785 | Open in IMG/M |
3300020448|Ga0211638_10054662 | All Organisms → Viruses → Predicted Viral | 1743 | Open in IMG/M |
3300020457|Ga0211643_10048661 | Not Available | 2119 | Open in IMG/M |
3300021335|Ga0213867_1290486 | Not Available | 518 | Open in IMG/M |
3300021368|Ga0213860_10258639 | Not Available | 763 | Open in IMG/M |
3300021957|Ga0222717_10071129 | All Organisms → Viruses → Predicted Viral | 2217 | Open in IMG/M |
3300021957|Ga0222717_10440997 | Not Available | 712 | Open in IMG/M |
3300021959|Ga0222716_10443022 | Not Available | 744 | Open in IMG/M |
3300022063|Ga0212029_1004060 | Not Available | 1546 | Open in IMG/M |
3300022068|Ga0212021_1005476 | Not Available | 1928 | Open in IMG/M |
3300022176|Ga0212031_1017288 | Not Available | 1095 | Open in IMG/M |
3300022198|Ga0196905_1039318 | Not Available | 1385 | Open in IMG/M |
3300022200|Ga0196901_1002801 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 8257 | Open in IMG/M |
3300025070|Ga0208667_1000367 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 20102 | Open in IMG/M |
3300025070|Ga0208667_1057883 | Not Available | 611 | Open in IMG/M |
3300025084|Ga0208298_1017039 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alteromonas/Salinimonas group → Alteromonas → Alteromonas australica | 1664 | Open in IMG/M |
3300025086|Ga0208157_1011512 | All Organisms → Viruses → Predicted Viral | 2911 | Open in IMG/M |
3300025086|Ga0208157_1017599 | Not Available | 2222 | Open in IMG/M |
3300025101|Ga0208159_1001113 | Not Available | 10258 | Open in IMG/M |
3300025101|Ga0208159_1090153 | Not Available | 564 | Open in IMG/M |
3300025101|Ga0208159_1095260 | Not Available | 538 | Open in IMG/M |
3300025102|Ga0208666_1022402 | Not Available | 1985 | Open in IMG/M |
3300025102|Ga0208666_1030109 | All Organisms → Viruses → Predicted Viral | 1648 | Open in IMG/M |
3300025102|Ga0208666_1036115 | All Organisms → Viruses → Predicted Viral | 1463 | Open in IMG/M |
3300025102|Ga0208666_1101514 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 708 | Open in IMG/M |
3300025108|Ga0208793_1173034 | Not Available | 556 | Open in IMG/M |
3300025110|Ga0208158_1021339 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1698 | Open in IMG/M |
3300025127|Ga0209348_1000044 | Not Available | 90867 | Open in IMG/M |
3300025127|Ga0209348_1049231 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1429 | Open in IMG/M |
3300025128|Ga0208919_1133069 | Not Available | 780 | Open in IMG/M |
3300025132|Ga0209232_1051112 | All Organisms → Viruses → Predicted Viral | 1510 | Open in IMG/M |
3300025132|Ga0209232_1212701 | Not Available | 583 | Open in IMG/M |
3300025137|Ga0209336_10057220 | Not Available | 1191 | Open in IMG/M |
3300025138|Ga0209634_1246266 | Not Available | 649 | Open in IMG/M |
3300025151|Ga0209645_1000264 | All Organisms → cellular organisms → Bacteria | 28227 | Open in IMG/M |
3300025151|Ga0209645_1000781 | Not Available | 16252 | Open in IMG/M |
3300025151|Ga0209645_1008481 | Not Available | 4243 | Open in IMG/M |
3300025151|Ga0209645_1020335 | Not Available | 2534 | Open in IMG/M |
3300025151|Ga0209645_1046030 | All Organisms → Viruses → Predicted Viral | 1548 | Open in IMG/M |
3300025151|Ga0209645_1047705 | Not Available | 1514 | Open in IMG/M |
3300025151|Ga0209645_1124866 | Not Available | 813 | Open in IMG/M |
3300025151|Ga0209645_1159700 | Not Available | 689 | Open in IMG/M |
3300025151|Ga0209645_1213769 | Not Available | 560 | Open in IMG/M |
3300025168|Ga0209337_1001350 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 18726 | Open in IMG/M |
3300025168|Ga0209337_1081076 | All Organisms → Viruses → Predicted Viral | 1571 | Open in IMG/M |
3300025168|Ga0209337_1289594 | Not Available | 600 | Open in IMG/M |
3300025647|Ga0208160_1074618 | Not Available | 919 | Open in IMG/M |
3300025674|Ga0208162_1036480 | Not Available | 1750 | Open in IMG/M |
3300027668|Ga0209482_1005516 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 6834 | Open in IMG/M |
3300027801|Ga0209091_10321923 | Not Available | 724 | Open in IMG/M |
3300027859|Ga0209503_10287404 | Not Available | 800 | Open in IMG/M |
3300029302|Ga0135227_1027099 | Not Available | 614 | Open in IMG/M |
3300029309|Ga0183683_1004250 | All Organisms → Viruses → Predicted Viral | 4691 | Open in IMG/M |
3300029309|Ga0183683_1057251 | Not Available | 524 | Open in IMG/M |
3300029319|Ga0183748_1001377 | All Organisms → cellular organisms → Bacteria | 14687 | Open in IMG/M |
3300029448|Ga0183755_1000632 | Not Available | 20742 | Open in IMG/M |
3300029448|Ga0183755_1002470 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 9714 | Open in IMG/M |
3300029787|Ga0183757_1000905 | Not Available | 14046 | Open in IMG/M |
3300029787|Ga0183757_1024638 | Not Available | 1363 | Open in IMG/M |
3300031773|Ga0315332_10000619 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae | 16920 | Open in IMG/M |
3300031774|Ga0315331_10041554 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 3411 | Open in IMG/M |
3300031851|Ga0315320_10000514 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 31769 | Open in IMG/M |
3300032011|Ga0315316_11359751 | Not Available | 564 | Open in IMG/M |
3300032277|Ga0316202_10001213 | Not Available | 21196 | Open in IMG/M |
3300032373|Ga0316204_10339271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Parvibaculum → unclassified Parvibaculum → Parvibaculum sp. | 1154 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 45.56% |
Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 14.44% |
Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 12.22% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 8.33% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 3.33% |
Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 2.78% |
Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 2.22% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.67% |
Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 1.67% |
Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 1.11% |
Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 1.11% |
Marine Surface Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water | 1.11% |
Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 1.11% |
Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 0.56% |
Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater | 0.56% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.56% |
Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.56% |
Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 0.56% |
Marine Harbor | Environmental → Aquatic → Marine → Harbor → Unclassified → Marine Harbor | 0.56% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
3300002483 | Marine viral communities from the Pacific Ocean - ETNP_6_30 | Environmental | Open in IMG/M |
3300002488 | Marine viral communities from the Pacific Ocean - ETNP_2_60 | Environmental | Open in IMG/M |
3300004097 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaG | Environmental | Open in IMG/M |
3300004457 | Marine viral communities from Newfoundland, Canada MC-1 | Environmental | Open in IMG/M |
3300005837 | Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18 | Environmental | Open in IMG/M |
3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
3300006191 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNA | Environmental | Open in IMG/M |
3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
3300006749 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG | Environmental | Open in IMG/M |
3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
3300006922 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG | Environmental | Open in IMG/M |
3300006924 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG | Environmental | Open in IMG/M |
3300006925 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG | Environmental | Open in IMG/M |
3300006928 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG | Environmental | Open in IMG/M |
3300006990 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG | Environmental | Open in IMG/M |
3300007234 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA | Environmental | Open in IMG/M |
3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
3300007963 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (version 2) | Environmental | Open in IMG/M |
3300008219 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_b05 | Environmental | Open in IMG/M |
3300009423 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423 | Environmental | Open in IMG/M |
3300009550 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome | Environmental | Open in IMG/M |
3300009705 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 | Environmental | Open in IMG/M |
3300010148 | Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaG | Environmental | Open in IMG/M |
3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
3300010151 | Marine viral communities from the Subarctic Pacific Ocean - 22_ETSP_OMZ_AT15343 metaG | Environmental | Open in IMG/M |
3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
3300012919 | Marine microbial communities from the Central Pacific Ocean - Fk160115 60m metaG | Environmental | Open in IMG/M |
3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
3300013253 | Marine hypoxic microbial communities from the Gulf of Mexico, USA - 10m_Station4_GOM_Metagenome | Environmental | Open in IMG/M |
3300017709 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27 | Environmental | Open in IMG/M |
3300017713 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 | Environmental | Open in IMG/M |
3300017719 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 | Environmental | Open in IMG/M |
3300017724 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17 | Environmental | Open in IMG/M |
3300017727 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20 | Environmental | Open in IMG/M |
3300017730 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13 | Environmental | Open in IMG/M |
3300017731 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16 | Environmental | Open in IMG/M |
3300017738 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12 | Environmental | Open in IMG/M |
3300017743 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17 | Environmental | Open in IMG/M |
3300017749 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 | Environmental | Open in IMG/M |
3300017756 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 | Environmental | Open in IMG/M |
3300017759 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28 | Environmental | Open in IMG/M |
3300017760 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16 | Environmental | Open in IMG/M |
3300017767 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20 | Environmental | Open in IMG/M |
3300017770 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2) | Environmental | Open in IMG/M |
3300017771 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13 | Environmental | Open in IMG/M |
3300017781 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14 | Environmental | Open in IMG/M |
3300017783 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10 | Environmental | Open in IMG/M |
3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
3300017949 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300017964 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071410BT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018421 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018424 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018426 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300020246 | Marine microbial communities from Tara Oceans - TARA_B100000424 (ERX555934-ERR599105) | Environmental | Open in IMG/M |
3300020282 | Marine microbial communities from Tara Oceans - TARA_B100000963 (ERX556074-ERR599169) | Environmental | Open in IMG/M |
3300020392 | Marine microbial communities from Tara Oceans - TARA_B100000963 (ERX555916-ERR599163) | Environmental | Open in IMG/M |
3300020394 | Marine microbial communities from Tara Oceans - TARA_B000000557 (ERX556068-ERR599026) | Environmental | Open in IMG/M |
3300020403 | Marine microbial communities from Tara Oceans - TARA_B100000085 (ERX556015-ERR599145) | Environmental | Open in IMG/M |
3300020406 | Marine microbial communities from Tara Oceans - TARA_B100000886 (ERX555926-ERR599024) | Environmental | Open in IMG/M |
3300020421 | Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556005-ERR599007) | Environmental | Open in IMG/M |
3300020437 | Marine microbial communities from Tara Oceans - TARA_B100000282 (ERX555906-ERR599074) | Environmental | Open in IMG/M |
3300020448 | Marine microbial communities from Tara Oceans - TARA_B100000941 (ERX555919-ERR598954) | Environmental | Open in IMG/M |
3300020457 | Marine microbial communities from Tara Oceans - TARA_B100001113 (ERX555941-ERR599014) | Environmental | Open in IMG/M |
3300021335 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO540 | Environmental | Open in IMG/M |
3300021368 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO550 | Environmental | Open in IMG/M |
3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
3300022063 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v2) | Environmental | Open in IMG/M |
3300022068 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2) | Environmental | Open in IMG/M |
3300022176 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v2) | Environmental | Open in IMG/M |
3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
3300025070 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
3300025084 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025101 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025102 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
3300025108 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025110 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025127 | Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes) | Environmental | Open in IMG/M |
3300025128 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
3300025137 | Marine viral communities from the Pacific Ocean - LP-32 (SPAdes) | Environmental | Open in IMG/M |
3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
3300025647 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027668 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNA (SPAdes) | Environmental | Open in IMG/M |
3300027801 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 (SPAdes) | Environmental | Open in IMG/M |
3300027859 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome (SPAdes) | Environmental | Open in IMG/M |
3300029302 | Marine harbor viral communities from the Indian Ocean - SRB3 | Environmental | Open in IMG/M |
3300029309 | Marine viral communities collected during Tara Oceans survey from station TARA_100 - TARA_R100001440 | Environmental | Open in IMG/M |
3300029319 | Marine viral communities collected during Tara Oceans survey from station TARA_032 - TARA_A100001516 | Environmental | Open in IMG/M |
3300029448 | Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082 | Environmental | Open in IMG/M |
3300029787 | Marine viral communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000172 | Environmental | Open in IMG/M |
3300031773 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 34915 | Environmental | Open in IMG/M |
3300031774 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 34915 | Environmental | Open in IMG/M |
3300031851 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515 | Environmental | Open in IMG/M |
3300032011 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 3416 | Environmental | Open in IMG/M |
3300032277 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotite | Environmental | Open in IMG/M |
3300032373 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 2 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
DelMOSum2011_101009512 | 3300000115 | Marine | MNKMTRCVLLDEWFNAWSSELDEAEKKEKKDLITGEKKCVKVR* |
DelMOSpr2010_1000626810 | 3300000116 | Marine | MTRCNYLDGWFDAKSKELDEAESKQKKDLITGDEK* |
DelMOWin2010_1000029037 | 3300000117 | Marine | MTRCVLLDEWFNAWSSELDEAEKKEKKDLITGEKKCVKVR* |
JGI24006J15134_1000068816 | 3300001450 | Marine | LKVNNMTRCNLLDKWFDAESKRLDEAEKKQKKDLITGEKNE* |
JGI24006J15134_100235495 | 3300001450 | Marine | MTRCTYLDSWFDAESKRLDKEETKQKKDLITGEKK* |
JGI24006J15134_100540185 | 3300001450 | Marine | MTRCTYLDSWFDAESKRLDKEEEKQNKDLITGEKK* |
JGI25132J35274_10028334 | 3300002483 | Marine | MTRCKLLDTWFDVKSKELDKAEKTQNKDLITGEKISNTK* |
JGI25132J35274_10041563 | 3300002483 | Marine | LLKVDNMTRCNXLDGWFDAKSKELDEAESKQKKDLXTGDKK* |
JGI25128J35275_10756931 | 3300002488 | Marine | MRLKKGDLMTRCNYLDSWFDSKSKELDEAESKAKKDLITGDKK* |
Ga0055584_1002018081 | 3300004097 | Pelagic Marine | VVRMTRCNLLDSWFDAESKKLDAKEKKEKKDLITGEKNE* |
Ga0055584_1016569683 | 3300004097 | Pelagic Marine | VVRMTRCVYLDRWFDAKSKELDAEEKKRKRDLITGEKNE* |
Ga0066224_10678152 | 3300004457 | Marine | VNKMTRCIYLDKWFDEQSKVLDQAEKEQKKDLITGEKNES* |
Ga0078893_108706182 | 3300005837 | Marine Surface Water | MTRCKILDKWFDEQSKVLDQAEKEQKKDLITGEKNDS* |
Ga0078893_110401174 | 3300005837 | Marine Surface Water | MTRCVYLDKWFDEQSKLLDKEEKLQQKDLITGGKK* |
Ga0075478_1000024821 | 3300006026 | Aqueous | MTRCKLLDQWFDSKSKELDKEENKQKKDLITGQKK* |
Ga0075462_100014425 | 3300006027 | Aqueous | MTRCKLLDTWFDAKSKELDKAEKTQNKDLITGEKINNTK* |
Ga0075447_100019898 | 3300006191 | Marine | MTRCTLLDTWIDAESKRLDKEEKKQTKDLITGEKK* |
Ga0098038_10044528 | 3300006735 | Marine | VNEMTRCVLLDKWFDEQSKVLDQAEKEQKKDLITGEKNDS* |
Ga0098038_10088983 | 3300006735 | Marine | MTRCVLLDSWLDAKSKELDVAEKKQEKDLITGQKK* |
Ga0098038_10160023 | 3300006735 | Marine | MTRCVYLDGWFDSKSKELDAEEKKQKKDLITGENNE* |
Ga0098038_10172663 | 3300006735 | Marine | MTRCILLDKWFDSKSEELDKAEKKEKKDLITGVKQ* |
Ga0098038_10441845 | 3300006735 | Marine | MTRCILLDEWFDSKSKELDEAEKKQKKDLITGEKK* |
Ga0098038_10567124 | 3300006735 | Marine | MTRCKLLDAWFDAKSKELDKAEKTQNKDLITGEKK* |
Ga0098038_10786334 | 3300006735 | Marine | MTRCTYLDSWFDAESKRLDKEEQKQNKDLITGEKK* |
Ga0098038_11544402 | 3300006735 | Marine | MTRCKLLDTWFDAKSKELDKAEKEKNKDLITGEKK* |
Ga0098038_11595992 | 3300006735 | Marine | MTRCNYLDGWFDAKSKELDEAESKQKKDLITGDKK* |
Ga0098037_11244083 | 3300006737 | Marine | MTRCKLLDSWFDHQSKKLDAEEKKQKKDLITGEKK* |
Ga0098037_11400204 | 3300006737 | Marine | MTRCILLDEWVDSKSKELDEAEKKQKKDLITGEKK* |
Ga0098037_11797921 | 3300006737 | Marine | MTRCKLLNTWFDTKSKELDKAEKTQNKDLITGEKISNTK* |
Ga0098042_10151812 | 3300006749 | Marine | MTRCKLLDAWFDAKSKELDKAEKTQNKDLITGEKISNTK* |
Ga0098042_10205103 | 3300006749 | Marine | MTRCNLLNTWFDAKSKELDKAEKKKNKDLITGEKK* |
Ga0098042_10533343 | 3300006749 | Marine | VSKVTRCKMLDTWFDAKSKELDLAEKKQNKDLITGEKNA* |
Ga0098042_10893523 | 3300006749 | Marine | MTRCILLDEWFDAQSKRLDKEEKKAGKDLIAGGKRES* |
Ga0098048_10095392 | 3300006752 | Marine | MMTRCAYLDGWFDAKSKELDKEEKKQKKDLITGEKSE* |
Ga0098048_10713291 | 3300006752 | Marine | MIKMTRCVYLDKWFDEQSKLLDKEEKKQKKDLITGEKNE* |
Ga0098055_10427454 | 3300006793 | Marine | MTRCVLLDSWLDAKSKELDAAEKKQEKDLITGQKK* |
Ga0098055_11158592 | 3300006793 | Marine | MTRCVLLDEWFDAESKKLDEEEEKQGKDLITGEKA* |
Ga0098055_11918205 | 3300006793 | Marine | NEMTRCILLDGWFDAWSKDLDEVEKNEQKDLITGEKNA* |
Ga0070749_100083217 | 3300006802 | Aqueous | MTRCKLLDTWFDAKSKELDKAEKTQNKDLITGEKISNTK* |
Ga0070749_100271873 | 3300006802 | Aqueous | MTRCKMLDEWFDVKSKELDLAEKKQKKDLITGEKK* |
Ga0098045_10197822 | 3300006922 | Marine | VNDMTRCKLLDEWFDAKSKELDEAESEQKKDLITGDKR* |
Ga0098051_11215901 | 3300006924 | Marine | VITLTRCTYLDSWFDAESKRLDKEETKQKKDLITGE |
Ga0098050_10354721 | 3300006925 | Marine | NNIGDLMTRCNYLDSWFDSKSKELDEAESKAKKDLITGDKK* |
Ga0098041_10567244 | 3300006928 | Marine | MTRCNYLDGWFDAKSKELDEAESKQKKDLITGEKK* |
Ga0098041_12102301 | 3300006928 | Marine | MTRCILLDGWFDAWSKDLDEVEKNEQKDLITGEKNA* |
Ga0098046_10767252 | 3300006990 | Marine | MTRCKLLDQWFDTKSKELDEEENKQKKDLITGQKK* |
Ga0098046_11018443 | 3300006990 | Marine | VVRMTRCVYLDGWFDSKSKELDAEEKKQKKDLITGENNE* |
Ga0075460_102968033 | 3300007234 | Aqueous | KMTRCKMLDEWFDVKSKELDLAEKKQKKDLITGEKK* |
Ga0099851_10459674 | 3300007538 | Aqueous | MTRCLYLDSWFDAQSKKIDEEEAKQKKDLIAGGKK* |
Ga0099851_10582933 | 3300007538 | Aqueous | MTRCQYLDSWFDAQSKRLDEEEAKKKKDLIAGGKK* |
Ga0099851_10736913 | 3300007538 | Aqueous | MTRCQYLDSWFDAQSKKLDEEEAKQKKDLIAGGKK* |
Ga0110931_10940483 | 3300007963 | Marine | TRCVLLDSWLDAKSKELDVAEKKQEKDLITGQKK* |
Ga0114905_11621082 | 3300008219 | Deep Ocean | VVKVTRCILLDGWFDAWSKDLDKVEKNEQKDLITGEKNA* |
Ga0115548_11345193 | 3300009423 | Pelagic Marine | MTRCNLLDTWFDAKSKELDLAEKKEKKDLITGEKNE* |
Ga0115013_107144794 | 3300009550 | Marine | MNNMTRCNYLDSWFDAKSKELDEAENKQKKDLITGDKK* |
Ga0115000_100720855 | 3300009705 | Marine | MTRCNYLDGWFDTKSKELDESESKQKKDLITGGKK* |
Ga0115000_109468801 | 3300009705 | Marine | MTRCNLLDTWFDAESKKLDKAESKQKKDLITGEKNE* |
Ga0098043_10300052 | 3300010148 | Marine | MTRCTYLDSWFDAESKRLDKEEAKQKKDLITGEKK* |
Ga0098043_10343951 | 3300010148 | Marine | MTRCKLLDTWFDTKSKELDKAEKAQNKDLITGEKK* |
Ga0098043_11734783 | 3300010148 | Marine | MKRCNYLYFWFDSKSKNLDEAESKAKKDLITGDKK* |
Ga0098049_10367823 | 3300010149 | Marine | MTRCILLDGWFDAWTKDLDEVEKNEQKDLITGEKNA* |
Ga0098056_10131343 | 3300010150 | Marine | MTRCNYLDSWFDSKSKELDEAESKAKKDLITGDKK* |
Ga0098056_12188442 | 3300010150 | Marine | VITLTRCTYLDSWFDAESKRLDKEETKQKKDLITGEKK* |
Ga0098061_100022021 | 3300010151 | Marine | MTRCIYLDSWFDLWSKELDKAEEKEGKDLIMGCKK* |
Ga0129351_11395911 | 3300010300 | Freshwater To Marine Saline Gradient | MTRCILLDSWFDSKSKELDTEEQKQKKDLITGEKK* |
Ga0160422_101236195 | 3300012919 | Seawater | MTRCKLLDSWLDVKSKELDKAEKKAGKDLFTGEKK* |
Ga0160423_1000259214 | 3300012920 | Surface Seawater | MTRCKLLDQWFDAKSKELDEEEKKQKKDLITGEKK* |
Ga0160423_101148372 | 3300012920 | Surface Seawater | MTRCNLLNTWFDAKSKDLDKAEKEKKKDLITGEKK* |
Ga0160423_103698962 | 3300012920 | Surface Seawater | MTRCKLLDEWFDAQSKRLDEEEKKANQDFITGEKK* |
Ga0160423_108603663 | 3300012920 | Surface Seawater | MTRCVLLDEWFDAQSKRLDEEEKKVGKDLIAGGKREP* |
Ga0160423_109584662 | 3300012920 | Surface Seawater | MTRCNLLNTWFDAKSKELDKAEKEKNKDLITGEKK* |
Ga0116813_10494182 | 3300013253 | Marine | MTRCTYLDSWFDAESKRLDEEETKQNKDLITGEKK* |
Ga0116813_10742283 | 3300013253 | Marine | MTRCTLLDQWFDSESKRLDKEEEKQKKDLITGVKR* |
Ga0181387_10172262 | 3300017709 | Seawater | MTRCNLLDTWFDAKSKQLDLAEKEQKKDLITGEKNE |
Ga0181387_10798412 | 3300017709 | Seawater | MTRCKILDKWFDAQSKRLDEKEKVQQKDLITGDKK |
Ga0181391_10998633 | 3300017713 | Seawater | MNKMTRCIYLDKWFDEQSKTLDKEEKKQKKDLITGEKNE |
Ga0181390_10008641 | 3300017719 | Seawater | MTRCVYLDGWFDAKSKELDAEEKKRKKDLITGEKSE |
Ga0181390_10044148 | 3300017719 | Seawater | MTRCIYLDKWFDEQSKTLDKEEKKQKKDLITGEKNE |
Ga0181390_10459152 | 3300017719 | Seawater | MMTRCVYLDGWFDAKSKELDAEEKKRKKDLITGEKSE |
Ga0181388_10001502 | 3300017724 | Seawater | VEARRAEVDNMTRCKLLDEWFNAKSKELDEAESEQKKDLITGDKK |
Ga0181401_10660913 | 3300017727 | Seawater | MNDMTRCVYLDGWFDAKSKELDAEEKRQKKDLITGENNE |
Ga0181417_10299924 | 3300017730 | Seawater | MTRCKMLDTWFDAKSKQLDLAEKEQKKDLITGEKNE |
Ga0181416_11751941 | 3300017731 | Seawater | MTRCNYLDSWFDSKSKELDEAESKAKKDLITGDEKXIG |
Ga0181428_11701091 | 3300017738 | Seawater | EVTKMTRCNLLDTWFDAKSKQLDLAEKEQKKDLITGEKNE |
Ga0181402_10636815 | 3300017743 | Seawater | GMNDMTRCVYLDGWFDAKSKELDAEEKRQKKDLITGENNE |
Ga0181392_12031042 | 3300017749 | Seawater | MIKMTRCVYLDGWFDAKSKELDAEEKRQKKDLITGEKNE |
Ga0181382_10822614 | 3300017756 | Seawater | GDTIMTRCVYLDGWFDAKSKELDEEEKKQKKDLITGEKNE |
Ga0181414_10735534 | 3300017759 | Seawater | DNMTRCKLLDEWFNAKSKELDEAESEQKKDLITGDKK |
Ga0181408_100000253 | 3300017760 | Seawater | VLKVTRCNLLDTWFDAKSKQLDLAEKKQKKDLITGEKNA |
Ga0181406_12206982 | 3300017767 | Seawater | EARRAEVDNMTRCKLLDEWFNAKSKELDEAESEQKKDLITGDKK |
Ga0187217_12620232 | 3300017770 | Seawater | MNDMTRCVYLDGWFDAKSKELDAEEKRQKKDLITGEKNE |
Ga0181425_10007562 | 3300017771 | Seawater | MTRCKLLDQWFDAKSKELDEEENKQKKDLITGQKK |
Ga0181425_11136022 | 3300017771 | Seawater | MTRCKLLDEWFNAKSKELDEAESEQKKDLITGDKK |
Ga0181425_11874661 | 3300017771 | Seawater | HGLHNEARIMTRCVYLDGWFDAKSKELDAEEKKQKKDLITGEKNE |
Ga0181423_10092484 | 3300017781 | Seawater | MTRCNYLDGWFDAKSKELDEAESKQKKDLITGDEK |
Ga0181423_12931492 | 3300017781 | Seawater | MTRCVYLDGWFDAKSKELDAEEKKQKKDLITGEKNE |
Ga0181379_12349942 | 3300017783 | Seawater | MTRCIYLDKWFDEQSKTLDKEEEKQKKDLITGEKNE |
Ga0181424_103000372 | 3300017786 | Seawater | MIKMTRCVYLDGWFDAKSKELDAEEKKRKQDLITGEKSE |
Ga0181424_104103761 | 3300017786 | Seawater | VEARRAEVDKMTRCKLLDEWFNAKSKELDEAESEQKKDLITGDKK |
Ga0181584_105316682 | 3300017949 | Salt Marsh | MTRCIYLDSWFDAQSKRLDEEELKQKKDLITGERK |
Ga0181589_106689413 | 3300017964 | Salt Marsh | FGEINMTRCIYLDSWFDAQSKRLDEEELKQKKDLITGERK |
Ga0181592_100949556 | 3300018421 | Salt Marsh | MTRCKLLDTWFDAKSKELDKAEKTQNKDLITGEKI |
Ga0181592_104636101 | 3300018421 | Salt Marsh | MTRCKMLDEWFDVKSKELDLAEKKQKKDLITGEKK |
Ga0181591_101163812 | 3300018424 | Salt Marsh | MTRCKLLDTWFDAKSKELDKAEKTQNKDLITGEKISNTK |
Ga0181566_107118502 | 3300018426 | Salt Marsh | MTRCLYLDSWFDAQSKRLDEEELKQKKDLITGERK |
Ga0211707_10200225 | 3300020246 | Marine | MTRCTLLDKWLDVESKRLDKEEEKQNKDLITGEKK |
Ga0211667_10949043 | 3300020282 | Marine | MTRCKLLDSWLDVKSKELDKAEKKAGKDLFTGEKK |
Ga0211666_1001236510 | 3300020392 | Marine | MTRCKLLDSWLDVKSKELDKAEKKAGKDLLTGEKK |
Ga0211497_100123463 | 3300020394 | Marine | MTRCNYLDGWFDAKSKELDEAEKKQKKDLITGEKK |
Ga0211532_1000810810 | 3300020403 | Marine | MTRCNLLDTWFDAKSKELDKAEKKEKKDLITGEKK |
Ga0211532_100813413 | 3300020403 | Marine | MRLKKGDLMTRCNYLDSWFDFKSKELDEAESKAKKDLITGDKK |
Ga0211532_102409991 | 3300020403 | Marine | VIKGDLITLTRCTLLDKWFDAESKRLDKEEEKQKK |
Ga0211532_102870401 | 3300020403 | Marine | MNMTRCNYLDGWFDAKSKELDEAEKKQKKDLITGE |
Ga0211668_1000214217 | 3300020406 | Marine | MTRCKMLDGWIDVQSKRLDEAEKKQKKDLITGKKA |
Ga0211653_100468283 | 3300020421 | Marine | MTRCKLLDSWFDHQSKRLDAEEKKQKKDLITGEKK |
Ga0211539_102178523 | 3300020437 | Marine | MINMTRCNLLNTWFDAKSKELDKAEKEKKRDLITGEKK |
Ga0211638_100546622 | 3300020448 | Marine | MTRCVLLDSWLDAKSKELDEAEKKAGKKILAGVLK |
Ga0211643_100486613 | 3300020457 | Marine | MTRCKLLDTWFDTKSKELDKAEKAQNKDLITGEKK |
Ga0213867_12904862 | 3300021335 | Seawater | MTRCNYLDSWFDAKSKELDEAESKQKKDLITGDKK |
Ga0213860_102586392 | 3300021368 | Seawater | MTRCKLLDTWFDAKSKELDKAEKTQNKDLITGEKINNTK |
Ga0222717_100711292 | 3300021957 | Estuarine Water | MMTRCVYLDGWFDAKSKELDAEEKKRKQDLITGEKSE |
Ga0222717_104409972 | 3300021957 | Estuarine Water | MTRCVLLDKWFDEQSKVLDQAEKEQKKDLITGEKNDS |
Ga0222716_104430223 | 3300021959 | Estuarine Water | MTRCNYLDGWFDAKSKELDEAESKQKKDLITGENK |
Ga0212029_10040602 | 3300022063 | Aqueous | MTRCQYLDSWFDAQSKRLDEEEAKKKKDLIAGGKK |
Ga0212021_10054762 | 3300022068 | Aqueous | MTRCKLLDQWFDSKSKELDKEENKQKKDLITGQKK |
Ga0212031_10172883 | 3300022176 | Aqueous | MTRCLYLDSWFDAQSKKIDEEEAKQKKDLIAGGKKXVGGA |
Ga0196905_10393183 | 3300022198 | Aqueous | MTRCQYLDSWFDAQSKKLDEEEAKQKKDLIAGGKKXKIG |
Ga0196901_100280112 | 3300022200 | Aqueous | MTRCLYLDSWFDAQSKKIDEEEAKQKKDLIAGGKK |
Ga0208667_10003672 | 3300025070 | Marine | MMTRCAYLDGWFDAKSKELDKEEKKQKKDLITGEKSE |
Ga0208667_10578833 | 3300025070 | Marine | VNDMTRCKLLDEWFDAKSKELDEAESEQKKDLITGDKR |
Ga0208298_10170394 | 3300025084 | Marine | MTRCVLLDSWLDAKSKELDAAEKKQEKDLITGQKK |
Ga0208157_10115123 | 3300025086 | Marine | MTRCVLLDSWLDAKSKELDVAEKKQEKDLITGQKK |
Ga0208157_10175994 | 3300025086 | Marine | MTRCTYLDSWFDAESKRLDKEEQKQNKDLITGEKK |
Ga0208159_100111310 | 3300025101 | Marine | MTRCKLLDTWFDAKSKELDKAEKEKNKDLITGEKK |
Ga0208159_10901533 | 3300025101 | Marine | MTRCILLDEWFDAQSKRLDKEEKKAGKDLIAGGKRES |
Ga0208159_10952602 | 3300025101 | Marine | MTRCKLLDAWFDAKSKELDKAEKTQNKDLITGEKISNTK |
Ga0208666_10224025 | 3300025102 | Marine | MTRCVYLDGWFDSKSKELDAEEKKQKKDLITGENNE |
Ga0208666_10301093 | 3300025102 | Marine | MTRCILLDKWFDSKSEELDKAEKKEKKDLITGVKQ |
Ga0208666_10361152 | 3300025102 | Marine | MTRCKLLDTWFDAKSKELDKAEKEKKKDLITGEKKLG |
Ga0208666_11015142 | 3300025102 | Marine | VNEMTRCVLLDKWFDEQSKVLDQAEKEQKKDLITGEKNDS |
Ga0208793_11730342 | 3300025108 | Marine | MTRCVLLDEWFDAESKKLDEEEEKQGKDLITGEKA |
Ga0208158_10213394 | 3300025110 | Marine | MTRCNLLNTWFDAKSKELDKAEKKKNKDLITGEKK |
Ga0209348_100004473 | 3300025127 | Marine | MTRCKLLDQWFDAKSKELDEEEKKQKKDLITGEKK |
Ga0209348_10492311 | 3300025127 | Marine | VNNMTRCNYLDGWFDAKSKELDEAESKQKKDLITGDKK |
Ga0208919_11330691 | 3300025128 | Marine | KNMTRCNYLDGWFDAKSKELDEAESKQKKDLITGEKK |
Ga0209232_10511122 | 3300025132 | Marine | MTRCKLLDSWFDHQSKKLDAEEKKQKKDLITGEKK |
Ga0209232_12127011 | 3300025132 | Marine | MTRCNYLDSWFDSKSKELDEAESKAKKDLITGDKK |
Ga0209336_100572205 | 3300025137 | Marine | MTRCTYLDSWFDAESKRLDKEETKQKKDLITGEKK |
Ga0209634_12462662 | 3300025138 | Marine | VNNMTRCNYLDGWFDAKSKELDEAESKQKKDLITGDEK |
Ga0209645_100026418 | 3300025151 | Marine | MTRCKLLDTWFDVKSKELDKAEKTQNKDLITGEKISNTK |
Ga0209645_10007818 | 3300025151 | Marine | MTRCKLLDQWFDAKSKELDKEEDKQKKDLITGEKK |
Ga0209645_10084817 | 3300025151 | Marine | MILDLKKMINMTRCNYLDGWFDAKSKELDEAEKKQKKDLITGDKK |
Ga0209645_10203359 | 3300025151 | Marine | MTRCKLLDQWFDAKSKELDKEEHKQKKDLITGEKK |
Ga0209645_10460302 | 3300025151 | Marine | MTRCSLLDTWFDAKSKELDKAEKKEKKDLITGEKK |
Ga0209645_10477053 | 3300025151 | Marine | MTRCKLLDTWFDVKSKELDKAEKTQNKDLITGEKK |
Ga0209645_11248663 | 3300025151 | Marine | MTRCKLLDQWFDAKSKELDKEEEKQNKDLITGEKKXTGNLS |
Ga0209645_11597002 | 3300025151 | Marine | MTRCKMLDEWFDVKSKELDLAEKKQKKDLITGEKNA |
Ga0209645_12137692 | 3300025151 | Marine | MTRCKLLDEWFDAKSKELDKAEKKDGKDLITGEKK |
Ga0209337_10013502 | 3300025168 | Marine | MTRCNLLDKWFDAESKRLDEAEKKQKKDLITGEKNE |
Ga0209337_10810762 | 3300025168 | Marine | MTRCTYLDSWFDAESKRLDKEEEKQNKDLITGEKK |
Ga0209337_12895942 | 3300025168 | Marine | MTRCVYLDKWFDEQSKVLDQAEKEQKKDLITGEKNES |
Ga0208160_10746182 | 3300025647 | Aqueous | MTRCQYLDSWFDAQSKKLDEEEAKQKKDLIAGGKK |
Ga0208162_10364805 | 3300025674 | Aqueous | MTRCILLDSWFDSKSKELDTEEQKQKKDLITGEKK |
Ga0209482_10055168 | 3300027668 | Marine | MTRCTLLDTWIDAESKRLDKEEKKQTKDLITGEKK |
Ga0209091_103219232 | 3300027801 | Marine | MTRCNYLDGWFDTKSKELDESESKQKKDLITGGKK |
Ga0209503_102874042 | 3300027859 | Marine | MTRCNYLDSWFDAKSKELDEAENKQKKDLITGDKK |
Ga0135227_10270993 | 3300029302 | Marine Harbor | MINMTRCNLLNTWFDAKSKELDKAEKEKKKDLITGEKK |
Ga0183683_10042504 | 3300029309 | Marine | MTRCKLLDSWLDVKSKELDEAEKKAGKDLITGRKK |
Ga0183683_10572511 | 3300029309 | Marine | TRCKLLDSWLDAKSKELDKAEKKAGKDLFTGEKKXLGKI |
Ga0183748_100137721 | 3300029319 | Marine | MTRCKLLDTWFDAKSKELDKAEKAQNKDLITGEKK |
Ga0183755_100063212 | 3300029448 | Marine | VNEMTRCNYLDAWFDAKSKELDKAESKQNKDLITGDKK |
Ga0183755_100247015 | 3300029448 | Marine | MTRCVLLDEWFNAWSKDLDKVEKNEQKDLITGEKNA |
Ga0183757_100090510 | 3300029787 | Marine | MTRCKLLDRWFDAKSKELDKEEEQQKKDLITGEKK |
Ga0183757_10246384 | 3300029787 | Marine | MTRCNYLDGWFDAKSKELDEAESKQKKDLITGDKK |
Ga0315332_1000061913 | 3300031773 | Seawater | VRIKKGGLMTRCNYLDSWFDSKSKELDEAESKAKKDLITGDEK |
Ga0315331_100415547 | 3300031774 | Seawater | MTRCNYLDSWFDSKSKELDEAESKAKKDLITGDEK |
Ga0315320_1000051423 | 3300031851 | Seawater | MTRCVYLDGWFDAKSKELDEEEKKQKKDLITGEKNE |
Ga0315316_113597513 | 3300032011 | Seawater | MGDTIMTRCVYLDGWFDAKSKELDEEEKKQKKDLITGEKNE |
Ga0316202_1000121312 | 3300032277 | Microbial Mat | MTRCVLLDEWFNAWSKDLDEAEKKEKKDLITGEKNA |
Ga0316204_103392712 | 3300032373 | Microbial Mat | MNKMTRCVLLDEWFNAWSSELDEAEKKEKKDLITGEKKCVKVR |
⦗Top⦘ |