| Basic Information | |
|---|---|
| Family ID | F032192 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 180 |
| Average Sequence Length | 48 residues |
| Representative Sequence | MANEDWKLQVSYKTPSGDMINVRANTADELSVLLEGVGDYSTQIAA |
| Number of Associated Samples | 140 |
| Number of Associated Scaffolds | 180 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 92.22 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 95.00 % |
| Associated GOLD sequencing projects | 130 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (76.667 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (26.111 % of family members) |
| Environment Ontology (ENVO) | Unclassified (58.889 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (70.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 24.32% β-sheet: 16.22% Coil/Unstructured: 59.46% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 180 Family Scaffolds |
|---|---|---|
| PF12705 | PDDEXK_1 | 97.22 |
| PF01930 | Cas_Cas4 | 1.11 |
| COG ID | Name | Functional Category | % Frequency in 180 Family Scaffolds |
|---|---|---|---|
| COG1468 | CRISPR/Cas system-associated exonuclease Cas4, RecB family | Defense mechanisms [V] | 1.11 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.44 % |
| Unclassified | root | N/A | 0.56 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000558|Draft_10011198 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8868 | Open in IMG/M |
| 3300000756|JGI12421J11937_10168312 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 529 | Open in IMG/M |
| 3300002206|metazooDRAFT_1329803 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 907 | Open in IMG/M |
| 3300002212|metazooDRAFT_1388526 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 933 | Open in IMG/M |
| 3300002408|B570J29032_109777610 | All Organisms → Viruses → Predicted Viral | 1289 | Open in IMG/M |
| 3300003277|JGI25908J49247_10146759 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 551 | Open in IMG/M |
| 3300003393|JGI25909J50240_1022363 | All Organisms → Viruses → Predicted Viral | 1444 | Open in IMG/M |
| 3300003404|JGI25920J50251_10094962 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 693 | Open in IMG/M |
| 3300003404|JGI25920J50251_10096945 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 683 | Open in IMG/M |
| 3300003411|JGI25911J50253_10076711 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1068 | Open in IMG/M |
| 3300003754|Ga0005853_1044402 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 649 | Open in IMG/M |
| 3300004054|Ga0063232_10139995 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 701 | Open in IMG/M |
| 3300005528|Ga0068872_10639466 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 562 | Open in IMG/M |
| 3300005581|Ga0049081_10343037 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 508 | Open in IMG/M |
| 3300005582|Ga0049080_10177699 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 708 | Open in IMG/M |
| 3300005805|Ga0079957_1191929 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 994 | Open in IMG/M |
| 3300005940|Ga0073913_10077487 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 557 | Open in IMG/M |
| 3300006805|Ga0075464_10236755 | All Organisms → Viruses → Predicted Viral | 1090 | Open in IMG/M |
| 3300006805|Ga0075464_10617520 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 668 | Open in IMG/M |
| 3300007548|Ga0102877_1149686 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 660 | Open in IMG/M |
| 3300007550|Ga0102880_1165308 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 579 | Open in IMG/M |
| 3300007992|Ga0105748_10064023 | All Organisms → Viruses → Predicted Viral | 1435 | Open in IMG/M |
| 3300008106|Ga0114339_1133415 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 897 | Open in IMG/M |
| 3300008107|Ga0114340_1160103 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 816 | Open in IMG/M |
| 3300008108|Ga0114341_10312878 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 810 | Open in IMG/M |
| 3300008108|Ga0114341_10401707 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 663 | Open in IMG/M |
| 3300008111|Ga0114344_1148719 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 802 | Open in IMG/M |
| 3300008113|Ga0114346_1063347 | All Organisms → Viruses → Predicted Viral | 2384 | Open in IMG/M |
| 3300008113|Ga0114346_1232141 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 705 | Open in IMG/M |
| 3300008116|Ga0114350_1089822 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 997 | Open in IMG/M |
| 3300008119|Ga0114354_1110277 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1078 | Open in IMG/M |
| 3300008120|Ga0114355_1113235 | All Organisms → Viruses → Predicted Viral | 1038 | Open in IMG/M |
| 3300008120|Ga0114355_1118260 | All Organisms → Viruses → Predicted Viral | 1003 | Open in IMG/M |
| 3300008120|Ga0114355_1127753 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 943 | Open in IMG/M |
| 3300008120|Ga0114355_1128501 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 939 | Open in IMG/M |
| 3300008120|Ga0114355_1167737 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 755 | Open in IMG/M |
| 3300008265|Ga0114361_1119980 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 817 | Open in IMG/M |
| 3300008266|Ga0114363_1136935 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 829 | Open in IMG/M |
| 3300008266|Ga0114363_1156577 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 750 | Open in IMG/M |
| 3300008450|Ga0114880_1097961 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1139 | Open in IMG/M |
| 3300008450|Ga0114880_1143551 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 868 | Open in IMG/M |
| 3300008450|Ga0114880_1146830 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 854 | Open in IMG/M |
| 3300009068|Ga0114973_10028953 | All Organisms → Viruses → Predicted Viral | 3364 | Open in IMG/M |
| 3300009081|Ga0105098_10698070 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 538 | Open in IMG/M |
| 3300009085|Ga0105103_10864796 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 528 | Open in IMG/M |
| 3300009152|Ga0114980_10454934 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 731 | Open in IMG/M |
| 3300009154|Ga0114963_10366830 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 787 | Open in IMG/M |
| 3300009155|Ga0114968_10706687 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 528 | Open in IMG/M |
| 3300009160|Ga0114981_10780858 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 504 | Open in IMG/M |
| 3300009165|Ga0105102_10614259 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 602 | Open in IMG/M |
| 3300009169|Ga0105097_10186663 | All Organisms → Viruses → Predicted Viral | 1141 | Open in IMG/M |
| 3300009180|Ga0114979_10656624 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 596 | Open in IMG/M |
| 3300009181|Ga0114969_10599119 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 604 | Open in IMG/M |
| 3300009184|Ga0114976_10683921 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 515 | Open in IMG/M |
| 3300009185|Ga0114971_10792988 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 513 | Open in IMG/M |
| 3300009194|Ga0114983_1003018 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6123 | Open in IMG/M |
| 3300009469|Ga0127401_1159666 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 566 | Open in IMG/M |
| 3300010388|Ga0136551_1050880 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 754 | Open in IMG/M |
| 3300011010|Ga0139557_1059426 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 644 | Open in IMG/M |
| 3300011268|Ga0151620_1134002 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 767 | Open in IMG/M |
| 3300012006|Ga0119955_1076729 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 979 | Open in IMG/M |
| 3300012013|Ga0153805_1042064 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 776 | Open in IMG/M |
| 3300012017|Ga0153801_1028034 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 997 | Open in IMG/M |
| 3300012017|Ga0153801_1031278 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 941 | Open in IMG/M |
| 3300012017|Ga0153801_1034889 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 888 | Open in IMG/M |
| 3300012522|Ga0129326_1103453 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 729 | Open in IMG/M |
| 3300012666|Ga0157498_1033456 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 793 | Open in IMG/M |
| 3300012666|Ga0157498_1045989 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 670 | Open in IMG/M |
| 3300013004|Ga0164293_10709345 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 644 | Open in IMG/M |
| (restricted) 3300013137|Ga0172375_10586009 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 724 | Open in IMG/M |
| 3300013295|Ga0170791_12575895 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 732 | Open in IMG/M |
| 3300013372|Ga0177922_11295678 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 999 | Open in IMG/M |
| 3300017701|Ga0181364_1004831 | All Organisms → Viruses → Predicted Viral | 2354 | Open in IMG/M |
| 3300017701|Ga0181364_1054714 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 622 | Open in IMG/M |
| 3300017736|Ga0181365_1024886 | All Organisms → Viruses → Predicted Viral | 1509 | Open in IMG/M |
| 3300017736|Ga0181365_1052126 | All Organisms → Viruses → Predicted Viral | 1021 | Open in IMG/M |
| 3300017736|Ga0181365_1136363 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 585 | Open in IMG/M |
| 3300017761|Ga0181356_1097950 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 958 | Open in IMG/M |
| 3300017766|Ga0181343_1139477 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 678 | Open in IMG/M |
| 3300017774|Ga0181358_1033610 | All Organisms → Viruses → Predicted Viral | 1996 | Open in IMG/M |
| 3300017774|Ga0181358_1050178 | All Organisms → Viruses → Predicted Viral | 1581 | Open in IMG/M |
| 3300017774|Ga0181358_1140979 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 831 | Open in IMG/M |
| 3300017777|Ga0181357_1116082 | All Organisms → Viruses → Predicted Viral | 1006 | Open in IMG/M |
| 3300017777|Ga0181357_1128256 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 947 | Open in IMG/M |
| 3300017777|Ga0181357_1160754 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 822 | Open in IMG/M |
| 3300017777|Ga0181357_1182157 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 759 | Open in IMG/M |
| 3300017778|Ga0181349_1096362 | All Organisms → Viruses → Predicted Viral | 1111 | Open in IMG/M |
| 3300017780|Ga0181346_1037210 | All Organisms → Viruses → Predicted Viral | 2001 | Open in IMG/M |
| 3300017780|Ga0181346_1137351 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 925 | Open in IMG/M |
| 3300017780|Ga0181346_1321535 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 520 | Open in IMG/M |
| 3300017784|Ga0181348_1130810 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 956 | Open in IMG/M |
| 3300017785|Ga0181355_1271188 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 645 | Open in IMG/M |
| 3300018420|Ga0181563_10601281 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 611 | Open in IMG/M |
| 3300018868|Ga0187844_10292230 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 681 | Open in IMG/M |
| 3300019784|Ga0181359_1164973 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 747 | Open in IMG/M |
| 3300019784|Ga0181359_1191011 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 668 | Open in IMG/M |
| 3300020048|Ga0207193_1149598 | All Organisms → Viruses → Predicted Viral | 1963 | Open in IMG/M |
| 3300020220|Ga0194119_10597558 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 680 | Open in IMG/M |
| 3300020505|Ga0208088_1002196 | All Organisms → Viruses → Predicted Viral | 3131 | Open in IMG/M |
| 3300020530|Ga0208235_1032143 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 628 | Open in IMG/M |
| 3300020535|Ga0208228_1051000 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 622 | Open in IMG/M |
| 3300020550|Ga0208600_1045240 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 666 | Open in IMG/M |
| 3300021962|Ga0222713_10175385 | All Organisms → Viruses → Predicted Viral | 1456 | Open in IMG/M |
| 3300021963|Ga0222712_10192401 | All Organisms → Viruses → Predicted Viral | 1343 | Open in IMG/M |
| 3300021963|Ga0222712_10259164 | All Organisms → Viruses → Predicted Viral | 1108 | Open in IMG/M |
| 3300021963|Ga0222712_10551126 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 673 | Open in IMG/M |
| 3300022179|Ga0181353_1141611 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 560 | Open in IMG/M |
| 3300022190|Ga0181354_1171110 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 667 | Open in IMG/M |
| 3300022407|Ga0181351_1245772 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 561 | Open in IMG/M |
| 3300022752|Ga0214917_10138437 | All Organisms → Viruses → Predicted Viral | 1314 | Open in IMG/M |
| 3300023184|Ga0214919_10459623 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 801 | Open in IMG/M |
| 3300024348|Ga0244776_10311852 | All Organisms → Viruses → Predicted Viral | 1071 | Open in IMG/M |
| 3300024483|Ga0255224_1057967 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 800 | Open in IMG/M |
| 3300024556|Ga0256341_1069975 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 704 | Open in IMG/M |
| 3300024562|Ga0256336_1144121 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 508 | Open in IMG/M |
| 3300024573|Ga0256337_1076789 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 842 | Open in IMG/M |
| 3300026473|Ga0255166_1064831 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 697 | Open in IMG/M |
| 3300027529|Ga0255077_1087765 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 586 | Open in IMG/M |
| 3300027538|Ga0255085_1052421 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 887 | Open in IMG/M |
| 3300027581|Ga0209651_1147609 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 639 | Open in IMG/M |
| 3300027642|Ga0209135_1186137 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 647 | Open in IMG/M |
| 3300027659|Ga0208975_1217854 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 503 | Open in IMG/M |
| 3300027679|Ga0209769_1092722 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 983 | Open in IMG/M |
| 3300027688|Ga0209553_1088634 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1135 | Open in IMG/M |
| 3300027707|Ga0209443_1069001 | All Organisms → Viruses → Predicted Viral | 1394 | Open in IMG/M |
| 3300027720|Ga0209617_10284671 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 621 | Open in IMG/M |
| 3300027720|Ga0209617_10371217 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 526 | Open in IMG/M |
| 3300027721|Ga0209492_1009209 | Not Available | 3282 | Open in IMG/M |
| 3300027754|Ga0209596_1068994 | All Organisms → Viruses → Predicted Viral | 1763 | Open in IMG/M |
| 3300027756|Ga0209444_10313099 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 521 | Open in IMG/M |
| 3300027759|Ga0209296_1082779 | All Organisms → Viruses → Predicted Viral | 1575 | Open in IMG/M |
| 3300027769|Ga0209770_10237263 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 710 | Open in IMG/M |
| 3300027770|Ga0209086_10438343 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 513 | Open in IMG/M |
| 3300027772|Ga0209768_10108285 | All Organisms → Viruses → Predicted Viral | 1356 | Open in IMG/M |
| 3300027782|Ga0209500_10074099 | All Organisms → Viruses → Predicted Viral | 1744 | Open in IMG/M |
| 3300027785|Ga0209246_10129932 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 989 | Open in IMG/M |
| 3300027797|Ga0209107_10182319 | All Organisms → Viruses → Predicted Viral | 1049 | Open in IMG/M |
| 3300027808|Ga0209354_10240283 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 729 | Open in IMG/M |
| 3300027816|Ga0209990_10194569 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 942 | Open in IMG/M |
| 3300027816|Ga0209990_10427710 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 571 | Open in IMG/M |
| 3300027816|Ga0209990_10470708 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 535 | Open in IMG/M |
| 3300027892|Ga0209550_10148800 | All Organisms → Viruses → Predicted Viral | 1671 | Open in IMG/M |
| 3300027892|Ga0209550_10324970 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 979 | Open in IMG/M |
| 3300027963|Ga0209400_1272215 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 661 | Open in IMG/M |
| 3300027971|Ga0209401_1191521 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 769 | Open in IMG/M |
| 3300028025|Ga0247723_1050934 | All Organisms → Viruses → Predicted Viral | 1185 | Open in IMG/M |
| 3300028025|Ga0247723_1055063 | All Organisms → Viruses → Predicted Viral | 1120 | Open in IMG/M |
| 3300028393|Ga0304728_1288498 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 535 | Open in IMG/M |
| (restricted) 3300028553|Ga0247839_1209054 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 791 | Open in IMG/M |
| 3300029933|Ga0119945_1012724 | All Organisms → Viruses → Predicted Viral | 1071 | Open in IMG/M |
| 3300031758|Ga0315907_10213053 | All Organisms → Viruses → Predicted Viral | 1614 | Open in IMG/M |
| 3300031758|Ga0315907_10877766 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 661 | Open in IMG/M |
| 3300031758|Ga0315907_11299312 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 502 | Open in IMG/M |
| 3300031772|Ga0315288_11527495 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 550 | Open in IMG/M |
| 3300031784|Ga0315899_10064193 | All Organisms → Viruses → Predicted Viral | 3817 | Open in IMG/M |
| 3300031787|Ga0315900_11065455 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 524 | Open in IMG/M |
| 3300031834|Ga0315290_10510321 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1049 | Open in IMG/M |
| 3300031857|Ga0315909_10697576 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 659 | Open in IMG/M |
| 3300031951|Ga0315904_11072600 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 631 | Open in IMG/M |
| 3300031952|Ga0315294_11129570 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 642 | Open in IMG/M |
| 3300031952|Ga0315294_11422283 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 547 | Open in IMG/M |
| 3300031963|Ga0315901_11181796 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 519 | Open in IMG/M |
| 3300031999|Ga0315274_10843616 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 964 | Open in IMG/M |
| 3300032050|Ga0315906_10195770 | All Organisms → Viruses → Predicted Viral | 1908 | Open in IMG/M |
| 3300032050|Ga0315906_10245496 | All Organisms → Viruses → Predicted Viral | 1649 | Open in IMG/M |
| 3300032050|Ga0315906_10868030 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 697 | Open in IMG/M |
| 3300032050|Ga0315906_11301149 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 518 | Open in IMG/M |
| 3300032093|Ga0315902_10205300 | All Organisms → Viruses → Predicted Viral | 1971 | Open in IMG/M |
| 3300032116|Ga0315903_10937029 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 614 | Open in IMG/M |
| 3300033981|Ga0334982_0327095 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 714 | Open in IMG/M |
| 3300033981|Ga0334982_0430926 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 594 | Open in IMG/M |
| 3300034060|Ga0334983_0677517 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 552 | Open in IMG/M |
| 3300034101|Ga0335027_0790027 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 551 | Open in IMG/M |
| 3300034102|Ga0335029_0144724 | All Organisms → Viruses → Predicted Viral | 1632 | Open in IMG/M |
| 3300034106|Ga0335036_0826176 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 534 | Open in IMG/M |
| 3300034109|Ga0335051_0397627 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 653 | Open in IMG/M |
| 3300034119|Ga0335054_0677813 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 556 | Open in IMG/M |
| 3300034272|Ga0335049_0605639 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 679 | Open in IMG/M |
| 3300034283|Ga0335007_0400436 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 859 | Open in IMG/M |
| 3300034283|Ga0335007_0511642 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 717 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 26.11% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 9.44% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 8.89% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 8.89% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 7.78% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.89% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 3.89% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 2.78% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 2.78% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.22% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.22% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.67% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment | 1.67% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.67% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.67% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.67% |
| Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 1.11% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.11% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 1.11% |
| Freshwater, Surface Ice | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Surface Ice | 1.11% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 1.11% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.56% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.56% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.56% |
| Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 0.56% |
| Surface Ice | Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice | 0.56% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater | 0.56% |
| Pond Fresh Water | Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water | 0.56% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.56% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.56% |
| Meromictic Pond | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond | 0.56% |
| Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 0.56% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.56% |
| Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 0.56% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000558 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - West In Pit SyncrudeMLSB2011 | Engineered | Open in IMG/M |
| 3300000756 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 | Environmental | Open in IMG/M |
| 3300002206 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - OCT 2012 | Environmental | Open in IMG/M |
| 3300002212 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - JAN 2013 | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
| 3300003404 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD | Environmental | Open in IMG/M |
| 3300003411 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD | Environmental | Open in IMG/M |
| 3300003754 | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004054 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (v2) | Environmental | Open in IMG/M |
| 3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300005940 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_25-Nov-14 | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007548 | Estuarine microbial communities from the Columbia River estuary - metaG 1548B-3 | Environmental | Open in IMG/M |
| 3300007550 | Estuarine microbial communities from the Columbia River estuary - metaG 1549A-3 | Environmental | Open in IMG/M |
| 3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
| 3300008106 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-53-LTR | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
| 3300008111 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008119 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0110-C-NA | Environmental | Open in IMG/M |
| 3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
| 3300008265 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0126-100-LTR | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300009185 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG | Environmental | Open in IMG/M |
| 3300009194 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT | Environmental | Open in IMG/M |
| 3300009469 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 6m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
| 3300010388 | Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV, may 2015 | Environmental | Open in IMG/M |
| 3300011010 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice | Environmental | Open in IMG/M |
| 3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
| 3300012006 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1101B | Environmental | Open in IMG/M |
| 3300012013 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice | Environmental | Open in IMG/M |
| 3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012522 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012666 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Surface Ice version 2 | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013137 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_11.1m | Environmental | Open in IMG/M |
| 3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018868 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_50 | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300020220 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015018 Mahale Deep Cast 100m | Environmental | Open in IMG/M |
| 3300020505 | Freshwater microbial communities from Lake Mendota, WI - 02APR2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020530 | Freshwater microbial communities from Lake Mendota, WI - 22OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020535 | Freshwater microbial communities from Lake Mendota, WI - 25JUL2011 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020550 | Freshwater microbial communities from Lake Mendota, WI - 08OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300024483 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024556 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024562 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024573 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026473 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_8d | Environmental | Open in IMG/M |
| 3300027529 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepC_8h | Environmental | Open in IMG/M |
| 3300027538 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_8d | Environmental | Open in IMG/M |
| 3300027581 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027642 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027679 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027688 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027707 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD (SPAdes) | Environmental | Open in IMG/M |
| 3300027720 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027721 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027756 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027769 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027772 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027971 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300028393 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300028553 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_16m | Environmental | Open in IMG/M |
| 3300029933 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727_2 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300034060 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16May2013-rr0016 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034109 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME26Aug2009-rr0158 | Environmental | Open in IMG/M |
| 3300034119 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Jul2015-rr0166 | Environmental | Open in IMG/M |
| 3300034272 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156 | Environmental | Open in IMG/M |
| 3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Draft_1001119818 | 3300000558 | Hydrocarbon Resource Environments | MEEWKLQVSYKTPAGDMINVRANTADELSVLLEGVGDYSTQVAAVQRLV |
| JGI12421J11937_101683122 | 3300000756 | Freshwater And Sediment | MEDWKLQVSYKTPAGDMINIRANTADELSVLLEGIGDYSVQVAAVQRL |
| metazooDRAFT_13298033 | 3300002206 | Lake | MASEDYKLQVSYKVGTSGDMINIRANTADELSVLLEGIGDYSSQIAAVR |
| metazooDRAFT_13885262 | 3300002212 | Lake | MTEEWKLQVSYKTATGDMINIRANTADELSVLLEGIGDYSTQIVSTQKMLSAAYNVAPLS |
| B570J29032_1097776101 | 3300002408 | Freshwater | MSEENWKLQVSVKSPNGDLINIRATSADELSVLLEGISDYSTQIAATSK |
| JGI25908J49247_101467592 | 3300003277 | Freshwater Lake | MSEENWKLQVSVKSPNGDLINIRAQSADELSVLLEGITDYSTQIA |
| JGI25909J50240_10223634 | 3300003393 | Freshwater Lake | MAEEWKLQVSYRTPNGDMINVRANTADELSILLEGVGDYSTQIASVGKLVVG |
| JGI25920J50251_100949621 | 3300003404 | Freshwater Lake | MEEWKLQVSYKTPAGDMINIRSNTADELSVLLEGIGDYSTQIA |
| JGI25920J50251_100969451 | 3300003404 | Freshwater Lake | MEEWKLQVSYKTPAGDMINIRSNTADELSVLLEGIGDYSTQIAAV |
| JGI25911J50253_100767111 | 3300003411 | Freshwater Lake | MATEEWKLQVSYKTPSGDLINIRAKTAEELSVMLEGVSDYSTQIAATGKLIQGAYT |
| Ga0005853_10444022 | 3300003754 | Freshwater And Sediment | MANEDWKLQWSIKTPTGDLINVRANSAEELSVLLEGIAEVSGQAASTSKVIG |
| Ga0063232_101399951 | 3300004054 | Freshwater Lake | MAEEWKLQVSYRTPNGDMINVRANTADELSILLEGVGDYSTQIASVGKLV |
| Ga0068872_106394662 | 3300005528 | Freshwater Lake | MNNDDWKLQVSYKTGAGDMINIRANTADELSVLLEGISDYSTQIAATGRMLGAA |
| Ga0049081_103430372 | 3300005581 | Freshwater Lentic | MANEDWKLQVSMKSPNGDLINVRANSADELSVLLEGIGDYSTQIAAVSKKVAGAYTVLPL |
| Ga0049080_101776991 | 3300005582 | Freshwater Lentic | MATEDWKLQVSYKTSNGDMINVRANTADELSVLLEGVSDYSTQIA |
| Ga0079957_11919293 | 3300005805 | Lake | MNEEWKLQVSYKTGTGDMINIRANTADELSVLLEGVGDYATQIAATN |
| Ga0073913_100774871 | 3300005940 | Sand | MRKMANEDWKLQVSYKTPSGDMINVRANTADELSVL |
| Ga0075464_102367554 | 3300006805 | Aqueous | MEEWKLQVSYKTPAGDMINIRAHTADELSVLLEGIGDYSAQVAAVQRLVVGAYNAAPLG |
| Ga0075464_106175202 | 3300006805 | Aqueous | MSEEWKLQVSYKIPGDAMINVRANTSDELSVLLEGI |
| Ga0102877_11496862 | 3300007548 | Estuarine | MEEWKLQVSYKAPAGDMINIRGNTADELSVLLEGIGDYSTQMAAV |
| Ga0102880_11653082 | 3300007550 | Estuarine | MEEWKLQVSYKTPAGDMINIRGNTADELSVLLEGIGDYS |
| Ga0105748_100640234 | 3300007992 | Estuary Water | MAEDWKLQVSYKTPAGDMINIRAHTNDELSVLLEGIGDYSTQIAAVQKLVVGAYGLAPLA |
| Ga0114339_11334153 | 3300008106 | Freshwater, Plankton | MAEDWKLQVSYKTGTGDLINVRANTADELSVLLEGIGDFATQIAAVQKLVVGAS |
| Ga0114340_11601032 | 3300008107 | Freshwater, Plankton | MAEDWKLQVSYKTGTGDLINVRANTADELSVLLEGIGDFATQIAAVQKL |
| Ga0114341_103128781 | 3300008108 | Freshwater, Plankton | MAEDWKLQVSYKTGTGDLINVRANTADELSVLLEGIGDFATQIAAVQ |
| Ga0114341_104017072 | 3300008108 | Freshwater, Plankton | MAEDWKLQVSYKTPAGDMINIRAHTNDELSVLLEGIGDYSTQIAAVQKLVVGAYGLAP |
| Ga0114344_11487191 | 3300008111 | Freshwater, Plankton | MAEDWKLQVSYKTGTGDLINVRANTADELSVLLEGIGDFATQI |
| Ga0114346_10633471 | 3300008113 | Freshwater, Plankton | MAEDWKLQVSYKTPAGDMITIRAHTNDELSVLLEGIG |
| Ga0114346_12321412 | 3300008113 | Freshwater, Plankton | MAEDWKLQVSYKTPAGDMINVRAQTADELSVLLESMGDYSTQIAAVQRL |
| Ga0114350_10898222 | 3300008116 | Freshwater, Plankton | MNEEWKLQVSYKTGTGDMINIRANTADELSVLLEGVGDYATQIAATNKMLAA |
| Ga0114354_11102771 | 3300008119 | Freshwater, Plankton | MAEDWKLQVSYKTPGGDMINVRANTADELSVLLEGIGDYSTQIAAVGKLVVGAS |
| Ga0114355_11132351 | 3300008120 | Freshwater, Plankton | MAIEDWKLQVSYKSPTGDLINVRANTSDELSVLLEGVSDYATQIAATGKLLAG |
| Ga0114355_11182603 | 3300008120 | Freshwater, Plankton | MNEEWKLQVSYKTGAGDMINIRANTADELSVLLEGVGDYATQIAATNKMLAA |
| Ga0114355_11277531 | 3300008120 | Freshwater, Plankton | MAEDWKLQVSYKTGTGDLINVRANTADELSVLLEGIGDFATQIA |
| Ga0114355_11285011 | 3300008120 | Freshwater, Plankton | MAIEDWKLQVSYKSPNGDLINVRANTSDELSVLLEGVSDYATQIAATGKLLAG |
| Ga0114355_11677371 | 3300008120 | Freshwater, Plankton | MAEDWKLQVSYKTGTGDLINVRANTADELSVLLEGIGDFATQ |
| Ga0114361_11199802 | 3300008265 | Freshwater, Plankton | MRKTMANEDWKLQVSYKTPSGDMINIRANTADELSVLLEGVGDYSTQIAATQQKIVGSYA |
| Ga0114363_11369352 | 3300008266 | Freshwater, Plankton | MSEEWKLQVSYKTPSGDMINVRANTSDELSVLLEGVGDYATQIASVQ |
| Ga0114363_11565772 | 3300008266 | Freshwater, Plankton | MAEDWKLQVSYKTGTGDLINVRANTADELSVLLEGIG |
| Ga0114880_10979611 | 3300008450 | Freshwater Lake | MATEEWKLQVSYKTPSGDLINIRAKTAEELSVMLEGVSDYSTQI |
| Ga0114880_11435512 | 3300008450 | Freshwater Lake | MNNDDWKIQVSLKSSASKDADMINIRANTIDELSILLEGVGDYATQIASTAKLVQVAY |
| Ga0114880_11468303 | 3300008450 | Freshwater Lake | MTTENWKLQVSVKSPNGDLINIRANTADELSVMLEGIADYSHQIAATSKAVAA |
| Ga0114973_100289531 | 3300009068 | Freshwater Lake | MAMEDWKLQVSYKTPTGDLINIRAKTTEELSVMLEGVSDYSTQIAATGKLIQGA |
| Ga0105098_106980701 | 3300009081 | Freshwater Sediment | MEEWKLQVSYKTPAGDMINVRANTADELSVLLEGVGDYSTQ |
| Ga0105103_108647961 | 3300009085 | Freshwater Sediment | MAEDWKLQVSYKTNGGDMVNVRANTADELSVLLEGISDYSTQIAATGRMLNGAGVA |
| Ga0114980_104549342 | 3300009152 | Freshwater Lake | MAMEDWKLQVSYKTPTGDLINIRAQTAEELSVMLEGVT |
| Ga0114963_103668301 | 3300009154 | Freshwater Lake | MNEDWKLQVSYKTPAGDMINVRANTADELSVLLEGVGDYSTQVASVQRLIVGAYN |
| Ga0114968_107066872 | 3300009155 | Freshwater Lake | MRKMANEDWKLQVSYKTPSVDMINVRANTADKLAVLLEGVGD |
| Ga0114981_107808581 | 3300009160 | Freshwater Lake | MEEWKLQVSYKTPAGDMINIRSNTADELSVLLEGIG |
| Ga0105102_106142592 | 3300009165 | Freshwater Sediment | MTTENWKLQVSVKSPNGDLINIRANTADELSVMLEGIADYSHQIAATS |
| Ga0105097_101866631 | 3300009169 | Freshwater Sediment | MANEDWKLQVSMKSPTGDLINVRANTADELSVLLEGVGDYSTQ |
| Ga0114979_106566241 | 3300009180 | Freshwater Lake | MAEDWKLQVNYKLSTGDLINIRANSADELSVLLEGIGDYATQIHATQRLLQG |
| Ga0114969_105991192 | 3300009181 | Freshwater Lake | MATEEWKLQVSYKTPSGDLINIRAKTAEELSVMLEGVSDYSTQIAATGKLIQGAYTVAPL |
| Ga0114976_106839211 | 3300009184 | Freshwater Lake | MEEWKLQVSYKTPAGDMINVRANTADELSILLEGVGD |
| Ga0114971_107929881 | 3300009185 | Freshwater Lake | MATEEWKLQVSYKTPSGDLINIRAKTAEELSVMLEGVSDYST |
| Ga0114983_100301813 | 3300009194 | Deep Subsurface | MTTENWKLQVSVKSPNGDLINVRANTADELSVLLEGLADYSTQIAATSK |
| Ga0127401_11596662 | 3300009469 | Meromictic Pond | MTVENWKLQVSYKTGSGDMINIRANTADELSVLLEGIGDYAVQIAATQRLLGASYATA |
| Ga0136551_10508801 | 3300010388 | Pond Fresh Water | MSAEEWKLQVSIKTPAGDLINIRANTAEELSVLLEGISDYSTQIAAT |
| Ga0139557_10594261 | 3300011010 | Freshwater | MEDWKLQVSYKTPAGDMINIRANTADELSVLLEGIGDYSVQVAAVQR |
| Ga0151620_11340021 | 3300011268 | Freshwater | MEDWKLQVSYKTPAGDMINIRANTADELSVLLEGIGDYSTQVASVQ |
| Ga0119955_10767293 | 3300012006 | Freshwater | MAEDWKLQVSYKLNTGDLINIRANTADELSVLLEGIGDFSTQIAAVQRLVTGAYNVA |
| Ga0153805_10420641 | 3300012013 | Surface Ice | MEEWKLQVSYKTPAGDMINIRSNTADELSVLLEGIGDYSTQ |
| Ga0153801_10280341 | 3300012017 | Freshwater | MNEEWKLQVSYKTGSGDMINIRANTADELSVLLEGIGDYSTQIAATNKKLAQAYTVLP |
| Ga0153801_10312783 | 3300012017 | Freshwater | MEEWKLQVSYKTPAGDMINIRSNTADELSVLLEGIGDYSTQIAAVQR |
| Ga0153801_10348893 | 3300012017 | Freshwater | MSTEDWKLQVSYKTPGGDMINIRANTADELSVLLEGIGDYSPQI |
| Ga0129326_11034532 | 3300012522 | Aqueous | MANEDWKLQVSYTIPNGPMINVRAQSADELSVLLEGTGDYSTQI |
| Ga0157498_10334561 | 3300012666 | Freshwater, Surface Ice | MSTEDWKLQVSYKTPGGDMINIRANTADELSVLLEGIGDYSPQIAAVRGLVVASYN |
| Ga0157498_10459891 | 3300012666 | Freshwater, Surface Ice | MAEDWKLQVSYKTGTGDLINVRAGTADELSVLLEGIGDFATQIAAVQK |
| Ga0164293_107093452 | 3300013004 | Freshwater | MAEDWKLQVSYKTPSGDMINVRAQTADELSVLLEGIGDYSHQV |
| (restricted) Ga0172375_105860091 | 3300013137 | Freshwater | MAIEDWKLQVSYKSPTGDLINVRANTSDELSVLLEGVSDYATQIAATGKL |
| Ga0170791_125758952 | 3300013295 | Freshwater | MAEDWKLQVNYKLPTGDLINIRANSADELSVLLEGIGDYSTQIHATQRLLASAGTL |
| Ga0177922_112956783 | 3300013372 | Freshwater | MNNDDWKIQVSIKSSASKDADMINVRANTADELSVLLEGVSNYSTQIAATAK |
| Ga0181364_10048311 | 3300017701 | Freshwater Lake | MAEDWKLQVSYKTPSGDMINIRAHTNDELSVLLEGIGDYSTQI |
| Ga0181364_10547141 | 3300017701 | Freshwater Lake | MAEDWKLQVSYKTGTGDLINVRAGTADELSVLLEGI |
| Ga0181365_10248863 | 3300017736 | Freshwater Lake | MATEEWKLQVSYKTPSGDLINIRAKTAEELSVMLEGV |
| Ga0181365_10521263 | 3300017736 | Freshwater Lake | MATEDWKLQVSYKTSNGDMINVRANTADELSVLLEGVSDYSTQIAATARMLNGAAVVAPL |
| Ga0181365_11363632 | 3300017736 | Freshwater Lake | MEEWKLQVSYKTPAGDMINVRAQTADELSVLLEGVGDYSTQIAAVQRLVVGAY |
| Ga0181356_10979501 | 3300017761 | Freshwater Lake | MSEEWKLQVSYKTPGGDMINIRANTADELSVLLEGVGDYATQIAATNKLL |
| Ga0181343_11394773 | 3300017766 | Freshwater Lake | MAEDWKLQVSYKTNGGDMVNVRANTADELSVLLEGISDYSTQ |
| Ga0181358_10336106 | 3300017774 | Freshwater Lake | MSEEWKLQVSYKTPSGDLINIRAKTAEELSVMLEGV |
| Ga0181358_10501781 | 3300017774 | Freshwater Lake | MREPMANEDWKLQVSYKTPSGDMINVRANTADELSVLLEGVGDYSTQIAATQQKVIA |
| Ga0181358_11409791 | 3300017774 | Freshwater Lake | MANEDWKLQVSYKTPSGDMINVRANTADELSVLLEGVGDYSTQIAATQQKVIA |
| Ga0181357_11160823 | 3300017777 | Freshwater Lake | MREPMANEDWKLQVSYKTPSGDMINVRANTADELSVLLEGVGDY |
| Ga0181357_11282563 | 3300017777 | Freshwater Lake | MSEEWKLQVSYKTPGGDMINIRANTADELSVLLEGVGDYATQIAATNKLLAGAYNLA |
| Ga0181357_11607541 | 3300017777 | Freshwater Lake | MNEEWKLQVSYKTGPGDMINIRANTADELSVLLEGVGDYATQIAATNKLLAGAYNLA |
| Ga0181357_11821571 | 3300017777 | Freshwater Lake | MNNEGYKLQVSYKTPTGDMINVRADTSDELSVLLEG |
| Ga0181349_10963624 | 3300017778 | Freshwater Lake | MAEDWKLQVSYKTPSGDMINIRAHTNDELSVLLEGIGDYSTQIAAVQRLVVGAYG |
| Ga0181346_10372107 | 3300017780 | Freshwater Lake | MSTEDWKLQVSYKLATGDLINIRANTADELSVLLEGIGDYSTQIAA |
| Ga0181346_11373513 | 3300017780 | Freshwater Lake | MRKAMANEDWKLQVSYKTPSGDMVNVRANTADELSVLLEGVGDY |
| Ga0181346_13215351 | 3300017780 | Freshwater Lake | MANEDWKLQVSYKTPTGDMINIRANTADELSVLFP |
| Ga0181348_11308103 | 3300017784 | Freshwater Lake | MREPMANEDWKLQVSYKTPSGDMINVRANTADELSVLLEGVGDYSTQI |
| Ga0181355_12711883 | 3300017785 | Freshwater Lake | VSNEDWKLQVSYKTPAGDMINVRANTADELSVLLEGI |
| Ga0181563_106012811 | 3300018420 | Salt Marsh | MEEWKLQVSYKTPAGDMINIRANTADELSVLLEGIGDYSTQVAAVQRLVVGAY |
| Ga0187844_102922301 | 3300018868 | Freshwater | MAEDWKLQVSYKTGTGDLINVRANTVDELSVLLEGIGDF |
| Ga0181359_11649731 | 3300019784 | Freshwater Lake | MANEDWKLQVSYKTGTGDMINVRAHTAEELSVLLEGVSDYSAQIAAT |
| Ga0181359_11910112 | 3300019784 | Freshwater Lake | MSTEDWKLQVSYKLATGDLINIRANTADELSVLLEGIGDYS |
| Ga0207193_11495981 | 3300020048 | Freshwater Lake Sediment | MAEDWKLQVSYKTPSGDMINVRAQTADELSVLLEGIGDYSHQVASVQRLI |
| Ga0194119_105975582 | 3300020220 | Freshwater Lake | VEDYKLQVSYKVGPTGDMINVRANTADELSVLIEGVGDYSHQIAAVAKLVQGAY |
| Ga0208088_10021968 | 3300020505 | Freshwater | MAEDWKLQVSYKTPAGDMINVRAQTADELSVLLESMGDYSTQIAAVQRLVVGAYGVAP |
| Ga0208235_10321431 | 3300020530 | Freshwater | MSEENWKLQVSVKSPNGDLINIRATSADELSVLLEGISDYSTQIAATSKMI |
| Ga0208228_10510002 | 3300020535 | Freshwater | MEDWKLQVSYKTPAGDMINIRANTADELSVLLEGIGDYSTQVAAVQRLVVGAY |
| Ga0208600_10452402 | 3300020550 | Freshwater | MAIEDWKLQVSIKTPVGDLINIRANTSDELSVLLEGIADFSTQIAATQKMIAGAYNTAPL |
| Ga0222713_101753854 | 3300021962 | Estuarine Water | MSAEEWKLQVSIKTPAGDLINIRANTAEELSVLLEGISDYSTQIAATQKMVH |
| Ga0222712_101924014 | 3300021963 | Estuarine Water | MNEEWKLQVSYKTPSGDMINIRANTADELSVFLEGVGDYSTQIAATQKL |
| Ga0222712_102591641 | 3300021963 | Estuarine Water | MNEDWKLQVSYKTPAGDMINVRANTADELSVLLEGIGDYS |
| Ga0222712_105511262 | 3300021963 | Estuarine Water | MAIEDWKLQVSYKSPSGDLINVRANTSDELSVLLEGVSDYATQIAATGK |
| Ga0181353_11416111 | 3300022179 | Freshwater Lake | MTTENWKLQVSVKSPNGDLINIRANTADELSVMLEGIADYSHQIAATSKA |
| Ga0181354_11711102 | 3300022190 | Freshwater Lake | MSEENWKLQVSVKSPNGDLINIRAQSADELSVLLEGI |
| Ga0181351_12457722 | 3300022407 | Freshwater Lake | MAEEWKLQVNYKLATGDLINIRANSADELSVLLEGIGDYA |
| Ga0214917_101384371 | 3300022752 | Freshwater | MRKTMANEDWKLQVSYKTPSGDMINIRANTADELSVLLEGVGDYSTQIAATQQKIV |
| Ga0214919_104596231 | 3300023184 | Freshwater | MEEWKLQVSYKTPAGDMINVRAQTADELSVLLEGVGDYSTQIAAVQRLVVGAYTLAPL |
| Ga0244776_103118523 | 3300024348 | Estuarine | MANEDWKLQVSYKTGTGDMINVRAHTAEELSVLLEGVSDYS |
| Ga0255224_10579672 | 3300024483 | Freshwater | MNNDDWKIQVSIKSSPSKDADMINVRANTADELSVLLEGVSNYSTQIAATAKMVQAAYTT |
| Ga0256341_10699752 | 3300024556 | Freshwater | MSEDWKLQVSYKTSTGDMINIRAHTADELSVLLENIGDYATQIAATQRQIAQAN |
| Ga0256336_11441212 | 3300024562 | Freshwater | MSEDWKLQVSYKTSTGDMINIRAHTADELSVLLENIG |
| Ga0256337_10767893 | 3300024573 | Freshwater | MSEDWKLQVSYKTSTGDMINIRAHTADELSVLLENIGDYATQIAATQR |
| Ga0255166_10648312 | 3300026473 | Freshwater | MSEDWKLQVSYKTSTGDMINIRAHTADELSVLLENIGDYATQI |
| Ga0255077_10877651 | 3300027529 | Freshwater | MRNMANEDWKLQVSYKTPTGDMINIRANTADELSVLLEGIGDYSTQ |
| Ga0255085_10524211 | 3300027538 | Freshwater | MNNDDWKIQVSIKSSASKDADMINVRANTADELSVLLEGVSNYSTQIAATAKMV |
| Ga0209651_11476091 | 3300027581 | Freshwater Lake | MEEWKLQVSYKTPAGDMINVRANTADELSVLLEGVGDYSTQVAAVQRLVVGAYNAAPLG |
| Ga0209135_11861371 | 3300027642 | Freshwater Lake | MEEWKLQVSYKTPAGDMINIRSNTADELSVLLEGIGDYST |
| Ga0208975_12178541 | 3300027659 | Freshwater Lentic | MANEDWKLQVSYKTPSGDMINVRANTADELSVLLEGVGDYSTQIAATQQKIVGS |
| Ga0209769_10927221 | 3300027679 | Freshwater Lake | MATEEWKLQVSYKTPSGDLINIRAKTSEELSVMLEG |
| Ga0209553_10886341 | 3300027688 | Freshwater Lake | MAEDWKLQVSYKTGFGDLINIRANTADELSVLLEGIGDFATQI |
| Ga0209443_10690011 | 3300027707 | Freshwater Lake | MADDWKLQVSYTINGDMINVRANTVDELSILLEGVGDYSTQI |
| Ga0209617_102846711 | 3300027720 | Freshwater And Sediment | MEEWKLQVSYKTPAGDMINIRSNTADELSVLLEGIGDY |
| Ga0209617_103712171 | 3300027720 | Freshwater And Sediment | MAEDWKLQVSYKTPSGDMINIRAHTNDELSVLLEGIGDYSTQIAAVQRLVVG |
| Ga0209492_10092091 | 3300027721 | Freshwater Sediment | MAEDWKLQVSYKTNGGDMVNVRANTADELSVLLEGISDYSTQIAATGRMLNGAGVAAPL |
| Ga0209596_10689941 | 3300027754 | Freshwater Lake | MTVENWKLQVSYKTGSGDMINVRANTADELSVLLEGVGDYAVQIAA |
| Ga0209444_103130992 | 3300027756 | Freshwater Lake | MAEDWKLQVSYKTSTGDLINIRANTTDELSVLLEGIGDYSTQIAAVQRLIVGAG |
| Ga0209296_10827791 | 3300027759 | Freshwater Lake | MAEDWKLQVSYKTPAGDMINIRAHTNDELSVLLEGIGDYSTQIAAVQRLVVGAYGLAP |
| Ga0209770_102372632 | 3300027769 | Freshwater Lake | MRKTMGNEDWKLQVSYKTPSGDMINIRANTADELSVL |
| Ga0209086_104383431 | 3300027770 | Freshwater Lake | MAEEWKLQVNYKLATGDLINIRANSADELSVLLEGI |
| Ga0209768_101082851 | 3300027772 | Freshwater Lake | MANEDWKLQVSYKTPSGDMINVRANTADELSVLLEGVGDYSTQIAA |
| Ga0209500_100740991 | 3300027782 | Freshwater Lake | MSEENWKLQVSVKSPNGDLINIRAQSADELSVLLEGITDYSTQIAATSK |
| Ga0209246_101299321 | 3300027785 | Freshwater Lake | MSEENWKLQVSVKSPNGDLINIRAQSADELSVLLEGITDYSTQIAATSKMIAGAYTV |
| Ga0209107_101823191 | 3300027797 | Freshwater And Sediment | MAEEWKLQVNYKLATGDLINIRANSADELSVLLEGIGDYATQIHATQRLLSQ |
| Ga0209354_102402832 | 3300027808 | Freshwater Lake | MANEDWKLQVSYKTPSGDMVNVRANTADELSVLLEGVGDYS |
| Ga0209990_101945691 | 3300027816 | Freshwater Lake | MNEEWKLQVSYKTGAGDMINIRANTADELSVLLEGVG |
| Ga0209990_104277101 | 3300027816 | Freshwater Lake | MAIEDWKLQVSYKSPTGDLINVRANTSDELSVLLEGVSDYATQIAATGKLLAGAYTA |
| Ga0209990_104707082 | 3300027816 | Freshwater Lake | MTEEWKLQVSYKTGTGDMINIRANTADELSVLLEGIGDYATQIVATNKLLG |
| Ga0209550_101488004 | 3300027892 | Freshwater Lake | MANEDWKLQVSYKTPSGDMINVRANTADELSVLLEGVGDYSTQIA |
| Ga0209550_103249703 | 3300027892 | Freshwater Lake | MRKQMANEDWKLQVSYKTPSGDMINVRANTADELSVLLEGVGDYSTQIA |
| Ga0209400_12722151 | 3300027963 | Freshwater Lake | MTVENWKLQVSYKTGSGDMINVRANTADELSVLLEGVGDYAVQIAATNRLL |
| Ga0209401_11915212 | 3300027971 | Freshwater Lake | MEDWKLQVSYKTPTGDLINIRAKTTEELSVMLEGVSDYSTQIAATGKLIQG |
| Ga0247723_10509343 | 3300028025 | Deep Subsurface Sediment | MAIEDWKLQVSYKSPNGDLINVRANTSDELSVLLEGVSDYATQIAATGKMIAGAYT |
| Ga0247723_10550631 | 3300028025 | Deep Subsurface Sediment | MTTENWKLQVSVKSPNGDLINVRANTADELSVLLEGLADY |
| Ga0304728_12884981 | 3300028393 | Freshwater Lake | MAMEDWKLQVSYKTPTGDLINIRAQTAEELSVMLEGVSDYSTQIAATGKLIQGVYTASPL |
| (restricted) Ga0247839_12090541 | 3300028553 | Freshwater | MNEEWKLQVSYKTGSGDMINIRANTADELSVLLEGIGDYSTQIAATNKKIA |
| Ga0119945_10127244 | 3300029933 | Aquatic | MANEDWKLQVSYKTPSGDMINVRANTADELSVLLEGVGDYSPQIA |
| Ga0315907_102130534 | 3300031758 | Freshwater | MRKTMANEDWKLQVSYKTPSGDMINVRANTADELSVLLEG |
| Ga0315907_108777662 | 3300031758 | Freshwater | MEEWKLQVSYKTPAGDMINVRANTADELSVLLEGVGDYSTQVAAVQ |
| Ga0315907_112993121 | 3300031758 | Freshwater | MAEDWKLQVSYKTGTGDLINVRANTADELSVLLEGIGDFATQIAAVQKLVV |
| Ga0315288_115274952 | 3300031772 | Sediment | MAEDWKLQVNYKLPTGDLINIRANSADELSVLLEGIGDYSTQIHATQRMLASAGTLAP |
| Ga0315899_100641939 | 3300031784 | Freshwater | MTNEDWKLQVSMKSPNGDLINVRAGSADELSVLLEGIGD |
| Ga0315900_110654552 | 3300031787 | Freshwater | MTIENWKLQVSVKSPNGDLINVRANTADELSVLLEGLADYSTQIAATSKAVAAAYTVLP |
| Ga0315290_105103213 | 3300031834 | Sediment | MATEEWKLQVSYKTPSGDLINIRAKTAEELSVMLEGVSDYSTQ |
| Ga0315909_106975762 | 3300031857 | Freshwater | MTTENWKLQVSVKSPNGDLINIRANTADELSVMLEGVTDYSHQIAATSKA |
| Ga0315904_110726002 | 3300031951 | Freshwater | MNEEWKLQVSYKTGTGDMINIRANTADELSVLLEGVGDY |
| Ga0315294_111295702 | 3300031952 | Sediment | MTTENWKLQVSYKTSAGDMINVRANTADELSVLLEGVSDYSTQIAATSKILNA |
| Ga0315294_114222832 | 3300031952 | Sediment | MAEDWKLQVSYKTSFGDLINIRANTADELSVLLEGIGDFATQISAVRQLVVGAGV |
| Ga0315901_111817962 | 3300031963 | Freshwater | MRKTMANEDWKLQVSYKTPSGDMINVRANTADELSVL |
| Ga0315274_108436163 | 3300031999 | Sediment | MAEDWKLQVSYKTSTGDLINIRANTTDELSVLLEGIGDYSTQIAAVQRLIVG |
| Ga0315906_101957701 | 3300032050 | Freshwater | MANEDWKLQVSYKTPSGDMINIRANTADELSVLLEGIGDYSPQIAATQQKVVGA |
| Ga0315906_102454963 | 3300032050 | Freshwater | MRNMANEDWKLQVSYKTPTGDMINIRANTADELSVLLEGIGDYSTQISSVQQKVVGA |
| Ga0315906_108680301 | 3300032050 | Freshwater | MNNDDWKLQVSYKTPSGDMINVRANTADELSVLLEGIGDYS |
| Ga0315906_113011491 | 3300032050 | Freshwater | MANEDWKLQVSYKSPNGDLINIRANTSDELSVLLEGVSDYSTQIVATGKLI |
| Ga0315902_102053005 | 3300032093 | Freshwater | MAIEDWKLQVSYKSPTGDLINVRANTSDELSVLLEGVSD |
| Ga0315903_109370291 | 3300032116 | Freshwater | MNEEWKLQVSYKTGTGDMINIRANTADELSVLLEGVGDYATQIA |
| Ga0334982_0327095_582_713 | 3300033981 | Freshwater | MSNEDWKLQVSYKTPAGDMINVRANTADELSVLLEGIGDYSSQI |
| Ga0334982_0430926_1_159 | 3300033981 | Freshwater | MSAEEWKLQVSIKTPAGDLINIRANTAEELSVLLEGISDYSTQIAATQKMVHG |
| Ga0334983_0677517_2_127 | 3300034060 | Freshwater | MAEDWKLQVSYKTPSGDMINVRAQTADELSVLLEGIGDYSHQ |
| Ga0335027_0790027_438_551 | 3300034101 | Freshwater | MAIEDWKLQVSIKTPVGDLINIRANTSDELSVLLEGIA |
| Ga0335029_0144724_1521_1631 | 3300034102 | Freshwater | MANEDWKLQVSYKTPSGDLINIRANTSEELSVLLEGV |
| Ga0335036_0826176_1_165 | 3300034106 | Freshwater | MEDWKLQVSYKTPAGDMINIRANTADELSVLLEGIGDYSTQVAAVQRLVVGAYNA |
| Ga0335051_0397627_487_651 | 3300034109 | Freshwater | MNEEWKLQVSYKTGPGDMINIRANTADELSVLLEGVGDYATQIAATNKLLAGAYN |
| Ga0335054_0677813_381_554 | 3300034119 | Freshwater | MAEDWKLQVSYKTNGGDMVNVRANTADELSVLLEGISDYSTQIAATGRMLNGAGVAAP |
| Ga0335049_0605639_2_106 | 3300034272 | Freshwater | MEEWKLQVSYKTPAGDMINVRANTADELSVLLEGV |
| Ga0335007_0400436_728_859 | 3300034283 | Freshwater | MTTENWKLQVSYKTSAGDMINVRANTTDELSVLLEGVSDYSTQI |
| Ga0335007_0511642_1_108 | 3300034283 | Freshwater | MEEWKLQVSYKTPAGDMINVRANTADELSVLLEGVG |
| ⦗Top⦘ |