| Basic Information | |
|---|---|
| Family ID | F032196 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 180 |
| Average Sequence Length | 48 residues |
| Representative Sequence | MFNLEDYETVEERLIKFWKDHPDGQIHTKLLDSTSGRFIVEASIYRT |
| Number of Associated Samples | 143 |
| Number of Associated Scaffolds | 180 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 98.34 % |
| % of genes near scaffold ends (potentially truncated) | 99.44 % |
| % of genes from short scaffolds (< 2000 bps) | 91.11 % |
| Associated GOLD sequencing projects | 130 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (90.000 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (18.333 % of family members) |
| Environment Ontology (ENVO) | Unclassified (53.333 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (53.333 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 18.67% β-sheet: 25.33% Coil/Unstructured: 56.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 180 Family Scaffolds |
|---|---|---|
| PF01844 | HNH | 1.67 |
| PF05257 | CHAP | 0.56 |
| PF05065 | Phage_capsid | 0.56 |
| PF05869 | Dam | 0.56 |
| PF04860 | Phage_portal | 0.56 |
| COG ID | Name | Functional Category | % Frequency in 180 Family Scaffolds |
|---|---|---|---|
| COG4653 | Predicted phage phi-C31 gp36 major capsid-like protein | Mobilome: prophages, transposons [X] | 0.56 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000756|JGI12421J11937_10068162 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1077 | Open in IMG/M |
| 3300002091|JGI24028J26656_1005554 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1879 | Open in IMG/M |
| 3300002307|JGI24890J29729_1073996 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 551 | Open in IMG/M |
| 3300003490|JGI25926J51410_1086984 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 506 | Open in IMG/M |
| 3300004054|Ga0063232_10028688 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1374 | Open in IMG/M |
| 3300004282|Ga0066599_101133199 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 579 | Open in IMG/M |
| 3300004282|Ga0066599_101250624 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 557 | Open in IMG/M |
| 3300005517|Ga0070374_10376153 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 716 | Open in IMG/M |
| 3300005581|Ga0049081_10184235 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 754 | Open in IMG/M |
| 3300005582|Ga0049080_10170342 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 726 | Open in IMG/M |
| 3300005584|Ga0049082_10201705 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 681 | Open in IMG/M |
| 3300006803|Ga0075467_10292847 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 869 | Open in IMG/M |
| 3300006803|Ga0075467_10493583 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 630 | Open in IMG/M |
| 3300006805|Ga0075464_10557335 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 704 | Open in IMG/M |
| 3300006875|Ga0075473_10178347 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 856 | Open in IMG/M |
| 3300006920|Ga0070748_1002061 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9323 | Open in IMG/M |
| 3300006920|Ga0070748_1100565 | All Organisms → Viruses → Predicted Viral | 1102 | Open in IMG/M |
| 3300006920|Ga0070748_1101968 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1093 | Open in IMG/M |
| 3300006920|Ga0070748_1183556 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 769 | Open in IMG/M |
| 3300007234|Ga0075460_10204058 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 672 | Open in IMG/M |
| 3300007276|Ga0070747_1349490 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 505 | Open in IMG/M |
| 3300007363|Ga0075458_10035651 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1574 | Open in IMG/M |
| 3300007538|Ga0099851_1115698 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1015 | Open in IMG/M |
| 3300007538|Ga0099851_1331229 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 533 | Open in IMG/M |
| 3300007708|Ga0102859_1001154 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5993 | Open in IMG/M |
| 3300008113|Ga0114346_1302052 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 550 | Open in IMG/M |
| 3300008122|Ga0114359_1289758 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 569 | Open in IMG/M |
| 3300008266|Ga0114363_1007480 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5380 | Open in IMG/M |
| 3300008266|Ga0114363_1121022 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 909 | Open in IMG/M |
| 3300008266|Ga0114363_1126659 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1261 | Open in IMG/M |
| 3300008266|Ga0114363_1163456 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 725 | Open in IMG/M |
| 3300008267|Ga0114364_1103634 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 880 | Open in IMG/M |
| 3300008448|Ga0114876_1016274 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3997 | Open in IMG/M |
| 3300008448|Ga0114876_1093136 | All Organisms → Viruses → Predicted Viral | 1219 | Open in IMG/M |
| 3300008450|Ga0114880_1188384 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 704 | Open in IMG/M |
| 3300009009|Ga0105105_10201827 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1031 | Open in IMG/M |
| 3300009009|Ga0105105_10963105 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 527 | Open in IMG/M |
| 3300009026|Ga0102829_1146762 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 753 | Open in IMG/M |
| 3300009068|Ga0114973_10569123 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 583 | Open in IMG/M |
| 3300009081|Ga0105098_10261648 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 819 | Open in IMG/M |
| 3300009081|Ga0105098_10515669 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 611 | Open in IMG/M |
| 3300009085|Ga0105103_10482572 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 694 | Open in IMG/M |
| 3300009146|Ga0105091_10178139 | All Organisms → Viruses → Predicted Viral | 1006 | Open in IMG/M |
| 3300009159|Ga0114978_10297885 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 988 | Open in IMG/M |
| 3300009160|Ga0114981_10645153 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 561 | Open in IMG/M |
| 3300009161|Ga0114966_10395986 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 810 | Open in IMG/M |
| 3300009164|Ga0114975_10120673 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1510 | Open in IMG/M |
| 3300009165|Ga0105102_10638712 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 592 | Open in IMG/M |
| 3300009169|Ga0105097_10640299 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 600 | Open in IMG/M |
| 3300009169|Ga0105097_10793747 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 539 | Open in IMG/M |
| 3300009170|Ga0105096_10422154 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 689 | Open in IMG/M |
| 3300009180|Ga0114979_10328681 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 904 | Open in IMG/M |
| 3300009180|Ga0114979_10657811 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 595 | Open in IMG/M |
| 3300009182|Ga0114959_10421513 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 651 | Open in IMG/M |
| 3300009183|Ga0114974_10140275 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1519 | Open in IMG/M |
| 3300009183|Ga0114974_10243319 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1079 | Open in IMG/M |
| 3300009183|Ga0114974_10738316 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 532 | Open in IMG/M |
| 3300009184|Ga0114976_10133635 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1399 | Open in IMG/M |
| 3300009185|Ga0114971_10422824 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 754 | Open in IMG/M |
| 3300009194|Ga0114983_1092243 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 673 | Open in IMG/M |
| 3300009419|Ga0114982_1138166 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 752 | Open in IMG/M |
| 3300010334|Ga0136644_10646246 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 578 | Open in IMG/M |
| 3300010356|Ga0116237_10571425 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 982 | Open in IMG/M |
| 3300010374|Ga0114986_1096526 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 535 | Open in IMG/M |
| 3300010885|Ga0133913_11478352 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1722 | Open in IMG/M |
| 3300010885|Ga0133913_12385531 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1295 | Open in IMG/M |
| 3300011010|Ga0139557_1031497 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 937 | Open in IMG/M |
| 3300011010|Ga0139557_1078612 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 549 | Open in IMG/M |
| 3300012013|Ga0153805_1028187 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 954 | Open in IMG/M |
| 3300012013|Ga0153805_1069671 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 596 | Open in IMG/M |
| 3300012663|Ga0157203_1018951 | All Organisms → Viruses → Predicted Viral | 1020 | Open in IMG/M |
| 3300012665|Ga0157210_1027629 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 896 | Open in IMG/M |
| 3300012666|Ga0157498_1054872 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 611 | Open in IMG/M |
| 3300013004|Ga0164293_10881040 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 564 | Open in IMG/M |
| 3300013005|Ga0164292_10514970 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 782 | Open in IMG/M |
| 3300013295|Ga0170791_11080832 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 546 | Open in IMG/M |
| 3300013372|Ga0177922_10291468 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 725 | Open in IMG/M |
| 3300013372|Ga0177922_11159359 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1084 | Open in IMG/M |
| 3300017701|Ga0181364_1016079 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1245 | Open in IMG/M |
| 3300017716|Ga0181350_1019884 | All Organisms → Viruses → Predicted Viral | 1886 | Open in IMG/M |
| 3300017716|Ga0181350_1100185 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 714 | Open in IMG/M |
| 3300017716|Ga0181350_1107744 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 679 | Open in IMG/M |
| 3300017723|Ga0181362_1114103 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 531 | Open in IMG/M |
| 3300017736|Ga0181365_1034989 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1267 | Open in IMG/M |
| 3300017736|Ga0181365_1126011 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 613 | Open in IMG/M |
| 3300017736|Ga0181365_1129865 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 602 | Open in IMG/M |
| 3300017761|Ga0181356_1197361 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 598 | Open in IMG/M |
| 3300017774|Ga0181358_1159125 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 765 | Open in IMG/M |
| 3300017777|Ga0181357_1145950 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 874 | Open in IMG/M |
| 3300017778|Ga0181349_1299619 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 521 | Open in IMG/M |
| 3300017780|Ga0181346_1050828 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1677 | Open in IMG/M |
| 3300018420|Ga0181563_10358240 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 840 | Open in IMG/M |
| 3300018682|Ga0188851_1010569 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1218 | Open in IMG/M |
| 3300020160|Ga0211733_11176319 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1067 | Open in IMG/M |
| 3300020563|Ga0208082_1016654 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1574 | Open in IMG/M |
| 3300021956|Ga0213922_1041279 | All Organisms → cellular organisms → Bacteria | 1060 | Open in IMG/M |
| 3300021962|Ga0222713_10012273 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7599 | Open in IMG/M |
| 3300021963|Ga0222712_10095418 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2093 | Open in IMG/M |
| 3300021963|Ga0222712_10602889 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 634 | Open in IMG/M |
| 3300022747|Ga0228703_1012751 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3005 | Open in IMG/M |
| 3300022747|Ga0228703_1084452 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 769 | Open in IMG/M |
| 3300024298|Ga0255178_1068724 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 671 | Open in IMG/M |
| 3300024306|Ga0255148_1009300 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1986 | Open in IMG/M |
| 3300024495|Ga0255164_1031473 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 871 | Open in IMG/M |
| 3300024506|Ga0255168_1052316 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 659 | Open in IMG/M |
| 3300025616|Ga0208613_1016403 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1869 | Open in IMG/M |
| 3300025635|Ga0208147_1003419 | All Organisms → Viruses → Predicted Viral | 4708 | Open in IMG/M |
| 3300025645|Ga0208643_1018161 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2508 | Open in IMG/M |
| 3300025732|Ga0208784_1213574 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 560 | Open in IMG/M |
| 3300025872|Ga0208783_10395109 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 534 | Open in IMG/M |
| 3300026457|Ga0255160_1001178 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5669 | Open in IMG/M |
| 3300027212|Ga0208554_1046430 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 689 | Open in IMG/M |
| 3300027285|Ga0255131_1030405 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1026 | Open in IMG/M |
| 3300027396|Ga0255146_1055349 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 831 | Open in IMG/M |
| 3300027581|Ga0209651_1044683 | All Organisms → Viruses → Predicted Viral | 1331 | Open in IMG/M |
| 3300027608|Ga0208974_1031505 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1598 | Open in IMG/M |
| 3300027659|Ga0208975_1131185 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 710 | Open in IMG/M |
| 3300027679|Ga0209769_1240984 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 552 | Open in IMG/M |
| 3300027710|Ga0209599_10099535 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 765 | Open in IMG/M |
| 3300027733|Ga0209297_1342176 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 544 | Open in IMG/M |
| 3300027734|Ga0209087_1185234 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 810 | Open in IMG/M |
| 3300027743|Ga0209593_10308543 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 543 | Open in IMG/M |
| 3300027754|Ga0209596_1227478 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 779 | Open in IMG/M |
| 3300027756|Ga0209444_10241071 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 634 | Open in IMG/M |
| 3300027764|Ga0209134_10066929 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1207 | Open in IMG/M |
| 3300027777|Ga0209829_10005297 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8804 | Open in IMG/M |
| 3300027777|Ga0209829_10395737 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 537 | Open in IMG/M |
| 3300027785|Ga0209246_10120691 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1029 | Open in IMG/M |
| 3300027785|Ga0209246_10405558 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 512 | Open in IMG/M |
| 3300027798|Ga0209353_10388903 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 575 | Open in IMG/M |
| 3300027805|Ga0209229_10159486 | All Organisms → Viruses → Predicted Viral | 1015 | Open in IMG/M |
| 3300027808|Ga0209354_10163841 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 906 | Open in IMG/M |
| 3300027871|Ga0209397_10106438 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1185 | Open in IMG/M |
| 3300027890|Ga0209496_10295729 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 809 | Open in IMG/M |
| 3300027900|Ga0209253_11111774 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 537 | Open in IMG/M |
| 3300027956|Ga0209820_1151379 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 641 | Open in IMG/M |
| 3300027969|Ga0209191_1001223 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 17224 | Open in IMG/M |
| 3300027971|Ga0209401_1093450 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1255 | Open in IMG/M |
| (restricted) 3300027977|Ga0247834_1139049 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1001 | Open in IMG/M |
| 3300028025|Ga0247723_1013412 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3034 | Open in IMG/M |
| 3300028025|Ga0247723_1027430 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1836 | Open in IMG/M |
| 3300028025|Ga0247723_1062529 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1025 | Open in IMG/M |
| (restricted) 3300029286|Ga0247841_10858479 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 531 | Open in IMG/M |
| 3300031758|Ga0315907_10061975 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3259 | Open in IMG/M |
| 3300031787|Ga0315900_10313805 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1290 | Open in IMG/M |
| 3300031857|Ga0315909_10625106 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 714 | Open in IMG/M |
| 3300031963|Ga0315901_10160309 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1993 | Open in IMG/M |
| 3300032050|Ga0315906_10535147 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 982 | Open in IMG/M |
| 3300032116|Ga0315903_10441921 | All Organisms → Viruses → Predicted Viral | 1046 | Open in IMG/M |
| 3300032116|Ga0315903_10666777 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 784 | Open in IMG/M |
| 3300032116|Ga0315903_10717940 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 744 | Open in IMG/M |
| 3300033979|Ga0334978_0404360 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 643 | Open in IMG/M |
| 3300033981|Ga0334982_0337068 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 700 | Open in IMG/M |
| 3300033994|Ga0334996_0402695 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 642 | Open in IMG/M |
| 3300033995|Ga0335003_0356911 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 638 | Open in IMG/M |
| 3300034012|Ga0334986_0083762 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1941 | Open in IMG/M |
| 3300034012|Ga0334986_0213983 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1069 | Open in IMG/M |
| 3300034050|Ga0335023_0265123 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 941 | Open in IMG/M |
| 3300034062|Ga0334995_0673174 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 587 | Open in IMG/M |
| 3300034066|Ga0335019_0128075 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1686 | Open in IMG/M |
| 3300034082|Ga0335020_0312634 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 768 | Open in IMG/M |
| 3300034082|Ga0335020_0438234 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 626 | Open in IMG/M |
| 3300034092|Ga0335010_0684118 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 507 | Open in IMG/M |
| 3300034095|Ga0335022_0004310 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8659 | Open in IMG/M |
| 3300034101|Ga0335027_0808345 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 542 | Open in IMG/M |
| 3300034104|Ga0335031_0114121 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1896 | Open in IMG/M |
| 3300034106|Ga0335036_0353280 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 959 | Open in IMG/M |
| 3300034112|Ga0335066_0251020 | All Organisms → Viruses → Predicted Viral | 1023 | Open in IMG/M |
| 3300034112|Ga0335066_0268331 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 979 | Open in IMG/M |
| 3300034117|Ga0335033_0397309 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 681 | Open in IMG/M |
| 3300034118|Ga0335053_0562657 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 662 | Open in IMG/M |
| 3300034119|Ga0335054_0764834 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 513 | Open in IMG/M |
| 3300034120|Ga0335056_0189570 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1194 | Open in IMG/M |
| 3300034122|Ga0335060_0231653 | All Organisms → Viruses → Predicted Viral | 1036 | Open in IMG/M |
| 3300034168|Ga0335061_0590756 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 559 | Open in IMG/M |
| 3300034272|Ga0335049_0558961 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 717 | Open in IMG/M |
| 3300034272|Ga0335049_0572023 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 706 | Open in IMG/M |
| 3300034283|Ga0335007_0139372 | All Organisms → Viruses → Predicted Viral | 1749 | Open in IMG/M |
| 3300034356|Ga0335048_0003860 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12109 | Open in IMG/M |
| 3300034356|Ga0335048_0355851 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 740 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 18.33% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 13.89% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 12.78% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 9.44% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 6.67% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 4.44% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 3.89% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 3.89% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 2.78% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.22% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 2.22% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.67% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 1.67% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.67% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.67% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 1.67% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 1.11% |
| Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic | 1.11% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.11% |
| Surface Ice | Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice | 1.11% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater | 1.11% |
| Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 1.11% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.56% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.56% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.56% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.56% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.56% |
| Freshwater, Surface Ice | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Surface Ice | 0.56% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.56% |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 0.56% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000756 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 | Environmental | Open in IMG/M |
| 3300002091 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-F8 metagenome | Environmental | Open in IMG/M |
| 3300002307 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-C2 co-culture F-D7 | Environmental | Open in IMG/M |
| 3300003490 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN | Environmental | Open in IMG/M |
| 3300004054 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (v2) | Environmental | Open in IMG/M |
| 3300004282 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Initial sediment | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
| 3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300007234 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007363 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008122 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample HABS-E2014-0124-100-LTR | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009009 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009146 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
| 3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009170 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300009185 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG | Environmental | Open in IMG/M |
| 3300009194 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT | Environmental | Open in IMG/M |
| 3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
| 3300010334 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300010356 | AD_USDEca | Engineered | Open in IMG/M |
| 3300010374 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S-1-Day17 | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011010 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice | Environmental | Open in IMG/M |
| 3300012013 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice | Environmental | Open in IMG/M |
| 3300012663 | Freshwater microbial communities from Indian River, Ontario, Canada - S50 | Environmental | Open in IMG/M |
| 3300012665 | Freshwater microbial communities from Talbot River, Ontario, Canada - S11 | Environmental | Open in IMG/M |
| 3300012666 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Surface Ice version 2 | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
| 3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018682 | Metatranscriptome of marine microbial communities from Baltic Sea - GS680_0p1 | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020563 | Freshwater microbial communities from Lake Mendota, WI - 09JUN2009 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
| 3300021956 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MG | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022747 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17_Aug_MG | Environmental | Open in IMG/M |
| 3300024298 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepC_8d | Environmental | Open in IMG/M |
| 3300024306 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepB_8h | Environmental | Open in IMG/M |
| 3300024495 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8d | Environmental | Open in IMG/M |
| 3300024506 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepB_8d | Environmental | Open in IMG/M |
| 3300025616 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA6M (SPAdes) | Environmental | Open in IMG/M |
| 3300025635 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025732 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025872 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300026457 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepB_8h | Environmental | Open in IMG/M |
| 3300027212 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027285 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepC_8d | Environmental | Open in IMG/M |
| 3300027396 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_8h | Environmental | Open in IMG/M |
| 3300027581 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027679 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027743 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027756 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027777 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_140205_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027871 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027890 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
| 3300027956 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027971 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027977 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_12m | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300029286 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_18m | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300033979 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME30Aug2017-rr0003 | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
| 3300033995 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056 | Environmental | Open in IMG/M |
| 3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
| 3300034050 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07May2013-rr0095 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
| 3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
| 3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
| 3300034095 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Feb2014D0-rr0091 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
| 3300034117 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124 | Environmental | Open in IMG/M |
| 3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
| 3300034119 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Jul2015-rr0166 | Environmental | Open in IMG/M |
| 3300034120 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172 | Environmental | Open in IMG/M |
| 3300034122 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181 | Environmental | Open in IMG/M |
| 3300034168 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME06Apr2016-rr0183 | Environmental | Open in IMG/M |
| 3300034272 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156 | Environmental | Open in IMG/M |
| 3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
| 3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12421J11937_100681621 | 3300000756 | Freshwater And Sediment | MFNLEEYETVEERLVKFWKEHPDGRIDTTLVESTLQRFIIKAAIYRTEV |
| JGI24028J26656_10055541 | 3300002091 | Lentic | MFNLDDYETVEERLVKFWKDNPDGRVDTKLLDFNGGRYI |
| JGI24890J29729_10739962 | 3300002307 | Lentic | MISMFNLDEYETVEERLVKFWKDNPDGRVDTKLLDFNGGRY |
| JGI25926J51410_10869843 | 3300003490 | Freshwater Lake | MFNLEDYETVEERLTKYWKDHPDGQIHTEILDQSAGRFIVKASVYRTEADIRPWTT |
| Ga0063232_100286881 | 3300004054 | Freshwater Lake | MFNLEDYETVEERLVKFWKEHPDGRISTTIIEHTLQRFIVQA |
| Ga0066599_1011331991 | 3300004282 | Freshwater | MFNLEDYETVEERLVKFWKDHPDGQIHTKLLEHTASRFIVEAS |
| Ga0066599_1012506242 | 3300004282 | Freshwater | MFYLEDYETVEERLIKYWKEHPDGQIHTQLLEQTSNRFIVLASIFRTEADARPWTTGLAEETVQGR |
| Ga0070374_103761531 | 3300005517 | Freshwater Lake | MFNLEDYETVEERLTKYWKDHPDGQIHTEILDQSA |
| Ga0049081_101842351 | 3300005581 | Freshwater Lentic | MFNLDDYETVEERLAKFWKDHPQGRVETKLLVHTPTQYIVW |
| Ga0049080_101703424 | 3300005582 | Freshwater Lentic | MFNLEDYETVEERLIKFWKDHPDGQIHTKLLDSASGRFIVEASVYRTEADIRP |
| Ga0049082_102017051 | 3300005584 | Freshwater Lentic | MFNLEDYETVEERLVKFWKDHPDGRIDTTLVESTLQRFIVRASIFRTEVDAQAWTT |
| Ga0075467_102928475 | 3300006803 | Aqueous | MFNLEDYETVEERLVKFWKEHPDGQIHTRLLECTASRFIVE |
| Ga0075467_104935833 | 3300006803 | Aqueous | MFNLEDYETVEERLAKYWKDHPDGRIDTKLIEASATRFIVQA |
| Ga0075464_105573354 | 3300006805 | Aqueous | MKRMGFNLDDYETVEERLIKFWKEHPDGRIVTSMLSGSGSQFIVRAEL |
| Ga0075473_101783474 | 3300006875 | Aqueous | MAFNLEDYETVEERLEKFWKEYPDGRIESELLEASANRFIVLARIYRTEADQRYW |
| Ga0070748_100206118 | 3300006920 | Aqueous | MFNLEDYETVEERLVKFWKDHEDGQIHTKVLEHTASRFIVEASIYRTEADARPWTTGLAEETIQG |
| Ga0070748_11005651 | 3300006920 | Aqueous | MFNLEDYETVEERLVKFWKDHPDGQIHTQVLEHTSGRFIVQASVFRTEADPRPWTTGLA |
| Ga0070748_11019686 | 3300006920 | Aqueous | MFNLEDYSPVEDRLVLFWKDHPDGQIHTKLLDSASGRFIVEAA |
| Ga0070748_11835564 | 3300006920 | Aqueous | MFNLEDYETVEERLAKFWKEHPDGRISTEVIEHTLQRFIVKA |
| Ga0075460_102040582 | 3300007234 | Aqueous | MFNLEDYETVEERLVKFWKDHPDGQIHTRVLEHTSSRFIVEASIYRTEADARPWTTGLAEETIQGRGVNA |
| Ga0070747_13494901 | 3300007276 | Aqueous | MFNLEDYETVEERLVKFWKEHPDGRIDTTLVESTLQRFI |
| Ga0075458_100356511 | 3300007363 | Aqueous | MAFNLEDYETVEERLEKFHKDFPDFRIETQLVAHSPSRFIVQAWVYRTYADAQPFS |
| Ga0099851_11156985 | 3300007538 | Aqueous | MAFNLNDYETVEERITKFWKDYPDGRIETELLEAGSNRFIVEAR |
| Ga0099851_13312293 | 3300007538 | Aqueous | MFNLEDYETVEERLVKFWKDYPDGRIDTRLVEASATRFIVQAYIYRTEADQHPWSSGLAEET |
| Ga0102859_10011541 | 3300007708 | Estuarine | MFNLEDYETVEERLIKFWKDHEDGQIHTRLLDSSSGRFIVEASIYRTEADA |
| Ga0114346_13020523 | 3300008113 | Freshwater, Plankton | MFNLEDYQPVEDRLLLFWKDHPDGQIHTKLLDSAAGRF |
| Ga0114359_12897583 | 3300008122 | Freshwater, Plankton | MFNLEDYETVEERLVKFWKDNPNGQIHTKLLDSASGRFIVEAAIFRSGDDIR |
| Ga0114363_10074801 | 3300008266 | Freshwater, Plankton | MFNLEDYETVEERLVKYWKDHPDGQIHTKLLDSTASRFIVEASIYRTEADARPWTTGLAEETVQG |
| Ga0114363_11210223 | 3300008266 | Freshwater, Plankton | MFNLEDYETVEERLVKFWKDHPDGQIHTKVLEHTTARFIV |
| Ga0114363_11266593 | 3300008266 | Freshwater, Plankton | MFNLEDYETVEERLVKFWKDNPNGQIHTKLLDSASG |
| Ga0114363_11634561 | 3300008266 | Freshwater, Plankton | MFNLEDYETVEERLIKFWKEHPDGQIHTKLLDSASGRFIVEASI |
| Ga0114364_11036344 | 3300008267 | Freshwater, Plankton | MFNLEDYETVEERLIKFWKDHPDGQIHTKLLDQSSGRFIVEAA |
| Ga0114876_101627412 | 3300008448 | Freshwater Lake | MFNLEDYETVEERLIKFLKEHPDGQIHTKLLDSASGRFIVEAAIYRTEADVRPWTT |
| Ga0114876_10931363 | 3300008448 | Freshwater Lake | MFNLEDYETVEERLAKFWKEHPDGRIETTMVESTLQR |
| Ga0114880_11883841 | 3300008450 | Freshwater Lake | MFNLEDYETVEERLAKFWKEHPDGRISTEVIEHTLQ |
| Ga0105105_102018271 | 3300009009 | Freshwater Sediment | MFNLDDYETVEERLAKFWKDYPEGRIETKLIVNTPTQYIVWSAIFRD |
| Ga0105105_109631053 | 3300009009 | Freshwater Sediment | MFNLEDYETVEERLIKFWKDHEDGQIHTKLLDSSSGRFIVEASIYRT |
| Ga0102829_11467621 | 3300009026 | Estuarine | MFNLEDYETVEERLIKFWKDHPDGQIHTKLLDQSAGRFIVEASIYRTEADIRPWTTGLAEETIQG |
| Ga0114973_105691233 | 3300009068 | Freshwater Lake | MFNLEDYQPVEDRLLLFWKDHPDGQIHTKLLDSAAGRFIVEAAIYRTEADIRPWTTGLAE |
| Ga0105098_102616484 | 3300009081 | Freshwater Sediment | MFNLEDYQPVEERLQLFWKDHPDGQIHTKLLESQSARFIVEASIFRTEADLRPWTTGLAE |
| Ga0105098_105156691 | 3300009081 | Freshwater Sediment | MFNLEDYETVEERLAKFWKDHPEGRIETKLIVNTPTQYIVWSAI |
| Ga0105103_104825721 | 3300009085 | Freshwater Sediment | MFNLEDYETVEERLIKFWKDHPDGRIDTKIIEASTTRFIVQAYIYRTEVDQ |
| Ga0105091_101781391 | 3300009146 | Freshwater Sediment | MFNLEDYETVEERLVKFWKDHPDGQIHTKVIEASASRFIVEASIYRTEADLRPWTNGLAEETVQGRG |
| Ga0114978_102978854 | 3300009159 | Freshwater Lake | MFNLEDYETVEERLVKFWKDHPDGRISTTIIEHTLQRFIVSASIYRTE |
| Ga0114981_106451531 | 3300009160 | Freshwater Lake | MFNLEDYETVEERLVKFWKDHPDGRISTTIIEHTLQRFI |
| Ga0114966_103959861 | 3300009161 | Freshwater Lake | MFNLDDYETVEERLIKYWKDHPDGRIETKLIEASA |
| Ga0114975_101206731 | 3300009164 | Freshwater Lake | MFNLEDYETVEERLVKFWKDHPDGQIHTKLLESTASRFIVEASIFRTEADLRPWTT |
| Ga0105102_106387123 | 3300009165 | Freshwater Sediment | MFNLEDYETVEERLIKFWKDHPDGQIHTKLLDQSAGRFIVEASIFRTEADNRPW |
| Ga0105097_106402993 | 3300009169 | Freshwater Sediment | MFNLEDYETVEERLIKFWKDHPDGQIHTKVIEASVSRFIVEASIYRTEADLR |
| Ga0105097_107937473 | 3300009169 | Freshwater Sediment | MFNLEDYETVEERLIKFWKDHPDGQIHTKLLDSTSGRFIVEASIYRT |
| Ga0105096_104221541 | 3300009170 | Freshwater Sediment | MFNLEDYETVEERLIKYWKEHPDGQIHTKIIEHSGSRFIVEASIFR |
| Ga0114979_103286811 | 3300009180 | Freshwater Lake | MFNLEDYETVEERLIKFWKEHPDGRIDTKLVDANATRFIVQAYIYRTEVD |
| Ga0114979_106578112 | 3300009180 | Freshwater Lake | MFNLEDYETVEERLVKFWKEHPDGRISTTIIEHTL |
| Ga0114959_104215131 | 3300009182 | Freshwater Lake | MFNLDDYETVEERLVKFWKDNPDGRVDTKLLDFNGGRYIVQAYI |
| Ga0114974_101402753 | 3300009183 | Freshwater Lake | MFNLEDYETVEERLVKFWKEHPDGRIETLLVDATLQRFIVKASVFRTEADAQAWTTGYA |
| Ga0114974_102433194 | 3300009183 | Freshwater Lake | MFNLEDYETVEERLIKFWKEHPDGRIDTKLVDASATRFIVQ |
| Ga0114974_107383163 | 3300009183 | Freshwater Lake | MFNLDDYETVEERLIKYWKEHPDGRIETKLIEASASRFIVQAYIYRT |
| Ga0114976_101336351 | 3300009184 | Freshwater Lake | MFNLEDYETVEERLVKFWKDHPDGQIHTKLLESTASRFIVEASIFRTEA |
| Ga0114971_104228244 | 3300009185 | Freshwater Lake | MFNLEDYETVEERLIKFWKDHPDGQIHTKLLDQSAGRFIVEAAIYRTEADIRPWTTG |
| Ga0114983_10922434 | 3300009194 | Deep Subsurface | VAFFNLEDYETVEERLIKYWKDNPNGRILTKLLEFSPSRFIVEAA |
| Ga0114982_11381661 | 3300009419 | Deep Subsurface | MFNLEDYETVEERLEKFWKEYPDARIETTLVESTLQRFIVKAAIYRTE |
| Ga0136644_106462463 | 3300010334 | Freshwater Lake | MFNLDDYETVEERLVKFWKDNPDGRVDTKLLDFNGGRY |
| Ga0116237_105714251 | 3300010356 | Anaerobic Digestor Sludge | MFNLEDYETVEERLIKYWKDHPDGQIHTKIIEHSASRFIVEASLYRTEADLRPWTTGLAE |
| Ga0114986_10965263 | 3300010374 | Deep Subsurface | MFNLEDYETVEERLAKFWKEHPDGRIYTTLVEHTLQRFIVQAAIYRTEVDA |
| Ga0133913_114783521 | 3300010885 | Freshwater Lake | MFNLEDYETVEDRLTKFWKDHPDGRIETALVESTLQRFIVKASVFRTEVDAQAWTTGF |
| Ga0133913_123855311 | 3300010885 | Freshwater Lake | MFNLEDYETVEERLVKFWKEHPDGRIETLLVDATL |
| Ga0139557_10314973 | 3300011010 | Freshwater | MFNLDDYETVEERLIKFWKDHPDGQIHTKLLDSTATRFI |
| Ga0139557_10786121 | 3300011010 | Freshwater | MFNLDDYETVEERLIKFWKEHPDGRIDTKLVEASATRFIVQAYIYRTE |
| Ga0153805_10281871 | 3300012013 | Surface Ice | MFNLDDYETVEERLIKFWKEHPDGRIDTKLVDASATRFIVQAYIY |
| Ga0153805_10696713 | 3300012013 | Surface Ice | MSNMFNLEDYETVEERLIKFWKDHPDGQIHTKLLDSASGRFIVEASVY |
| Ga0157203_10189511 | 3300012663 | Freshwater | MFNLEDYETVEDRLAKFWKEHEDGRIETTLVESTLQRFIVKAAIYRTEVDAQA |
| Ga0157210_10276294 | 3300012665 | Freshwater | MFNLEDYETVEERLAKFWKEHPDGRISTEVVEHTLQRFIV |
| Ga0157498_10548722 | 3300012666 | Freshwater, Surface Ice | MFNLEDYETVEERLIKFWKDHPDGQIHTKILDSAAGRFIVEAAIYRTEAD |
| Ga0164293_108810402 | 3300013004 | Freshwater | MFNLEDYETVEERLVKFWKDHPDGQIHTKVLEHTTARFIVEASIYRTEADSRPWTTGLAEETV |
| Ga0164292_105149701 | 3300013005 | Freshwater | MFNLEDYETVEERLVKFWKDHPDGRISTQIIEHTLQ |
| Ga0170791_110808321 | 3300013295 | Freshwater | MSNMFNLEDYQPVEDRLLLFWKDHPDGQIHTKLLDSTSGRFIVEASVYRTEADVRPWTTGLAEETIQG |
| Ga0177922_102914681 | 3300013372 | Freshwater | MFNLGDYETVEERLTKYWKDHPDGQIHTEILDQSAGRFI |
| Ga0177922_111593591 | 3300013372 | Freshwater | MFNLEDYETVEERLIKYWKDHPDGQIHTRLLNQDSGRFIVIAEIYRTEADSRPWTTGLA |
| Ga0181364_10160795 | 3300017701 | Freshwater Lake | MFDLSDYQPVEERLTLFWKDYPDGQIHTKILDSASGRFIVEAAIYRTEADVRPWTTGLAEET |
| Ga0181350_10198845 | 3300017716 | Freshwater Lake | MFNLEDYETVEERLTKYWRDHPDGQIHTEILDQSPGRFIVKASVYRTEADVRPWTSGLA |
| Ga0181350_11001852 | 3300017716 | Freshwater Lake | MFNLEDYETVEERLVKFWKDHPDGQIHTKLLDQTSSRFIVEASIYRTEADARAWTTGLAEET |
| Ga0181350_11077442 | 3300017716 | Freshwater Lake | MFNLDDYETVEERLVKFWKEHPDGRIDTKLVEASATRFIVQAYIYRTE |
| Ga0181362_11141031 | 3300017723 | Freshwater Lake | MFNLDDYETVEERLIKFWKEHPDGRIDTRLVDASATRFMVQAYINRTEVDQHPWA |
| Ga0181365_10349894 | 3300017736 | Freshwater Lake | MFNLDDYETVEERLIKFWKEHPDGRIDTKLVDASATRFI |
| Ga0181365_11260111 | 3300017736 | Freshwater Lake | MFNLEDYETVEERLMKYWKDHPDGQIHTEILEQSAGRFIVKASV |
| Ga0181365_11298651 | 3300017736 | Freshwater Lake | EDYETVEERLVKFWKEHPDGRIFTTIIEHTLQRFIVQAAIYRTEVDANPWTTG |
| Ga0181356_11973611 | 3300017761 | Freshwater Lake | MFNLDDYETVEERLIKFWKEHPDGRIDTKLVDASATRFIVQAYIYR |
| Ga0181358_11591251 | 3300017774 | Freshwater Lake | MFNLDDYETVEERLIKFWKEHPDGRIDTKLVDASATRFIVQA |
| Ga0181357_11459503 | 3300017777 | Freshwater Lake | MFNLEDYETVEERLVKFWKEHPDGRISTTIIEHTLQRFIVQAAIYRT |
| Ga0181349_12996191 | 3300017778 | Freshwater Lake | MFNLDDYETVEERLIKFWKEHPDGRIDTKLVDASAT |
| Ga0181346_10508281 | 3300017780 | Freshwater Lake | MFNLEDYETVEERLIKFWKDYPDGQIHTKILDSASGRFI |
| Ga0181563_103582401 | 3300018420 | Salt Marsh | MFNLEDYETVEERLIKYWKDHPDGQIHTQLLEQSANRFIVLASIYRTEADARPWTTGL |
| Ga0188851_10105691 | 3300018682 | Freshwater Lake | MFNLEDYETVEERLVKFWKDHPDGQIHTKIVHSSSTQYIVEASIFRT |
| Ga0211733_111763191 | 3300020160 | Freshwater | MFNLSEYQTCAERLELFWKDNPDGRIDTKLIEAGQ |
| Ga0208082_10166545 | 3300020563 | Freshwater | MFNLEDYETVEERLVKFWKDHPDGQIHTKVLEHTSSRFIVEASIYRTEADLRPWTTGLAEET |
| Ga0213922_10412793 | 3300021956 | Freshwater | MFNLEDYETVEERLVKFWKDHPDGRIDTLLVESTLQRFI |
| Ga0222713_100122731 | 3300021962 | Estuarine Water | MFNLDDYETVEERLVKFWKDYPDGQIHTKVLEHTSARFIVE |
| Ga0222712_100954189 | 3300021963 | Estuarine Water | MTYMFNLEDYETVEERLIKYWKDHPDGQIHTKVVEASASRFIVEASIYRTE |
| Ga0222712_106028891 | 3300021963 | Estuarine Water | VAFFNLEDYETVEERLIKYWKDNPNGRILTKLLENSPSRFIVEA |
| Ga0228703_10127511 | 3300022747 | Freshwater | MAFNLEDYETVEERLIKFWKENPDGRIETELLESTPSRFIVVARIFRTEADARHWTSG |
| Ga0228703_10844523 | 3300022747 | Freshwater | MFKLEDYETVEERLTKFWKEHPDGRIETELLEASTSR |
| Ga0255178_10687241 | 3300024298 | Freshwater | MFNLEDYETVEERLVKFWKEHPDGQIHTKLLDHSSSRFIVEASIFRTEADARPWTTGLAEETVQ |
| Ga0255148_10093006 | 3300024306 | Freshwater | MFNLEDYETVEERLVKFWKEHPDGQIHTKLLDHSASRFIVEASIFRTEADARPWTTGLAEET |
| Ga0255164_10314731 | 3300024495 | Freshwater | MFNLEDYETVEERLVKFWKEHPDGQIHTKLLDHSASRFIVEASIFRTEADARPWTTGLAEETV |
| Ga0255168_10523162 | 3300024506 | Freshwater | MAFNLEDYETVEERLEKFWKEYPDGRIESELLEASANRFIVLARI |
| Ga0208613_10164031 | 3300025616 | Freshwater | MFNLAEYQTCAERLELFWKEHPDGRIDTKLIEASASRFIVQAFI |
| Ga0208147_10034191 | 3300025635 | Aqueous | VAHFNLDDYETVEDRLIKYWKDNPNGRILTKLLENSPSRFIVEAAV |
| Ga0208643_101816110 | 3300025645 | Aqueous | MFNLEDYSPVEDRLVLFWKDHPDGQIHTKLLDSASGR |
| Ga0208784_12135742 | 3300025732 | Aqueous | MAFNLEDYETVEERLEKFHKDFPDFRIETQLVAHSPSRFIVQAWVYRTYADAQPFSSG |
| Ga0208783_103951091 | 3300025872 | Aqueous | MFNLEDYETVEERLAKFWKDHPEGRIETKLIVNTPTQYIVW |
| Ga0255160_10011781 | 3300026457 | Freshwater | MFNLEDYETVEERLIKFWKEHPDGRIATKLLDFSSGRYIVQ |
| Ga0208554_10464304 | 3300027212 | Estuarine | MFNLEDYETVEERLVKFWKEHPDGRIETALVESTLQRFIVK |
| Ga0255131_10304051 | 3300027285 | Freshwater | MFNLEDYETVEERLAKFWKEHPDGRIETALVESTLQRF |
| Ga0255146_10553491 | 3300027396 | Freshwater | MFNLEDYETVEERLVKFWKEHPDGQIHTKLLDHSASRFIVEASIFRTEADARPW |
| Ga0209651_10446835 | 3300027581 | Freshwater Lake | MFNLEDYETVEERLTKYWKDHPDGQIHTEILDQSAGRFIVKASVYRTEAD |
| Ga0208974_10315055 | 3300027608 | Freshwater Lentic | MFNLEDYETVEERLVKYWKEHPDGRIDTTLVESTLQRFIVKASIFRTEVDAQAWTT |
| Ga0208975_11311851 | 3300027659 | Freshwater Lentic | MFNLEDYETVEERLIKFWKDHPDGQIHTKLLDQAAGRFIVEAAIYRTE |
| Ga0209769_12409843 | 3300027679 | Freshwater Lake | MFNLDDYETVEERLIKYWKEHPDGRIETKLIEASASRFIVQAYIYRTEA |
| Ga0209599_100995353 | 3300027710 | Deep Subsurface | MFNLEDYETVEERLEKFWKEYPDARIETTLVESTLQRFIVKAAIYRTEVDAQA |
| Ga0209297_13421763 | 3300027733 | Freshwater Lake | MFNLEDYETVEERLTKFWKEHPDGRIDTSLVESTLQRFIVKAAIYRTEVDAQAWTTG |
| Ga0209087_11852343 | 3300027734 | Freshwater Lake | MFNLEDYETVEERLIKFWKDYPDGQIHTELLDSASGRFIVMARIFRTEADSRPWTS |
| Ga0209593_103085433 | 3300027743 | Freshwater Sediment | MFNLEDYETVEERLAKFWKEHPDGRISTEVVEHTLQRFIVK |
| Ga0209596_12274783 | 3300027754 | Freshwater Lake | MFNLEDYETVEERLIKFWKDHPDGQIHTKLLDQSA |
| Ga0209444_102410714 | 3300027756 | Freshwater Lake | MFNLEDYETVEERLTKYWKDHPDGQIHTEILDQSAG |
| Ga0209134_100669295 | 3300027764 | Freshwater Lake | MFNLEDYETVEERLIKFWKDHPDGQIHTKLLDSAGGRFIVE |
| Ga0209829_100052971 | 3300027777 | Freshwater Lake | MFNLEDYETVEERLTKFWEDYPDGRISTQLAESTGDVFIF |
| Ga0209829_103957373 | 3300027777 | Freshwater Lake | MFNLDDYETVEERLVKFWKDNPDGRVDTKLLDFNSGRYIVQAYIYRTFADS |
| Ga0209246_101206911 | 3300027785 | Freshwater Lake | MFNLEDYETVEERLVKFWKEHPDGRIFTTIIEHTLQ |
| Ga0209246_104055581 | 3300027785 | Freshwater Lake | MFNLEDYETVEERLTKYWKDHPDGQIHTEILDQSAGRFIVKASVYRTE |
| Ga0209353_103889031 | 3300027798 | Freshwater Lake | MFNLDDYETVEERLVKFWKEHPDGRIDTKLVEASA |
| Ga0209229_101594861 | 3300027805 | Freshwater And Sediment | MFNLEDYETVEERLIKFWKEHPDGQIHTKLLDSAGGRFIVEAAIYRTEADVRP |
| Ga0209354_101638411 | 3300027808 | Freshwater Lake | MFNLDDYETVEERLIKFWKEHPDGRIDTKLVDASATRFIVQAYIYRT |
| Ga0209397_101064384 | 3300027871 | Wetland | MFNLEDYETVEERLIKFWKDHPDGQIHTKLLDHNGGRFIVEASIFRTEADLRPWTTGLA |
| Ga0209496_102957291 | 3300027890 | Wetland | MGFFNLEDYETVEERLVKFWADNKNGRVFTRLLESSATRFIVEAAIFRSH |
| Ga0209253_111117741 | 3300027900 | Freshwater Lake Sediment | MFNLEDYETVEERLIKFWKDHPDGQIHTKLLDSTSGRFIVEASI |
| Ga0209820_11513791 | 3300027956 | Freshwater Sediment | MFNLEDYETVEERLIKFWKDHPDGQIHTKLMEHTTGRFIVEASIYRTEADNR |
| Ga0209191_10012231 | 3300027969 | Freshwater Lake | MFNLEDYETVEERLVKFWKDHPDGQIHTKLLESTASRFIVEASIFRTEADL |
| Ga0209401_10934504 | 3300027971 | Freshwater Lake | MFNLDDYETVEERLIKFWKEHPDGRIDTKLVDASATRFIVQAY |
| (restricted) Ga0247834_11390494 | 3300027977 | Freshwater | MFNLEDYETVEERLIKFWKDHPDGRIDTKIIEASATRFIVQ |
| Ga0247723_10134121 | 3300028025 | Deep Subsurface Sediment | MFNLEDYETVEERLVKFWKEHPDGRIETTLVESTLQRFIVK |
| Ga0247723_10274306 | 3300028025 | Deep Subsurface Sediment | MFNLEDYETVEERLVKFWKDYPDGQIHTKLVASSSTQYIVEASIYRTEADPRPWTTGLAEET |
| Ga0247723_10625291 | 3300028025 | Deep Subsurface Sediment | MFNLEDYETVEERLVKFWKEHPDGQIHTKLLDSTSSRFIVEASIFRTEADVRPWTTGLAEETVQG |
| (restricted) Ga0247841_108584793 | 3300029286 | Freshwater | MFNLEDYETVEERLIKFWKDHPDGRIDTKIIEASATRFIVQAYIYRT |
| Ga0315907_1006197510 | 3300031758 | Freshwater | MFNLEDYETVEERLIKYWKDHPDGQIHTKIIEHSGS |
| Ga0315900_103138054 | 3300031787 | Freshwater | MFNLEDYETVEERLIKFWKDHPDGRIDTKIIEASATRFIVQAYIYRTEVDQFAWSSGLAEET |
| Ga0315909_106251061 | 3300031857 | Freshwater | MGFNLDDYETVEERLVKFWKDHESGRIITTLISGTS |
| Ga0315901_101603096 | 3300031963 | Freshwater | MFNLEDYETVEERLIKFWKEHPDGQIHTKLLDSAGGRFIVEAAIYRTEADVRPWTTG |
| Ga0315906_105351471 | 3300032050 | Freshwater | MFNLEDYETVEERLIKFWKDHPDGQIHTKLLDSSSGRFIVEAAIYRTEA |
| Ga0315903_104419213 | 3300032116 | Freshwater | MFNLEDYETVEERLEKFWKEYPDARIETTLVESTLQRFIVKASIYRTEVDAQAW |
| Ga0315903_106667771 | 3300032116 | Freshwater | MFNLEDYETVEERLIKFWKEHPDGQIHTKLLDSAGGRFIVEAAIYRTEADV |
| Ga0315903_107179404 | 3300032116 | Freshwater | MFNLEDYETVEERLVKFWKDNPNGQIHTKLLDSASGRFIVEAAIFRS |
| Ga0334978_0404360_3_137 | 3300033979 | Freshwater | MFKLEDYETVEERLVKFWKEHPDGRISTELVEHSLQRFIVKASIF |
| Ga0334982_0337068_1_210 | 3300033981 | Freshwater | MFNLEDYETVEERLIKFWKDHPDGQIHTKLLDSTSGRFIVEASIYRTEADVRPWTTGLAEETVQGRGVNA |
| Ga0334996_0402695_527_640 | 3300033994 | Freshwater | MFNLEDYETVEERLIKFWKDHPDGRIDTKIIEASTTRF |
| Ga0335003_0356911_474_638 | 3300033995 | Freshwater | MFNLEDYETVEERLEKFWKEYPDARIETTLVESTLQRFIVKASIYRTEVDAQAWT |
| Ga0334986_0083762_1831_1941 | 3300034012 | Freshwater | MFNLEDYETVEERLVKYWKDHPDGQIHTKLLDSTATR |
| Ga0334986_0213983_3_128 | 3300034012 | Freshwater | MFNLEDYETVEERLVKYWKDHPDGQIHTKLLDSTASRFIVEA |
| Ga0335023_0265123_3_125 | 3300034050 | Freshwater | MFNLDDYETVEERLIKYWKDHPDGQIHTKLLDSTASRFIVE |
| Ga0334995_0673174_376_585 | 3300034062 | Freshwater | MFNLEDYETVEERLVKYWKDHPDGQIHTKLLDSTASRFIVEASIYRTEADSRPWTTGLAEETVQGRGVNA |
| Ga0335019_0128075_1_150 | 3300034066 | Freshwater | MFNLEDYETVEERLVKYWKDHPDGQIHTKLLDSTASRFIVEASIYRTEAD |
| Ga0335020_0312634_1_192 | 3300034082 | Freshwater | MFNLEDYETVEERLVKFWKDHPDGQIHTKVLEHTTARFIVEASIYRTEADSRPWTTGLAEETVQ |
| Ga0335020_0438234_2_166 | 3300034082 | Freshwater | MFNLEDYETVEERLIKFWKDHPDGQIHTELLDSANGRFIVMARIFRTEADSRPWT |
| Ga0335010_0684118_1_150 | 3300034092 | Freshwater | MFNLEDYETVEERLIKFWKDHPDGQIHTKLLDSSSGRFIVEASVYRTEAD |
| Ga0335022_0004310_8526_8657 | 3300034095 | Freshwater | MFNLEDYETVEERLTKFWKEHPDGRIETTLVESTLQRFIIKAAI |
| Ga0335027_0808345_1_195 | 3300034101 | Freshwater | MFNLEDYETVEERLIKFWKDHPDGQIHTKLLDQSAGRFIVEAAIYRTEADIRPWTTGLAEETIQG |
| Ga0335031_0114121_2_148 | 3300034104 | Freshwater | MFNLEDYETVEERLAKFWKEHPDGRIYTTLVEHTLQRFIVQAAIYRTEV |
| Ga0335036_0353280_836_958 | 3300034106 | Freshwater | MFNLEDYETVEERLAKFWKEHPDGRIYTTLVEHTLQRFIVQ |
| Ga0335066_0251020_866_1021 | 3300034112 | Freshwater | MFNLEDYETVEERLVKFWKDYPDGRIDTRLVEASATRFIVQAYIYRTEVDQH |
| Ga0335066_0268331_2_157 | 3300034112 | Freshwater | MFNLEDYETVEERLIKFWKDHPDGQIHTKLLDQSAGRFIVEASIFRTEADNR |
| Ga0335033_0397309_523_681 | 3300034117 | Freshwater | MFNLEDYETVEERLEKFWKEYPDARIETTLVESTLQRFIVKASIYRTEVDAQA |
| Ga0335053_0562657_511_660 | 3300034118 | Freshwater | MFNLDDYETVEERLIKFWKEHPDGRISTVLVEATASRFIVQAYIYRTEVD |
| Ga0335054_0764834_386_511 | 3300034119 | Freshwater | MFNLEDYETVEERLIKFWKDHPDGQIHTKLLDSASGRFIVEA |
| Ga0335056_0189570_1046_1192 | 3300034120 | Freshwater | MFNLEDYETVEERLVKFWKDHPDGQIHTKLLDQSAGRFIVEASIFRTEA |
| Ga0335060_0231653_1_108 | 3300034122 | Freshwater | MFNLSEYQTCAERLELFWKEHPDGRIDTKLIEASGG |
| Ga0335061_0590756_1_153 | 3300034168 | Freshwater | MFNLEDYETVEERLIKFWKDQPDGRINTTLLEANTTRFIVRAEIFRTEVDP |
| Ga0335049_0558961_1_177 | 3300034272 | Freshwater | MFNLEDYETVEERLVKYWKDHPDGQIHTKLLDSTATRFIVEASIYRTEADSRPWTTGLA |
| Ga0335049_0572023_601_705 | 3300034272 | Freshwater | MFNLEDYETVEERLVKYWKDHPDGQIHTKLLDSTA |
| Ga0335007_0139372_3_170 | 3300034283 | Freshwater | MFNLEDYETVEERLVKFWKDHPDGQIHTKIVHSSSTQYIVEASIYRTEADARPWTT |
| Ga0335048_0003860_11974_12108 | 3300034356 | Freshwater | MFNLEDYETVEERLVKFWKEHPDGQIHTSLLENTSSRFIVEASIY |
| Ga0335048_0355851_545_739 | 3300034356 | Freshwater | MFNLEDYETVEERLIKFWKDHPDGQIHTKLLDSASGRFIVEASVYRTEADVRPWTTGLAEVTIQG |
| ⦗Top⦘ |