NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F032304

Metagenome / Metatranscriptome Family F032304

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F032304
Family Type Metagenome / Metatranscriptome
Number of Sequences 180
Average Sequence Length 68 residues
Representative Sequence MKHSESGNRKVMKQLKKCPDIEEIRATASGHMILAKNGQQYLAHFSAKAFHPLRRWLKKNTSLKNLRF
Number of Associated Samples 149
Number of Associated Scaffolds 180

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 17.32 %
% of genes near scaffold ends (potentially truncated) 24.44 %
% of genes from short scaffolds (< 2000 bps) 66.67 %
Associated GOLD sequencing projects 137
AlphaFold2 3D model prediction Yes
3D model pTM-score0.63

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (61.111 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(26.667 % of family members)
Environment Ontology (ENVO) Unclassified
(70.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(82.778 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 30.21%    β-sheet: 17.71%    Coil/Unstructured: 52.08%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.63
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 180 Family Scaffolds
PF06067DUF932 6.67
PF00082Peptidase_S8 2.22
PF04542Sigma70_r2 1.11
PF13589HATPase_c_3 0.56
PF04488Gly_transf_sug 0.56
PF02562PhoH 0.56
PF03851UvdE 0.56
PF00565SNase 0.56
PF13361UvrD_C 0.56

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 180 Family Scaffolds
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 1.11
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 1.11
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 1.11
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 1.11
COG1702Phosphate starvation-inducible protein PhoH, predicted ATPaseSignal transduction mechanisms [T] 0.56
COG1875Predicted ribonuclease YlaK, contains NYN-type RNase and PhoH-family ATPase domainsGeneral function prediction only [R] 0.56
COG3774Mannosyltransferase OCH1 or related enzymeCell wall/membrane/envelope biogenesis [M] 0.56
COG4294UV DNA damage repair endonucleaseReplication, recombination and repair [L] 0.56


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms75.56 %
UnclassifiedrootN/A24.44 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000225|SI34jun09_120mDRAFT_1017075Not Available2095Open in IMG/M
3300000325|SI39nov09_100mDRAFT_1020805Not Available1422Open in IMG/M
3300000928|OpTDRAFT_10028672Not Available3871Open in IMG/M
3300001778|ACM18_1021123All Organisms → cellular organisms → Bacteria → Proteobacteria601Open in IMG/M
3300002242|KVWGV2_10561858All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium1202Open in IMG/M
3300002514|JGI25133J35611_10074129All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Halobacteriovoraceae → Halobacteriovorax → unclassified Halobacteriovorax → Halobacteriovorax sp.1063Open in IMG/M
3300003263|JGI26117J46588_1002759All Organisms → Viruses → Predicted Viral1973Open in IMG/M
3300003478|JGI26238J51125_1004818Not Available4140Open in IMG/M
3300003620|JGI26273J51734_10002881All Organisms → cellular organisms → Bacteria8602Open in IMG/M
3300003620|JGI26273J51734_10045545Not Available1427Open in IMG/M
3300004097|Ga0055584_100014712Not Available7691Open in IMG/M
3300004097|Ga0055584_101213724All Organisms → cellular organisms → Bacteria787Open in IMG/M
3300004280|Ga0066606_10120620All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon980Open in IMG/M
3300005430|Ga0066849_10027325All Organisms → cellular organisms → Bacteria2312Open in IMG/M
3300005521|Ga0066862_10238197All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Halobacteriovoraceae → Halobacteriovorax → unclassified Halobacteriovorax → Halobacteriovorax sp.597Open in IMG/M
3300005522|Ga0066861_10070399All Organisms → Viruses → Predicted Viral1229Open in IMG/M
3300005593|Ga0066837_10304457All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Halobacteriovoraceae → Halobacteriovorax → unclassified Halobacteriovorax → Halobacteriovorax sp.559Open in IMG/M
3300005605|Ga0066850_10293463All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Halobacteriovoraceae → Halobacteriovorax → unclassified Halobacteriovorax → Halobacteriovorax sp.574Open in IMG/M
3300005606|Ga0066835_10000242All Organisms → cellular organisms → Bacteria10862Open in IMG/M
3300005606|Ga0066835_10014947All Organisms → cellular organisms → Bacteria2040Open in IMG/M
3300005606|Ga0066835_10017977All Organisms → Viruses → Predicted Viral1897Open in IMG/M
3300006327|Ga0068499_1019770All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Halobacteriovoraceae → Halobacteriovorax → unclassified Halobacteriovorax → Halobacteriovorax sp.642Open in IMG/M
3300006332|Ga0068500_1040191All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Halobacteriovoraceae → Halobacteriovorax → unclassified Halobacteriovorax → Halobacteriovorax sp.965Open in IMG/M
3300006332|Ga0068500_1262974All Organisms → cellular organisms → Bacteria1170Open in IMG/M
3300006340|Ga0068503_10224302All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon1060Open in IMG/M
3300006738|Ga0098035_1030431Not Available2052Open in IMG/M
3300006738|Ga0098035_1066621All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Halobacteriovoraceae → Halobacteriovorax → unclassified Halobacteriovorax → Halobacteriovorax sp.1290Open in IMG/M
3300006738|Ga0098035_1077550All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Halobacteriovoraceae → Halobacteriovorax → unclassified Halobacteriovorax → Halobacteriovorax sp.1178Open in IMG/M
3300006749|Ga0098042_1044996Not Available1212Open in IMG/M
3300006750|Ga0098058_1129850All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Halobacteriovoraceae → Halobacteriovorax → unclassified Halobacteriovorax → Halobacteriovorax sp.671Open in IMG/M
3300006753|Ga0098039_1117536All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Halobacteriovoraceae → Halobacteriovorax → unclassified Halobacteriovorax → Halobacteriovorax sp.913Open in IMG/M
3300006753|Ga0098039_1244960All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Halobacteriovoraceae → Halobacteriovorax → unclassified Halobacteriovorax → Halobacteriovorax sp.603Open in IMG/M
3300006902|Ga0066372_10216175All Organisms → Viruses → Predicted Viral1055Open in IMG/M
3300006902|Ga0066372_10497825All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Halobacteriovoraceae → Halobacteriovorax → unclassified Halobacteriovorax → Halobacteriovorax sp.716Open in IMG/M
3300006919|Ga0070746_10133683All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Halobacteriovoraceae → Halobacteriovorax → unclassified Halobacteriovorax → Halobacteriovorax sp.1218Open in IMG/M
3300006924|Ga0098051_1214289All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Halobacteriovoraceae → Halobacteriovorax → unclassified Halobacteriovorax → Halobacteriovorax sp.500Open in IMG/M
3300007283|Ga0066366_10495029All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Halobacteriovoraceae → Halobacteriovorax → unclassified Halobacteriovorax → Halobacteriovorax sp.540Open in IMG/M
3300007514|Ga0105020_1006688Not Available12689Open in IMG/M
3300007514|Ga0105020_1006855Not Available12503Open in IMG/M
3300007539|Ga0099849_1036627All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Halobacteriovoraceae → Halobacteriovorax → unclassified Halobacteriovorax → Halobacteriovorax sp.2082Open in IMG/M
3300007554|Ga0102820_1009945All Organisms → cellular organisms → Bacteria2418Open in IMG/M
3300007777|Ga0105711_1461878All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Halobacteriovoraceae → Halobacteriovorax → unclassified Halobacteriovorax → Halobacteriovorax sp.576Open in IMG/M
3300008050|Ga0098052_1224142All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Halobacteriovoraceae → Halobacteriovorax → unclassified Halobacteriovorax → Halobacteriovorax sp.725Open in IMG/M
3300008216|Ga0114898_1140018All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Halobacteriovoraceae → Halobacteriovorax → unclassified Halobacteriovorax → Halobacteriovorax sp.701Open in IMG/M
3300008624|Ga0115652_1012868Not Available3760Open in IMG/M
3300008952|Ga0115651_1192141All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon1380Open in IMG/M
3300008952|Ga0115651_1281874All Organisms → Viruses → Predicted Viral1045Open in IMG/M
3300009008|Ga0115649_1412317All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Halobacteriovoraceae → Halobacteriovorax → unclassified Halobacteriovorax → Halobacteriovorax sp.725Open in IMG/M
3300009103|Ga0117901_1041730Not Available3141Open in IMG/M
3300009103|Ga0117901_1047887All Organisms → Viruses → Predicted Viral2865Open in IMG/M
3300009130|Ga0118729_1006984Not Available9712Open in IMG/M
3300009132|Ga0118730_1002848Not Available18495Open in IMG/M
3300009172|Ga0114995_10215258All Organisms → Viruses → Predicted Viral1065Open in IMG/M
3300009339|Ga0117928_1080672All Organisms → Viruses → Predicted Viral1357Open in IMG/M
3300009370|Ga0118716_1032963Not Available3494Open in IMG/M
3300009425|Ga0114997_10531513All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Halobacteriovoraceae → Halobacteriovorax → unclassified Halobacteriovorax → Halobacteriovorax sp.624Open in IMG/M
3300009488|Ga0114925_11424288All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Halobacteriovoraceae → Halobacteriovorax → unclassified Halobacteriovorax → Halobacteriovorax sp.513Open in IMG/M
3300009605|Ga0114906_1008775Not Available4491Open in IMG/M
3300009622|Ga0105173_1103847All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Halobacteriovoraceae → Halobacteriovorax → unclassified Halobacteriovorax → Halobacteriovorax sp.524Open in IMG/M
3300010148|Ga0098043_1029433Not Available1732Open in IMG/M
3300010153|Ga0098059_1008299Not Available4428Open in IMG/M
3300010155|Ga0098047_10347655All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Halobacteriovoraceae → Halobacteriovorax → unclassified Halobacteriovorax → Halobacteriovorax sp.557Open in IMG/M
3300010299|Ga0129342_1025540All Organisms → cellular organisms → Bacteria2397Open in IMG/M
3300010883|Ga0133547_10337781Not Available3107Open in IMG/M
3300010883|Ga0133547_11604076All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Halobacteriovoraceae → Halobacteriovorax → unclassified Halobacteriovorax → Halobacteriovorax sp.1215Open in IMG/M
3300012919|Ga0160422_10003015Not Available10435Open in IMG/M
3300012928|Ga0163110_10000119All Organisms → cellular organisms → Bacteria33780Open in IMG/M
3300012952|Ga0163180_10332894Not Available1089Open in IMG/M
3300012952|Ga0163180_10581897All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Halobacteriovoraceae → Halobacteriovorax → unclassified Halobacteriovorax → Halobacteriovorax sp.849Open in IMG/M
3300012953|Ga0163179_10138878All Organisms → Viruses → Predicted Viral1804Open in IMG/M
3300012953|Ga0163179_10463239All Organisms → Viruses → Predicted Viral1041Open in IMG/M
3300012953|Ga0163179_11212034All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Halobacteriovoraceae → Halobacteriovorax → unclassified Halobacteriovorax → Halobacteriovorax sp.668Open in IMG/M
3300013252|Ga0116817_1033655All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Halobacteriovoraceae → Halobacteriovorax → unclassified Halobacteriovorax → Halobacteriovorax sp.595Open in IMG/M
3300016797|Ga0182090_1103792All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes818Open in IMG/M
3300017702|Ga0181374_1059945All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Halobacteriovoraceae → Halobacteriovorax → unclassified Halobacteriovorax → Halobacteriovorax sp.643Open in IMG/M
3300017705|Ga0181372_1028912All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon941Open in IMG/M
3300017743|Ga0181402_1000574All Organisms → cellular organisms → Bacteria13740Open in IMG/M
3300017767|Ga0181406_1045262All Organisms → cellular organisms → Bacteria1364Open in IMG/M
3300017824|Ga0181552_10214363All Organisms → cellular organisms → Bacteria987Open in IMG/M
3300017952|Ga0181583_10630194All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Halobacteriovoraceae → Halobacteriovorax → unclassified Halobacteriovorax → Halobacteriovorax sp.643Open in IMG/M
3300018036|Ga0181600_10006298All Organisms → cellular organisms → Bacteria8873Open in IMG/M
3300018041|Ga0181601_10134249All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Halobacteriovoraceae → Halobacteriovorax → unclassified Halobacteriovorax → Halobacteriovorax sp.1540Open in IMG/M
3300018410|Ga0181561_10104485All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Halobacteriovoraceae → Halobacteriovorax → unclassified Halobacteriovorax → Halobacteriovorax sp.1540Open in IMG/M
3300018426|Ga0181566_11095564All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Halobacteriovoraceae → Halobacteriovorax → unclassified Halobacteriovorax → Halobacteriovorax sp.534Open in IMG/M
3300019459|Ga0181562_10462360All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Halobacteriovoraceae → Halobacteriovorax → unclassified Halobacteriovorax → Halobacteriovorax sp.606Open in IMG/M
3300019756|Ga0194023_1015568All Organisms → cellular organisms → Bacteria1536Open in IMG/M
3300019756|Ga0194023_1047315All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Halobacteriovoraceae → Halobacteriovorax → unclassified Halobacteriovorax → Halobacteriovorax sp.866Open in IMG/M
3300020185|Ga0206131_10000275Not Available74298Open in IMG/M
3300020191|Ga0181604_10094599Not Available1616Open in IMG/M
3300020260|Ga0211588_1001161All Organisms → cellular organisms → Bacteria3792Open in IMG/M
3300020265|Ga0211533_1024497All Organisms → Viruses → Predicted Viral1049Open in IMG/M
3300020299|Ga0211615_1016638All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Halobacteriovoraceae → Halobacteriovorax → unclassified Halobacteriovorax → Halobacteriovorax sp.1025Open in IMG/M
3300020320|Ga0211597_1057226All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium741Open in IMG/M
3300020347|Ga0211504_1084828All Organisms → cellular organisms → Bacteria721Open in IMG/M
3300020348|Ga0211600_1152807All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Halobacteriovoraceae → Halobacteriovorax → unclassified Halobacteriovorax → Halobacteriovorax sp.504Open in IMG/M
3300020366|Ga0211489_10005869Not Available3276Open in IMG/M
3300020374|Ga0211477_10003307All Organisms → cellular organisms → Bacteria9077Open in IMG/M
3300020381|Ga0211476_10039354All Organisms → Viruses → Predicted Viral1983Open in IMG/M
3300020402|Ga0211499_10251219All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Halobacteriovoraceae → Halobacteriovorax → unclassified Halobacteriovorax → Halobacteriovorax sp.624Open in IMG/M
3300020405|Ga0211496_10069443Not Available1272Open in IMG/M
3300020410|Ga0211699_10003200Not Available7669Open in IMG/M
3300020410|Ga0211699_10293624All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Halobacteriovoraceae → Halobacteriovorax → unclassified Halobacteriovorax → Halobacteriovorax sp.633Open in IMG/M
3300020413|Ga0211516_10472410All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Halobacteriovoraceae → Halobacteriovorax → unclassified Halobacteriovorax → Halobacteriovorax sp.550Open in IMG/M
3300020419|Ga0211512_10508379All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Halobacteriovoraceae → Halobacteriovorax → unclassified Halobacteriovorax → Halobacteriovorax sp.536Open in IMG/M
3300020438|Ga0211576_10488613All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Halobacteriovoraceae → Halobacteriovorax → unclassified Halobacteriovorax → Halobacteriovorax sp.622Open in IMG/M
3300020439|Ga0211558_10039091Not Available2390Open in IMG/M
3300020449|Ga0211642_10310549All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Halobacteriovoraceae → Halobacteriovorax → unclassified Halobacteriovorax → Halobacteriovorax sp.678Open in IMG/M
3300020452|Ga0211545_10015813Not Available3862Open in IMG/M
3300020457|Ga0211643_10065127All Organisms → Viruses → Predicted Viral1805Open in IMG/M
3300020469|Ga0211577_10000054All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales104956Open in IMG/M
3300020475|Ga0211541_10508369All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Halobacteriovoraceae → Halobacteriovorax → unclassified Halobacteriovorax → Halobacteriovorax sp.588Open in IMG/M
3300020477|Ga0211585_10010107All Organisms → cellular organisms → Bacteria8795Open in IMG/M
3300020478|Ga0211503_10078682All Organisms → cellular organisms → Bacteria1982Open in IMG/M
3300021356|Ga0213858_10000318All Organisms → cellular organisms → Bacteria23220Open in IMG/M
3300021356|Ga0213858_10011175All Organisms → cellular organisms → Bacteria4240Open in IMG/M
3300021364|Ga0213859_10515358All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Halobacteriovoraceae → Halobacteriovorax → unclassified Halobacteriovorax → Halobacteriovorax sp.518Open in IMG/M
3300021425|Ga0213866_10037174Not Available2813Open in IMG/M
3300021443|Ga0206681_10293130All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Halobacteriovoraceae → Halobacteriovorax → unclassified Halobacteriovorax → Halobacteriovorax sp.631Open in IMG/M
3300021957|Ga0222717_10057491Not Available2505Open in IMG/M
3300021958|Ga0222718_10034250Not Available3365Open in IMG/M
3300021960|Ga0222715_10567193All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Halobacteriovoraceae → Halobacteriovorax → unclassified Halobacteriovorax → Halobacteriovorax sp.591Open in IMG/M
3300022925|Ga0255773_10343113All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Halobacteriovoraceae → Halobacteriovorax → unclassified Halobacteriovorax → Halobacteriovorax sp.590Open in IMG/M
(restricted) 3300023109|Ga0233432_10479197All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Halobacteriovoraceae → Halobacteriovorax → unclassified Halobacteriovorax → Halobacteriovorax sp.525Open in IMG/M
(restricted) 3300023112|Ga0233411_10000988Not Available8331Open in IMG/M
(restricted) 3300024264|Ga0233444_10005677All Organisms → cellular organisms → Bacteria11425Open in IMG/M
(restricted) 3300024264|Ga0233444_10016826Not Available5391Open in IMG/M
3300024344|Ga0209992_10233196All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Halobacteriovoraceae → Halobacteriovorax → unclassified Halobacteriovorax → Halobacteriovorax sp.770Open in IMG/M
3300024346|Ga0244775_10000923All Organisms → cellular organisms → Bacteria35322Open in IMG/M
3300024346|Ga0244775_11541465All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Halobacteriovoraceae → Halobacteriovorax → unclassified Halobacteriovorax → Halobacteriovorax sp.507Open in IMG/M
3300025072|Ga0208920_1045333Not Available886Open in IMG/M
3300025112|Ga0209349_1160719All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Halobacteriovoraceae → Halobacteriovorax → unclassified Halobacteriovorax → Halobacteriovorax sp.598Open in IMG/M
3300025114|Ga0208433_1015978All Organisms → Viruses → Predicted Viral2170Open in IMG/M
3300025122|Ga0209434_1128019All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Halobacteriovoraceae → Halobacteriovorax → unclassified Halobacteriovorax → Halobacteriovorax sp.704Open in IMG/M
3300025125|Ga0209644_1066283All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Halobacteriovoraceae → Halobacteriovorax → unclassified Halobacteriovorax → Halobacteriovorax sp.838Open in IMG/M
3300025125|Ga0209644_1145392All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Halobacteriovoraceae → Halobacteriovorax → unclassified Halobacteriovorax → Halobacteriovorax sp.565Open in IMG/M
3300025132|Ga0209232_1000944Not Available16578Open in IMG/M
3300025141|Ga0209756_1102974All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Halobacteriovoraceae → Halobacteriovorax → unclassified Halobacteriovorax → Halobacteriovorax sp.1228Open in IMG/M
3300025267|Ga0208179_1104512All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Halobacteriovoraceae → Halobacteriovorax → unclassified Halobacteriovorax → Halobacteriovorax sp.553Open in IMG/M
3300025277|Ga0208180_1040417All Organisms → Viruses → Predicted Viral1255Open in IMG/M
3300025282|Ga0208030_1033142All Organisms → Viruses → Predicted Viral1579Open in IMG/M
3300025658|Ga0209659_1064686All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Halobacteriovoraceae → Halobacteriovorax → unclassified Halobacteriovorax → Halobacteriovorax sp.1288Open in IMG/M
3300025665|Ga0209360_1149231All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Halobacteriovoraceae → Halobacteriovorax → unclassified Halobacteriovorax → Halobacteriovorax sp.645Open in IMG/M
3300025674|Ga0208162_1028461All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Halobacteriovoraceae → Halobacteriovorax → unclassified Halobacteriovorax → Halobacteriovorax sp.2068Open in IMG/M
3300025681|Ga0209263_1188979All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Halobacteriovoraceae → Halobacteriovorax → unclassified Halobacteriovorax → Halobacteriovorax sp.569Open in IMG/M
3300025870|Ga0209666_1000068All Organisms → cellular organisms → Bacteria80842Open in IMG/M
3300025880|Ga0209534_10004144All Organisms → cellular organisms → Bacteria13482Open in IMG/M
3300026189|Ga0208405_1000021All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium31491Open in IMG/M
3300026189|Ga0208405_1003406All Organisms → cellular organisms → Bacteria2669Open in IMG/M
3300026189|Ga0208405_1053603All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Halobacteriovoraceae → Halobacteriovorax → unclassified Halobacteriovorax → Halobacteriovorax sp.604Open in IMG/M
3300026263|Ga0207992_1174169All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Halobacteriovoraceae → Halobacteriovorax → unclassified Halobacteriovorax → Halobacteriovorax sp.526Open in IMG/M
3300026266|Ga0208410_1043714All Organisms → Viruses → Predicted Viral1282Open in IMG/M
3300026269|Ga0208766_1051267All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Halobacteriovoraceae → Halobacteriovorax → unclassified Halobacteriovorax → Halobacteriovorax sp.1296Open in IMG/M
3300027192|Ga0208673_1019782Not Available1158Open in IMG/M
3300027906|Ga0209404_10364351All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Halobacteriovoraceae → Halobacteriovorax → unclassified Halobacteriovorax → Halobacteriovorax sp.935Open in IMG/M
3300027906|Ga0209404_10418588All Organisms → cellular organisms → Bacteria → Proteobacteria875Open in IMG/M
(restricted) 3300027996|Ga0233413_10001232Not Available11398Open in IMG/M
3300028022|Ga0256382_1084858All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Halobacteriovoraceae → Halobacteriovorax → unclassified Halobacteriovorax → Halobacteriovorax sp.756Open in IMG/M
(restricted) 3300028045|Ga0233414_10039025All Organisms → cellular organisms → Bacteria1925Open in IMG/M
3300028192|Ga0257107_1155844All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Halobacteriovoraceae → Halobacteriovorax → unclassified Halobacteriovorax → Halobacteriovorax sp.665Open in IMG/M
3300028196|Ga0257114_1109833Not Available1109Open in IMG/M
3300028487|Ga0257109_1123119All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Halobacteriovoraceae → Halobacteriovorax → unclassified Halobacteriovorax → Halobacteriovorax sp.775Open in IMG/M
3300029319|Ga0183748_1001899All Organisms → cellular organisms → Bacteria11913Open in IMG/M
3300029319|Ga0183748_1121557All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Halobacteriovoraceae → Halobacteriovorax → unclassified Halobacteriovorax → Halobacteriovorax sp.564Open in IMG/M
3300031605|Ga0302132_10136344Not Available1218Open in IMG/M
3300031606|Ga0302119_10009677All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium4129Open in IMG/M
3300031606|Ga0302119_10036305All Organisms → Viruses → Predicted Viral2075Open in IMG/M
3300031701|Ga0302120_10024091Not Available2647Open in IMG/M
3300031757|Ga0315328_10106325All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Halobacteriovoraceae → Halobacteriovorax → unclassified Halobacteriovorax → Halobacteriovorax sp.1617Open in IMG/M
3300031773|Ga0315332_10410424All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Halobacteriovoraceae → Halobacteriovorax → unclassified Halobacteriovorax → Halobacteriovorax sp.863Open in IMG/M
3300031774|Ga0315331_10006728All Organisms → cellular organisms → Bacteria8582Open in IMG/M
3300031774|Ga0315331_10855918Not Available630Open in IMG/M
3300031861|Ga0315319_10684315All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Halobacteriovoraceae → Halobacteriovorax → unclassified Halobacteriovorax → Halobacteriovorax sp.503Open in IMG/M
3300031886|Ga0315318_10002174Not Available8783Open in IMG/M
3300031886|Ga0315318_10211973All Organisms → Viruses → Predicted Viral1105Open in IMG/M
3300032006|Ga0310344_10483222All Organisms → Viruses → Predicted Viral1063Open in IMG/M
3300032006|Ga0310344_11127942All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Halobacteriovoraceae → Halobacteriovorax → unclassified Halobacteriovorax → Halobacteriovorax sp.653Open in IMG/M
3300032011|Ga0315316_11168196All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Halobacteriovoraceae → Halobacteriovorax → unclassified Halobacteriovorax → Halobacteriovorax sp.620Open in IMG/M
3300032278|Ga0310345_10627256All Organisms → Viruses → Predicted Viral1037Open in IMG/M
3300032278|Ga0310345_10766540Not Available937Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine26.67%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine17.22%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine6.67%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh5.56%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine5.00%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater5.00%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater3.33%
Deep OceanEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean2.78%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater2.78%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater2.22%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater2.22%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater1.67%
MarineEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Marine1.67%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous1.67%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water1.67%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine1.67%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine1.11%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine1.11%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine1.11%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater1.11%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater1.11%
Marine PlanktonEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton0.56%
Marine OceanicEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine Oceanic0.56%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater0.56%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater0.56%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface0.56%
MarineEnvironmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine0.56%
MarineEnvironmental → Aquatic → Marine → Inlet → Unclassified → Marine0.56%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.56%
Freshwater And MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine0.56%
Diffuse Vent Fluid, Hydrothermal VentsEnvironmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Vent Fluid, Hydrothermal Vents0.56%
Marine SedimentEnvironmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment0.56%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface0.56%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000225Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 34 06/16/09 120mEnvironmentalOpen in IMG/M
3300000325Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 39 11/10/09 100mEnvironmentalOpen in IMG/M
3300000928Marine plume microbial communities from the Columbia River - 25 PSUEnvironmentalOpen in IMG/M
3300001778Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM18, ROCA_DNA027_0.2um_3gEnvironmentalOpen in IMG/M
3300002242Marine sediment microbial communities from Kolumbo Volcano mats, Greece - white/grey matEnvironmentalOpen in IMG/M
3300002514Marine viral communities from the Pacific Ocean - ETNP_6_85EnvironmentalOpen in IMG/M
3300003263Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_48_BLW_10EnvironmentalOpen in IMG/M
3300003478Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_100m_DNAEnvironmentalOpen in IMG/M
3300003620Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_125m_DNAEnvironmentalOpen in IMG/M
3300004097Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaGEnvironmentalOpen in IMG/M
3300004280Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_100mEnvironmentalOpen in IMG/M
3300005430Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV69EnvironmentalOpen in IMG/M
3300005521Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV255EnvironmentalOpen in IMG/M
3300005522Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV257EnvironmentalOpen in IMG/M
3300005593Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV86EnvironmentalOpen in IMG/M
3300005605Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV67EnvironmentalOpen in IMG/M
3300005606Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV84EnvironmentalOpen in IMG/M
3300006327Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_1_0125mEnvironmentalOpen in IMG/M
3300006332Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_1_0200mEnvironmentalOpen in IMG/M
3300006340Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_2_0770mEnvironmentalOpen in IMG/M
3300006738Marine viral communities from the Subarctic Pacific Ocean - 3_ETSP_OMZ_AT15126 metaGEnvironmentalOpen in IMG/M
3300006749Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaGEnvironmentalOpen in IMG/M
3300006750Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaGEnvironmentalOpen in IMG/M
3300006753Marine viral communities from the Subarctic Pacific Ocean - 6_ETSP_OMZ_AT15160 metaGEnvironmentalOpen in IMG/M
3300006902Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_250_ad_251m_LV_AEnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300006924Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaGEnvironmentalOpen in IMG/M
3300007283Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_250_ad_252m_LV_BEnvironmentalOpen in IMG/M
3300007514Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 143m, 2.7-0.2um, replicate aEnvironmentalOpen in IMG/M
3300007539Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaGEnvironmentalOpen in IMG/M
3300007554Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.709EnvironmentalOpen in IMG/M
3300007777Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS918_NRZ_DNA CLC_assemblyEnvironmentalOpen in IMG/M
3300008050Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaGEnvironmentalOpen in IMG/M
3300008216Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_GeostarEnvironmentalOpen in IMG/M
3300008624Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 200m, 250-2.7umEnvironmentalOpen in IMG/M
3300008952Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7umEnvironmentalOpen in IMG/M
3300009008Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 267m, 250-2.7umEnvironmentalOpen in IMG/M
3300009103Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 143m, 250-2.7umEnvironmentalOpen in IMG/M
3300009130Combined Assembly of Gp0139511, Gp0139512EnvironmentalOpen in IMG/M
3300009132Combined Assembly of Gp0139359, Gp0139510EnvironmentalOpen in IMG/M
3300009172Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154EnvironmentalOpen in IMG/M
3300009339Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, May cruise - 103m, 2.7-0.2um, replicate aEnvironmentalOpen in IMG/M
3300009370Combined Assembly of Gp0127930, Gp0127931EnvironmentalOpen in IMG/M
3300009425Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136EnvironmentalOpen in IMG/M
3300009488Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00607 metaGEnvironmentalOpen in IMG/M
3300009605Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_M9EnvironmentalOpen in IMG/M
3300009622Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3321_4155EnvironmentalOpen in IMG/M
3300010148Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaGEnvironmentalOpen in IMG/M
3300010153Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaGEnvironmentalOpen in IMG/M
3300010155Marine viral communities from the Subarctic Pacific Ocean - 12_ETSP_OMZ_AT15267 metaGEnvironmentalOpen in IMG/M
3300010299Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNAEnvironmentalOpen in IMG/M
3300010883western Arctic Ocean co-assemblyEnvironmentalOpen in IMG/M
3300012919Marine microbial communities from the Central Pacific Ocean - Fk160115 60m metaGEnvironmentalOpen in IMG/M
3300012928Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaGEnvironmentalOpen in IMG/M
3300012952Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 MetagenomeEnvironmentalOpen in IMG/M
3300012953Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 MetagenomeEnvironmentalOpen in IMG/M
3300013252Marine hypoxic microbial communities from the Gulf of Mexico, USA - 11m_Station6_GOM_MetagenomeEnvironmentalOpen in IMG/M
3300016797Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041408BS metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017702Marine viral communities from the Subarctic Pacific Ocean - Lowphox_10 viral metaGEnvironmentalOpen in IMG/M
3300017705Marine viral communities from the Subarctic Pacific Ocean - Lowphox_08 viral metaGEnvironmentalOpen in IMG/M
3300017743Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17EnvironmentalOpen in IMG/M
3300017767Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20EnvironmentalOpen in IMG/M
3300017824Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017952Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018036Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041406US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018041Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041407BS metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018410Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011510BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018426Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019459Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019756Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW6Sep16_MGEnvironmentalOpen in IMG/M
3300019938Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW8Nov16_MGEnvironmentalOpen in IMG/M
3300020185Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160517_1EnvironmentalOpen in IMG/M
3300020191Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041410US metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020260Marine microbial communities from Tara Oceans - TARA_B100000405 (ERX556087-ERR599025)EnvironmentalOpen in IMG/M
3300020265Marine microbial communities from Tara Oceans - TARA_B100000401 (ERX556012-ERR599088)EnvironmentalOpen in IMG/M
3300020299Marine microbial communities from Tara Oceans - TARA_B100000214 (ERX555923-ERR599016)EnvironmentalOpen in IMG/M
3300020320Marine microbial communities from Tara Oceans - TARA_B000000441 (ERX556072-ERR598990)EnvironmentalOpen in IMG/M
3300020347Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556109-ERR598994)EnvironmentalOpen in IMG/M
3300020348Marine microbial communities from Tara Oceans - TARA_B100000676 (ERX556089-ERR599161)EnvironmentalOpen in IMG/M
3300020366Marine microbial communities from Tara Oceans - TARA_B000000437 (ERX556091-ERR599146)EnvironmentalOpen in IMG/M
3300020374Marine microbial communities from Tara Oceans - TARA_A100001011 (ERX291766-ERR318618)EnvironmentalOpen in IMG/M
3300020381Marine microbial communities from Tara Oceans - TARA_A100001011 (ERX291769-ERR318620)EnvironmentalOpen in IMG/M
3300020402Marine microbial communities from Tara Oceans - TARA_B000000609 (ERX555971-ERR599057)EnvironmentalOpen in IMG/M
3300020405Marine microbial communities from Tara Oceans - TARA_B000000532 (ERX556129-ERR599012)EnvironmentalOpen in IMG/M
3300020410Marine microbial communities from Tara Oceans - TARA_B100000519 (ERX555959-ERR599148)EnvironmentalOpen in IMG/M
3300020413Marine microbial communities from Tara Oceans - TARA_S200000501 (ERX555962-ERR599092)EnvironmentalOpen in IMG/M
3300020419Marine microbial communities from Tara Oceans - TARA_X000000263 (ERX555964-ERR598955)EnvironmentalOpen in IMG/M
3300020438Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942)EnvironmentalOpen in IMG/M
3300020439Marine microbial communities from Tara Oceans - TARA_B100001939 (ERX556062-ERR599029)EnvironmentalOpen in IMG/M
3300020449Marine microbial communities from Tara Oceans - TARA_B100001079 (ERX556008-ERR599020)EnvironmentalOpen in IMG/M
3300020452Marine microbial communities from Tara Oceans - TARA_B100001173 (ERX556054-ERR599078)EnvironmentalOpen in IMG/M
3300020457Marine microbial communities from Tara Oceans - TARA_B100001113 (ERX555941-ERR599014)EnvironmentalOpen in IMG/M
3300020469Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052)EnvironmentalOpen in IMG/M
3300020475Marine microbial communities from Tara Oceans - TARA_B100002029 (ERX555951-ERR599001)EnvironmentalOpen in IMG/M
3300020477Marine microbial communities from Tara Oceans - TARA_B100001123 (ERX555935-ERR599156)EnvironmentalOpen in IMG/M
3300020478Marine microbial communities from Tara Oceans - TARA_B100000029 (ERX556025-ERR599111)EnvironmentalOpen in IMG/M
3300021356Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245EnvironmentalOpen in IMG/M
3300021364Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO304EnvironmentalOpen in IMG/M
3300021425Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO284EnvironmentalOpen in IMG/M
3300021443Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 12015EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300021958Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27DEnvironmentalOpen in IMG/M
3300021960Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9DEnvironmentalOpen in IMG/M
3300022925Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaGEnvironmentalOpen in IMG/M
3300023109 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_10_MGEnvironmentalOpen in IMG/M
3300023112 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_2_MGEnvironmentalOpen in IMG/M
3300024264 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_10_MGEnvironmentalOpen in IMG/M
3300024344Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300025072Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025112Marine viral communities from the Pacific Ocean - ETNP_2_130 (SPAdes)EnvironmentalOpen in IMG/M
3300025114Marine viral communities from the Subarctic Pacific Ocean - 3_ETSP_OMZ_AT15126 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025122Marine viral communities from the Pacific Ocean - ETNP_2_300 (SPAdes)EnvironmentalOpen in IMG/M
3300025125Marine viral communities from the Pacific Ocean - ETNP_2_1000 (SPAdes)EnvironmentalOpen in IMG/M
3300025132Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes)EnvironmentalOpen in IMG/M
3300025141Marine viral communities from the Pacific Ocean - ETNP_6_85 (SPAdes)EnvironmentalOpen in IMG/M
3300025267Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_Geostar (SPAdes)EnvironmentalOpen in IMG/M
3300025277Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s16 (SPAdes)EnvironmentalOpen in IMG/M
3300025282Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_M9 (SPAdes)EnvironmentalOpen in IMG/M
3300025658Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_10m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025665Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_130m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025674Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025681Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_100m (SPAdes)EnvironmentalOpen in IMG/M
3300025870Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_125m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025880Pelagic Microbial community sample from North Sea - COGITO 998_met_07 (SPAdes)EnvironmentalOpen in IMG/M
3300026189Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302PF84A (SPAdes)EnvironmentalOpen in IMG/M
3300026263Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV255 (SPAdes)EnvironmentalOpen in IMG/M
3300026266Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV257 (SPAdes)EnvironmentalOpen in IMG/M
3300026269Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV263 (SPAdes)EnvironmentalOpen in IMG/M
3300027192Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.715 (SPAdes)EnvironmentalOpen in IMG/M
3300027906Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027996 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_6_MGEnvironmentalOpen in IMG/M
3300028022Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 750mEnvironmentalOpen in IMG/M
3300028045 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_10_MGEnvironmentalOpen in IMG/M
3300028192Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_500mEnvironmentalOpen in IMG/M
3300028196Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI112_10mEnvironmentalOpen in IMG/M
3300028487Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_2000mEnvironmentalOpen in IMG/M
3300029319Marine viral communities collected during Tara Oceans survey from station TARA_032 - TARA_A100001516EnvironmentalOpen in IMG/M
3300031605Marine microbial communities from Western Arctic Ocean, Canada - CB9_32.1EnvironmentalOpen in IMG/M
3300031606Marine microbial communities from Western Arctic Ocean, Canada - AG5_TmaxEnvironmentalOpen in IMG/M
3300031701Marine microbial communities from Western Arctic Ocean, Canada - AG5_BottomEnvironmentalOpen in IMG/M
3300031757Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 200m 32315EnvironmentalOpen in IMG/M
3300031773Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 34915EnvironmentalOpen in IMG/M
3300031774Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 34915EnvironmentalOpen in IMG/M
3300031861Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 3416EnvironmentalOpen in IMG/M
3300031886Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 200m 3416EnvironmentalOpen in IMG/M
3300032006Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-200_MGEnvironmentalOpen in IMG/M
3300032011Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 3416EnvironmentalOpen in IMG/M
3300032278Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-500_MGEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
SI34jun09_120mDRAFT_101707543300000225MarineMKHSESGTRKVMKQLNKCPDIKEVRSVSNGYMILAKNGEQYLAHMSAKAFHPLRRWLKNNTSLKSLKF*
SI39nov09_100mDRAFT_102080513300000325MarineIPCPVCHTGTMKHSESGNRKVMKQLKKCPDIEEIRATASGHMILAKNGQQYLAHFSAKAFHPLRRWLKKNTSLKNLRF*
OpTDRAFT_1002867273300000928Freshwater And MarineMKHRDSGNLKILKQLRKCPEIKDIRATAKGFMLMATNGKQYLTHLSVKAHHPLRKWCRQNTSIQALKF*
ACM18_102112313300001778Marine PlanktonIHFFLVFIWLRGYVVSMKHSESGKLKVFKQLRKCPEITEIKQTAKGHMVLADNGEQFLVHLSARAFHPLRRWLKVNTSLKSLKF*
KVWGV2_1056185813300002242Marine SedimentMKHSESGTRKVMKQLNKCPDVKEVRSVANGYMIMAKNGEQYLAHMSARAFHPLRRWLKKNTSIKNLRY*
JGI25133J35611_1007412913300002514MarineMKHSESGTRKVLKQMKKCPDIVEIRQTASGYMVMAKNGEQYLAHMSARAFHPLRRWLKNNTSLKSLRF*
JGI26117J46588_100275953300003263MarineMKHSESGTRKVLKQLRKCPDIQEIRETASGHMILAKNGQQYLAHLSARAFHPLRRWLKKNTRLQALKF*
JGI26238J51125_100481833300003478MarineMKHSESGNRKVMKQLKKCPDIEEIRATASGHMILAKNGQQYLAHFSAKAFHPLRRWLKKNTSLKNLRF*
JGI26273J51734_1000288163300003620MarineVFIWCRGYVVSMNHSESGTRKVLKQLRKCAEITEIKQTAKGHMVLADNGAQILVHLSARAFHPLRRWLKANTSLKSLKF*
JGI26273J51734_1004554523300003620MarineMKHRDSGNLKILKQLRKCPEIKDIRATAKGFMLMATNGKQYLTHLSAKAHHPLRKWCRENTSIQALKF*
Ga0055584_100014712173300004097Pelagic MarineMKHSESGTRKVLKQMKKCPDIVEIRQTASGYMIMAKNGEQYLAHMSARAFHPLRRWLKNNTSLKSLKF*
Ga0055584_10121372413300004097Pelagic MarineVFIWCRGYVVSMNHSESGTRKVLKQLRKCPEITEIKQTAKGHMVLADNGAQFLVHLSARAFHPLRRWLKANTSLKSLKF*
Ga0066606_1012062033300004280MarineNRKVMKQLKKCPDIEEIRATASGHMILAKNGQQYLAHFSAKAFHPLRRWLKKNTSLKNLRF*
Ga0066849_1002732553300005430MarineMKHSESGTRKVLKQIKKCPDINEVRATANGYMILAKNGEQYLAHMSAKAFHPLRRWLKRNTRLQSLKF*
Ga0066862_1023819723300005521MarineMKHSESGTRKVLKQMKKCPDIVEIRQTASGYMIMAKNGEQYLAHMSARAFHPLRRWLKN
Ga0066861_1007039923300005522MarineMKHSESGTRKVMKQLKKCDDISDIKATASGYMIMAKNGEQYLAHFSARAFHPLRRWLKKNTSITNLKY*
Ga0066837_1030445723300005593MarineMKHSESGTRKVLKQMKKCPDIEEIRATASGYMILAKNGEQYLAHMSAKAFHPLRRWLKKNTRIQNLKY*
Ga0066850_1029346313300005605MarineSESGTRKVLKQMKKCPDIVEIRQTASGYMIMAKNGEQYLAHMSARAFHPLRRWLKNNTSLKSLKF*
Ga0066835_10000242263300005606MarineMKHSESGTQKVLKQLKKCKEIKEIKSTTKGYMIMGTNGEQYLAHMSARAFHPLRRWLKKNTSIKNLRY*
Ga0066835_1001494733300005606MarineMKHSESGTRKVLKQLRKCPEIEEIRATASGHMILAKNGQQYLAHFSARAFHPLRRWLKKNTSLQALKF*
Ga0066835_1001797733300005606MarineMKHSESGTRKVLKQLKKCSDIKEIRATASGHMIMAKNGKQYLTHFSAKAFHPLRRWLKQNTSIKTLKF*
Ga0068499_101977033300006327MarineICQTIIMKHNESGNRKVLKQIKKCPDIKEIRATASGYMILAKNGEQYLAHMSAKAFHPLRRWLKKNTRIQNLKY*
Ga0068500_104019123300006332MarineMKHSESGTRKVLKQMKKCDEIEEIRATANGHMILAKNGEQYLAHFSAKAFHPLRRWLKKNTSIKNLKF*
Ga0068500_126297443300006332MarineMKHSESGTRKVMKQLKKCPDISEIRATASGHMIMAKNGEQYLAHFSAKAFHPLRRWLKKNTSLKNLKY*
Ga0068503_1022430213300006340MarineMKHSESGTRKVLKQLKKSPDIKEIRQLAHGHMILATNGQQYLAHMSAKAFHPLRRWLKKNTNIKNLRF*
Ga0098035_103043133300006738MarineMKHSESGTRKIFKQLKKCPDIEEIRQLNSGHMILAKNGQQYLAHFSAKAFHPLRRWLKKNTSLKNLRF*
Ga0098035_106662123300006738MarineMKHSESGTRKVFKQLKKSPDIKEIRQLASGHMILAQNGQQYLVHLSAKAFHPLRRWLKKNTNIQNLRF*
Ga0098035_107755023300006738MarineMKHSESGNRKVMKQLKKCPDIVEIKATASGYMILARNGQQYLAHFSAKAFHPLRRWLKRNTRIQNLKF*
Ga0098042_104499623300006749MarineMKHSESGTRKVIKQLNKCPDISEIRPTANGYMILAKNGEQYLAHFSARAFHPLRRWLKRNTSLKNLKY*
Ga0098058_112985023300006750MarineMKHSESGTRKIFKQLKKSPDIKEIRQLNSGHMILAKNGQQYLAHFSAKAFHPLRRWLKKNTNIKNLRF*
Ga0098039_111753613300006753MarineMKHSESGTRKVMKQLKKCPDIKEIKELKSGKAGYMVLLKNGEQYLVHAGANCFHPLRRWLNKHTSIK
Ga0098039_124496023300006753MarineMKHSESGTRKVLKQIKKCPDINDVRATANGYMILAKNGEQYLAHMSAKAFHPLRRWLKRNTRLQSLKF*
Ga0066372_1021617523300006902MarineMKHSESGTRKVLKQIKKCPDIEEIRATASGYMIMAKNGEQYLAHMSAKAFHPLRRWLKKNTRIQNLKY*
Ga0066372_1049782533300006902MarineMKQLKKCPDIEEIRATASGHMILAKNGQQYLAHFSAKAFHPLRRWLKKN
Ga0070746_1013368353300006919AqueousDTQRFKELKLIHFFLVFIWLRGYVVSMKHSESGKLKVFKQLRKCPEITEIKQTAKGHMILADNGEQFLVHLSARAFHPLRRWLKANTSLKSLKF*
Ga0098051_121428923300006924MarineMKHSESGNRKVLKQLKKCPEITEIRATASGQMILAKNGEQYLAHFSAKAFHPLRRWLKKNTSLQNLKF*
Ga0066366_1049502913300007283MarineMKHSESGNRKVMKQLKKCPDIEEIRATASGYMILAKNGQQYLAHMSAKAFHPLRRWLKKNTSLKNLRF*
Ga0105020_100668893300007514MarineMKHSESGTRKVLKQLKKCPDIVEVSQTQHGHMIKASNGQQYLAHLSAKAFHPLRRWLKKNTRIQSLKF*
Ga0105020_1006855203300007514MarineVRLCHTGGMKHSESGTRKVIKQLKKCPEITEIRQLASGYMILAKNGEQYLVHFSAKAFHPLRRWLKQNTSLKQLRF*
Ga0099849_103662723300007539AqueousMKHSESGTRKVLKQLRKCPEIEKIRETASGHMILAKNGEQYLAHFSARAFHPLRRWLKRNTSLKALKF*
Ga0102820_100994553300007554EstuarineMNHSESGTRKVLKQLRKCAEITEIKQTAKGHMVLADNGAQILVHLSARAFHPLRRWLKANTSLKSLKF*
Ga0105711_146187813300007777Diffuse Vent Fluid, Hydrothermal VentsMKHSESGTRKVLKQLKKSPDIKEIRQLASGHMILAQNGQQYLVHLSAKAFHPLRRWLKRNTNIQNLRF*
Ga0098052_122414233300008050MarineMKHSESGTRKVMKQLKKCPDITEVLQTANGYMIKAKNQQQYLAHMSAKAFHPLRRWLKKNTRIQNLRF*
Ga0114898_114001813300008216Deep OceanMKHSESGTRKVLKQLNKCPDIAEVAQTAHGYMIKAKNQQQYLAHMSARAFHPLRRWLKKNTSLKNLRF*
Ga0115652_1012868103300008624MarineMKHSESGTRKIFKQLKKCPDIKEIRQLNSGHMILATNGQQYLAHFSAKAFHPLRRWLKKNTRIQSLKF*
Ga0115651_119214133300008952MarineMKHSESGTRKVFKQLKKCPDIKEIRQLASGHMILATNGQQYLVHLSAKAFHPLRRWLKKNTRIQSLKF*
Ga0115651_128187433300008952MarineMKHSESGNRKVLKQLKKCPDIKEIRATASGHMILAKNGQQYLAHFSAKAFHPLRRWLKKNTSLSNLRF*
Ga0115649_141231733300009008MarineMKHSESGTRKVMKQLKKSPDIKEVRQLAHGHMILATNGQQYLAHMSAKAFHPLRRWLKKNTNIKNLRF*
Ga0117901_104173073300009103MarineMKHSESGTRKVMKQLKKCPDIKEIRQLASGHMILATNGQQYLAHLSAKAFHPLRRWLKKNTRIQSLKF*
Ga0117901_104788723300009103MarineMKQLKKCPDIEEIRATASGHMILAKNGQQYLAHFSAKAFHPLRRWLKKNTSLKNLKF*
Ga0118729_100698423300009130MarineMKHSESGTRKVMKQLNKCPDIKEVRPTAKGCMILAKNGEQYLAHMSAKAFHPLRRWLRDNTSLKNLKY*
Ga0118730_1002848263300009132MarineMKHSESGNRKVLKQIKKCPDIQEIRATANGYMIMAKNGEQYLAHMSAKAFHPLRRWLKNNTSLKALKF*
Ga0114995_1021525843300009172MarineMKHSESGTRKVLKQINKCPDIQSVRATASGHMILARNGEQYLAHMSAKAFHPLRRWLKKHTRLQALKF*
Ga0117928_108067213300009339MarineKACVYPVFCHYRGMKHSESGNRKVLKQLKKCPDIKEIRATASGHMILAKNGQQYLAHFSAKAFHPLRRWLKKNTSLSNLRF*
Ga0118716_103296313300009370MarineMKQLKKCPDIEEIRATASGHMILAKNGQQYLAHFSAKAFHPLRRWLKKNTSLKNLRF*
Ga0114997_1053151313300009425MarineQINKCPDIQSVRATASGHMILARNGEQYLAHMSAKAFHPLRRWLKKHTRLQALKF*
Ga0114925_1142428823300009488Deep SubsurfaceMKHSESGNRKVLKQLKKCPDIQQIRATASGYMILAKNGEQYLAHMSAKAFHPLRRWLKKNTRLQTLKF*
Ga0114906_100877513300009605Deep OceanITQSVKLYIMKHSESGTRKVLKQLNKCPDIAEVAQTAHGYMIKAKNQQQYLAHMSARAFHPLRRWLKKNTSLKNLRF*
Ga0105173_110384723300009622Marine OceanicMKHSESGNRKVMKQMKKCPDIEEIRATASGHMILAKNGEQYLAHFSAKAFHPLRRWLKKNTSLSNLRF*
Ga0098043_102943313300010148MarineMKHSESGTRKVMKQLNKCPDIAEIRPTANGHMILAKNGEQYLAHFSARAFHPLRRWLKRNTSLKNLKY*
Ga0098059_100829943300010153MarineMKHSESGTRKVMKQLNKCPDVKEVRSVANGYMILAKNGEQYLAHMSARAFHPLRRWLKKNTSIKNLKY*
Ga0098047_1034765513300010155MarineMKHSESGTRKVLKQLKKSPDIKEIRQLASGHMILAQNGQQYLVHLSAKAFHPLRRWLKKN
Ga0129342_102554013300010299Freshwater To Marine Saline GradientVLDTKRLKEVNLIHFFLVFIWLRGYVVSMKHSESGKLKVFKQLRQCPEITEIKQTAKGHMILADNGEQFLVHLSARAFHPLRRWLKANTSLKSLKF*
Ga0133547_1033778153300010883MarineMKHSESGSRKVLKQIKKCPDIAEIRATASGYMIMAKNGEQYLAHMSAKAFHPLRRWLKKNTRIQSLKY*
Ga0133547_1160407633300010883MarineMKHSESGNRKVMKQMKKCPDIEEIRATASGHMILAKNGEQYLAHFSAKAFHPLRRWLKKNTSLKKLRF*
Ga0160422_10003015203300012919SeawaterMKHSESGTRKVMKQLKKCDEISEIRATASGHMIMAKNGEQYLAHFSARAFHPLRRWLKKNTSITNLKY*
Ga0163110_10000119223300012928Surface SeawaterMKHSESGTRKVLKQLKKCPDIKEIRATASGHMILAKNGEQYLAHFSARAFHPLRRWLKKNTSIQTLKY*
Ga0163180_1033289433300012952SeawaterMKHSESGTRKVLKQIKKCPDIQEIRATAHGHMILAKNGEQYLAHMSAKAFHPLRRWLKRNTRLQSLKF*
Ga0163180_1058189713300012952SeawaterSESGNRKVLKQLKKCPDIQEIRATASGYMILATNGEQYLAHLSAKAFHPLRRWLKKNTRLQTLKF*
Ga0163179_1013887843300012953SeawaterMKHSESGTRKVLKQLKKCPDIKDIKATANGHMILAKNGEQYLAHFSARAFHPLRRWLKKNTSIKALKY*
Ga0163179_1046323913300012953SeawaterMKHSESGTRKVLKQMKKCPDIVEIRQTASGYMIMAKNGEQYLAHMSARAFHPLRRWLKNNTSLKSLRF*
Ga0163179_1121203423300012953SeawaterMKHSESGSRKVLKQIKKCPDIKDIRATASGYMIMAQNGEQYLAHMSAKAFHPLRRWLKKNTRIKNLKY*
Ga0116817_103365523300013252MarineMKHSESGKLKVFKQLRKCPEITEIKQTAKGHMILAENGEQFLVHLSARAFHPLRRWLKANTSLKSLKF*
Ga0182090_110379223300016797Salt MarshVLDTKRLKEVNLIHFFLVFIWLRGYVVSMKHSESGKLKVFKQLRKCPEITEIKQTAKGHMVLADNGEQFLVHLSARAFHPLRRWLKANTSLKSLKF
Ga0181374_105994513300017702MarineMKQLKKCPDIVEIKATASGYMILARNGQQYLAHFSAKAFHPLRRWLKRNTRIQNLKF
Ga0181372_102891213300017705MarineSGTRKVIKQLNKCPDITEVAQTAHGYMVKAKNQQQYLVHMSARAFHPLRRWLKKNTSLKNLRF
Ga0181402_1000574223300017743SeawaterMKHRDSGNLKILKQLRKCPEIKDIRATAKGYMLMATNGKQYLTHLSPKAHHPLRKWCRENTSIQALKF
Ga0181406_104526243300017767SeawaterKKSGNKKVLKQMKKCAEIKEIRATASGYMILATNGEQYLAHMSAKAFHPLRRWLKKNTSLKALKF
Ga0181552_1021436333300017824Salt MarshVFDIQRFKKANLIHFFLVFIWLRGYVVSMKHSESGKLKVFKQLRKCPEITEIKQTAKGHMVLADNGEQFLVHLSARAFHPLRRWLKANTSLKSLKF
Ga0181583_1063019413300017952Salt MarshMKHSESGKLKVFKQLRKCPEITEVRQTAKGHMVLAENGEQFLVHLSARAFHPLRRWLKANTSLKSLKF
Ga0181600_10006298193300018036Salt MarshVFIWLRGYVVSMKHSESGKLKVFKQLRKCPEITEIKQTAKGHMVLADNGEQFLVHLSARAFHPLRRWLKANTSLKSLKF
Ga0181601_1013424953300018041Salt MarshLIHFFLVFIWLRGYVVSMKHSESGKLKVFKQLRKCPEITEIKQTAKGHMVLADNGEQFLVHLSARAFHPLRRWLKANTSLKSLKF
Ga0181561_1010448553300018410Salt MarshLVFIWLRGYVVSMKHSESGKLKVFKQLRKCPEITEIKQTAKGHMVLADNGEQFLVHLSARAFHPLRRWLKANTSLKSLKF
Ga0181566_1109556413300018426Salt MarshMKHSESGTRKILKQLRKCPDIKDIKATASGHMILANNGEQCLVHFSARAFHPLRRWLKRNTSIQSLKF
Ga0181562_1046236023300019459Salt MarshVFDIQRFKKANLIHFFLVFIWLRGYVVSMKHSESGKLKVFKQLRKCPEITEIKQTARGHMVLADNGEQFLVHLSARAFHPLRRWLKANTSLKSLKF
Ga0194023_101556833300019756FreshwaterVFDTQRFKELKLIHFFLVFIWLRGYVVSMKHSESGKLKVFKQLRKCPEITEIKQTAKGHMVLADNGEQFLVHLSARAFHPLRRWLKANTSLKSLKF
Ga0194023_104731523300019756FreshwaterMKHSESGTRKVLKQLRKCPEIEKIRETASGHMILAKNGEQYLAHFSARALHPLRRWLKRNTSLKALKF
Ga0194032_102800633300019938FreshwaterLRKCPEITEIKQTAKGHMVLADNGEQFLVHLSARAFHPLRRWLKANTSLKSLKF
Ga0206131_10000275703300020185SeawaterMKHSESGTRKVLKQLRKCPDIQEIRETASGHMILAKNGQQYLAHLSARAFHPLRRWLKKNTRLQALKF
Ga0181604_1009459953300020191Salt MarshMKHSESGTKKILKQLRKCPDIKDIRATAKGHMILAQNGEQLLVHFSAKAFHPLRRWLKRNTSLKALKF
Ga0211588_100116163300020260MarineMKQLKKCPEISEIRATASGHMIMAKNGEQYLAHFSARAFHPLRRWLKKNTSLKTLKY
Ga0211533_102449733300020265MarineMKHSESGTRKVMKQLKKCPEISEIRATASGHMIMAKNGEQYLAHFSARAFHPLRRWLKKNTSLKTLKY
Ga0211615_101663813300020299MarineMKHSESGTRKVLKQMKKCPDIVEIRQTASGYMIMAKNGEQYLAHMSARAFHPLRRWLKNNTSLKSLKF
Ga0211597_105722623300020320MarineMKHSESGTRKVMKQLKKCDDISDIKATASGYMIMAKNGEQYLAHFSARAFHPLRRWLKKNTSIKNLKY
Ga0211504_108482813300020347MarineMKHSESGTRKVLKQLRKCPEIEKIRETASGHMILARNGEQYLAHFSARAFHPLRRWLKK
Ga0211600_115280723300020348MarineHSESGTRKVMKQLKKCPEISEIRATASGHMIMAKNGEQYLAHFSARAFHPLRRWLKKNTSLKTLKY
Ga0211489_1000586973300020366MarineMKQLKKCDDISDIKATASGYMIMAKNGEQYLAHFSARAFHPLRRWLKKNTSIKNLKY
Ga0211477_10003307143300020374MarineMKHSESGTRKVLKQLKKCPDIKDIRATASGHMIMAKNGKQYLTHFSAKAFHPLRRWLKQNTSIKTLKF
Ga0211476_1003935413300020381MarineLVMKHSESGTRKVLKQLKKCPDIKDIRATASGHMIMAKNGKQYLTHFSAKAFHPLRRWLKQNTSIKTLKF
Ga0211499_1025121923300020402MarineMKHSESGIRKVMKQLKKCDDIQEIRETANGQMILAKNGQQYLAHFSARAFHPLRRWLKKNTSIKALKF
Ga0211496_1006944323300020405MarineMKQLKKCDDIQEIRETANGQMILAKNGQQYLAHFSARAFHPLRRWLKKNTSIKALKF
Ga0211699_1000320063300020410MarineMKHSESGTRKVLKQIKKCPDIQEIRATAHGHMILAKNGEQYLAHMSAKAFHPLRRWLKRNTRLQSLKF
Ga0211699_1029362413300020410MarineMKQLNKCPDIAEIRPTANGHMILAKNGEQYLAHFSARAFHPLR
Ga0211516_1047241023300020413MarineMKHSESGIRKVMKQLKKCNDIQEIRETAHGQMILAKNGEQYLAHFSAKAFHPLRRWLKKNTSIKTLKF
Ga0211512_1050837923300020419MarineMKQLKKCNDIQEIRETAHGQMILAKNGEQYLAHFSAKAFHPLRRWLKKNTSIKTLKF
Ga0211576_1048861323300020438MarineMNHSESGNRKVAKQINKAKDVEMRKTSSGYMIMASNGEQYLAHFSKACFHPLRRWLKRNTSIQNLKF
Ga0211558_1003909123300020439MarineMKHSESGNRKVLKQIKKCPDIQEIRATASGYMIMAKNGEQYLAHMSAKAFHPLRRWLKNNTSLKALKF
Ga0211642_1031054913300020449MarineKVMKQMKKCPDIEDIHATAHGYMIRAKNGEQYLAHFSAKAFHPLRRWLKKNTRIQNLKF
Ga0211545_1001581363300020452MarineMKHSESGTRKVLKQMKKCPDIVEIRQTASGYMIMAKNGEQYLAHMSARAFHPLRRWLKNNTSLKSLRF
Ga0211643_1006512773300020457MarineMKHSESGTRKVLKQIKKCPDIQEIRATAHGHMILAKNGEQYLAHMSAKAFHPLRRWLKRNTTLQSLKF
Ga0211577_100000541653300020469MarineMKHSESGNRKVLKQIKKCPDIEEIRATANGYMIMAKNGEQYLAHMSAKAFHPLRRWLKNNTRLKALKF
Ga0211541_1050836913300020475MarineMKHSESGSRKVLKQIKKCPDIKDIRATASGYMIMAQNGEQYLAHMSAKAFHPLRRWLKKNTRIKNLKY
Ga0211585_10010107153300020477MarineMKHSESGTRKVLKQMKKCNEIEEIRATANGHMILATNGEQYLAHFSAKAFHPLRRWLKKNTSIKNLKF
Ga0211503_1007868223300020478MarineMKQLKKCPEITEIRQLASGYMILAKNGEQYLVHFSAKAFHPLRRWLKQNTSLKQLRF
Ga0213858_10000318243300021356SeawaterVFIWNRAYCVSMKHSESGKLKVFKQLRKCPEITEIKQTAKGHMILAENGEQFLVHLSARAFHPLRRWLKANTSLKSLKF
Ga0213858_1001117563300021356SeawaterMKHSESGTRKVLKQLRKCKEIQAIRETASGHMILATNGQQYLAHFSAKAFHPLRRWLKKNTSIQSLKF
Ga0213859_1051535813300021364SeawaterHFFLVFIWLRGYVVSMKHSESGKLKVFKQLRKCPEITEIKQTAKGHMILADNGEQFLVHLSARAFHPLRRWLKANTSLKSLKF
Ga0213866_1003717423300021425SeawaterMKHSETGCRKIIKQLNNCPEINKIKNTTSGYMIKANNGEQYLVHFSDRAFHPLRRWLKNNTSLKNLKF
Ga0206681_1029313013300021443SeawaterMKHSESGTRKVFKQLKKSPDIKEIRQLASGHMILAQNGQQYLVHLSAKAFHPLRRWLKKNTNIQNLRF
Ga0222717_1005749163300021957Estuarine WaterMKHRDSGNLKILKQLRKCPEIKDIRATAKGFMLMATNGKQYLTHLSAKAHHPLRKWCRENTSIQALKF
Ga0222718_1003425013300021958Estuarine WaterMKHSESGTRKVLKQMKKCPDIVEIRQMASGYMIMAKNGEQYLAHMSARAFHPLRRWLKNNTSLKSLKF
Ga0222715_1056719323300021960Estuarine WaterKQMKKCAEIKEIRATASGYMILATNGEQYLAHMSAKAFHPLRRWLKKNTSLKALKF
Ga0255773_1034311323300022925Salt MarshVFIWLRGYVVSMKHSESGKLKVFKQLRKCPEITEIKQTAKGHMVLADNGEQFLVHLSARAFHPLRRWLKANT
(restricted) Ga0233432_1047919723300023109SeawaterMKHSESGTRKVLKQLRKCPDIQEVRETASGHMILAKNGQQYLAHLSARAFHPLRRWLKKNTRLQALKF
(restricted) Ga0233411_1000098833300023112SeawaterMKHSESGNRKVMKQLKKCPDIEEIRATASGHMILAKNGQQYLAHFSAKAFHPLRRWLKKNTSLKNLRF
(restricted) Ga0233444_10005677213300024264SeawaterMKHSESGKLKVFKQLRKCPEITEIKQTAKGHMVLADNGEQILVHLSASAFHPLRRWLKANTSLKSLKF
(restricted) Ga0233444_1001682623300024264SeawaterMKHSESGTRKVLKQMKKCPDIVDIRQTASGYMIMAKNGEQYLAHMSARAFHPLRRWLKSNTSLKSLKF
Ga0209992_1023319613300024344Deep SubsurfaceMKQLKKCPEITEIRQLASGYMILAKNGEQYLVHFSAKAFHPLRRWLKRNTSLNNLRF
Ga0244775_10000923303300024346EstuarineVFIWCRGYVVSMNHSESGTRKVLKQLRKCAEITEIKQTAKGHMVLADNGAQILVHLSARAFHPLRRWLKANTSLKSLKF
Ga0244775_1154146513300024346EstuarineMKHSESGTRKVLKQLRKCPDIQEIRETASGHMILAKNGQQYLAHLSARAFHPLRRWLKKNTRLQSLKF
Ga0208920_104533323300025072MarineMKHSESGTRKIFKQLKKCPDIEEIRQLNSGHMILAKNGQQYLAHFSAKAFHPLRRWLKKNTSLKNLRF
Ga0209349_116071923300025112MarineMKHSESGNRKVLKQLKKCPDIEEIRATASGHMILAKNGQQYLAHFSAKAFHPLRRWLKKNTRIQNLKF
Ga0208433_101597883300025114MarineHNCIMKHSESGTRKIFKQLKKCPDIEEIRQLNSGHMILAKNGQQYLAHFSAKAFHPLRRWLKKNTSLKNLRF
Ga0209434_112801923300025122MarineMKHSESGTRKIFKQLKKSPDIKEIRQLNSGHMILAKNGQQYLAHFSAKAFHPLRRWLKKNTNIKNLRF
Ga0209644_106628323300025125MarineMKHSESGTRKVMKQLKKSPDIKEIRALAHGHMILAKNGQQYLAHMSAKAFHPLRRWLKKNTNIQNLRF
Ga0209644_114539213300025125MarineVCHNYTMKHSESGTRKVLKQLKKSPDIKEIRQLASGHMILAQNGQQYLVHLSAKAFHPLRRWLKKNTSLKNLRF
Ga0209232_1000944233300025132MarineMKHSESGTRKVLKQIKKCPDINEVRATANGYMILAKNGEQYLAHMSAKAFHPLRRWLKRNTRLQSLKF
Ga0209756_110297453300025141MarineMKHSESGNRKVLKQLKKCPDIEEIRATASGHMILAKNGQQYLAHFSAKAFHPLRRWLKKNTRIQNL
Ga0208179_110451223300025267Deep OceanVKLYIMKHSESGTRKVLKQLNKCPDIAEVAQTAHGYMIKAKNQQQYLAHMSARAFHPLRRWLKKNTSLKNLRF
Ga0208180_104041733300025277Deep OceanMKHSESGTRKVLKQLNKCPDIAEVAQTAHGYMIKAKNQQQYLAHMSARAFHPLRRWLKKNTSLKNLRF
Ga0208030_103314223300025282Deep OceanMKHSESGTRKVFKQLKKSPDIKEIRQLASGHMILAQNGQQYLVHLSAKAFHPLRRWLKKNTNIKNLKF
Ga0209659_106468643300025658MarineMKHRDSGNLKILKQLRKCPEIKDIRATAKGFMLMATNGKQYLTHLSAKAHHPLRKWCREN
Ga0209360_114923133300025665MarineSGNRKVMKQLKKCPDIEEIRATASGHMILAKNGQQYLAHFSAKAFHPLRRWLKKNTSLKNLRF
Ga0208162_102846163300025674AqueousMKHSESGTRKVLKQLRKCPEIEKIRETASGHMILAKNGEQYLAHFSARAFHPLRRWLKRNTSLKALKF
Ga0209263_118897933300025681MarineNRKVMKQLKKCPDIEEIRATASGHMILAKNGQQYLAHFSAKAFHPLRRWLKKNTSLKNLR
Ga0209666_1000068403300025870MarineMNHSESGTRKVLKQLRKCAEITEIKQTAKGHMVLADNGAQILVHLSARAFHPLRRWLKANTSLKSLKF
Ga0209534_10004144183300025880Pelagic MarineVFIWCRGYVVSMNHSESGTRKVLKQLRKCPEITEIKQTAKGHMVLADNGAQFLVHLSARAFHPLRRWLKANTSLKSLKF
Ga0208405_1000021413300026189MarineMKHSESGTQKVLKQLKKCKEIKEIKSTTKGYMIMGTNGEQYLAHMSARAFHPLRRWLKKNTSIKNLRY
Ga0208405_100340613300026189MarineMKHSESGTRKVLKQLRKCPEIEEIRATASGHMILAKNGQQYLAHFSARAFHPLRRWLKKNTSLQALKF
Ga0208405_105360323300026189MarineMKHSESGTRKVLKQLKKCSDIKEIRATASGHMIMAKNGKQYLTHFSAKAFHPLRRWLKQNTSIKTLKF
Ga0207992_117416913300026263MarineMKHSESGTRKVLKQMKKCPDIVEIRQTASGYMIMAKNGEQYLAHMSARAFHPLRRWLKNN
Ga0208410_104371413300026266MarineMKHSESGTRKVMKQLKKCDDISDIKATASGYMIMAKNGEQYLAHFSARAFHPLRRWLKKNTSITNLKY
Ga0208766_105126723300026269MarineMKHSESGNRKVLKQMKKCPDIVEIRQTASGYMIMAKNGEQYLAHMSARAFHPLRRWLKSNTSLKSLRF
Ga0208673_101978243300027192EstuarineVLKQLRKCAEITEIKQTAKGHMVLADNGEQILVHLSASAFHPLRRWLKANTSLKSLKF
Ga0209404_1036435113300027906MarineMKHSESGTRKVIKQLNKCPDISEIRPTANGYMILAKNGEQYLAHFSARAFHPLRRWLKRNTSLKNLKY
Ga0209404_1041858833300027906MarineMKHSESGNRKVMKQLKKCDDISDIKATASGYMIMAKNGEQYLAHFSAKAFHPLRRWLKNNTSIKNLRF
(restricted) Ga0233413_1000123233300027996SeawaterMKQLKKCPDIEEIRATASGHMILAKNGQQYLAHFSAKAFHPLRRWLKKNTSLKNLRF
Ga0256382_108485823300028022SeawaterMKHSESGTRKIFKQLKKCPDIKEIRQLASGHMILAKNGQQYLAHFSAKAFHPLRRWLKKNTSLKNLRF
(restricted) Ga0233414_1003902553300028045SeawaterMKHNESGNKKVLKQMKKCAEIKEIRATASGYMILATNGEQYLAHMSAKAFHPLRRWLKKNTSLKALKF
Ga0257107_115584413300028192MarineMKHSESGTRKVFKQLKKSPDIKEIRQLQSGHMILATNGQQYLVHLSAKAFHPLRRWLKKNTNIQNLRF
Ga0257114_110983323300028196MarineMKHSESGTRKVMKQLKKCNDIQEIRETANGQMILARNGQQYLAHFSARAFHPLRRWLKKNTSIKALKF
Ga0257109_112311913300028487MarineMKHSESGNRKVMKQLKKCPDIEEIRATASGHMILAKNGEQYLAHFSAKAFHPLRRWLKKNTSLSNLRF
Ga0183748_100189943300029319MarineMKQLKKCDDIQEIRETANGQMILAKNGQQYLAHFSARAFHPLRRWLKKNTSIKSLKF
Ga0183748_112155723300029319MarineMKHSESGTRKVMKQLKKCPDIKEIRQLASGHMILATNGQQYLAHLSAKAFHPLRRWLKKNTRIQSLKF
Ga0302132_1013634433300031605MarineMKHSESGNRKVMKQLKKCPDIEEVRATASGHMILAKNGQQYLAHFSAKAFHPLRRWLKKNTSLSNLRF
Ga0302119_1000967793300031606MarineMKHSESGTKKVLKQLKKCPEIAEIRATANGQMILAKNGEQYLAHFSAKAFHPLRRWLKKHTSLKSLKY
Ga0302119_1003630513300031606MarineEWAYCISMKHSESGTRKVIKQLNKCPDIKEIRSVSNGYMILAKNGEQYLAHMSAKAFHPLRRWLKNNTSLKSLKF
Ga0302120_1002409123300031701MarineMKHSESGTRKVIKQLNKCPDIKEIRSVSNGYMILAKNGEQYLAHMSAKAFHPLRRWLKNNTSLKSLKF
Ga0315328_1010632513300031757SeawaterMKQLRKCPDIEQIKETGSGHMIMAKNGEQYLAHFSPKAFHPLRRWLKK
Ga0315332_1041042433300031773SeawaterVLYESIFIEIFLVFFCLWWYFIGMKHSESGNRKVLKQLKKCPEITEIRATASGQMILAKNGEQYLAHFSAKAFHPLRRWLKKNTSLQNLKF
Ga0315331_10006728233300031774SeawaterMKHSESGTQKVLKQLKKCKEIKDIKSTTKGYMIMSTNGQQYLAHMSARAFHPLRRWLKKNTSIKNLRY
Ga0315331_1085591813300031774SeawaterMKHSESGTQKVLKQLRKCKQIKEVKPTTKGYMIMGTNGEQYLAHMSARAFHPLRRWLKKNTSIKNL
Ga0315319_1068431513300031861SeawaterESGNRKVLKQLKKCPEITEIRATASGQMILAKNGEQYLAHFSAKAFHPLRRWLKKNTSLKNLKF
Ga0315318_10002174103300031886SeawaterMKHSESGTRKVMKQLKNCKEISDIRATASGYMVMAKNGEQYLTHFSARAFHPLRRWLKKNTSLKNLKY
Ga0315318_1021197333300031886SeawaterMKHSESGNRKVLKQMKKCPDIVEIRQTANGYMIMAKNGEQYLAHMSAKAFHPLRRWLNHNTSLKSLKY
Ga0310344_1048322233300032006SeawaterMKHSESGTRKVLKQMKKCNEIEEIRATANGHMILAKNGEQYLAHFSAKAFHPLRRWLKKNTSIKNLKF
Ga0310344_1112794213300032006SeawaterMKHNESGNRKVLKQIKKCPDIKEIRATASGYMILAKNGEQYLAHMSAKAFHPLRRWLKKNTRIQNLKY
Ga0315316_1116819613300032011SeawaterDFTTQSVKLYTMKHSESGTRKVIKQLNKCPDITEVAQTAHGYMIKAKNQQQYLVHMSARAFHPLRRWLKKNTSLKNLRF
Ga0310345_1062725633300032278SeawaterMKHSESGTRKVFKQLKKSPDIKEIRQLASGHMILAENGEQYLVHLSAKAFHPLRRWLKKNTNIQNLRF
Ga0310345_1076654023300032278SeawaterMKHSESGTRKVFKQLKKSPDIKEIRQLASGHMILATNGEQYLVHLSAKAFHPLRRWLKKNTNIKNLRF


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.