NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F032183

Metagenome / Metatranscriptome Family F032183

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F032183
Family Type Metagenome / Metatranscriptome
Number of Sequences 180
Average Sequence Length 46 residues
Representative Sequence MLATILIVVMILLQTGALSLGLMVDRRFITAAASLNRKSALLNRHNRERP
Number of Associated Samples 145
Number of Associated Scaffolds 180

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 82.78 %
% of genes near scaffold ends (potentially truncated) 28.89 %
% of genes from short scaffolds (< 2000 bps) 72.22 %
Associated GOLD sequencing projects 137
AlphaFold2 3D model prediction Yes
3D model pTM-score0.41

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (55.556 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment
(17.222 % of family members)
Environment Ontology (ENVO) Unclassified
(28.889 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Subsurface (non-saline)
(35.556 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 60.26%    β-sheet: 0.00%    Coil/Unstructured: 39.74%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.41
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 180 Family Scaffolds
PF00912Transgly 10.56
PF00072Response_reg 8.33
PF13545HTH_Crp_2 3.89
PF02518HATPase_c 3.33
PF00210Ferritin 2.78
PF05532CsbD 1.67
PF00534Glycos_transf_1 1.67
PF02954HTH_8 1.67
PF01594AI-2E_transport 1.67
PF00990GGDEF 1.67
PF16864Dimerisation2 1.67
PF13185GAF_2 1.11
PF13439Glyco_transf_4 1.11
PF13727CoA_binding_3 0.56
PF04120Iron_permease 0.56
PF02371Transposase_20 0.56
PF00872Transposase_mut 0.56
PF03631Virul_fac_BrkB 0.56
PF02915Rubrerythrin 0.56
PF10282Lactonase 0.56
PF00905Transpeptidase 0.56
PF09537DUF2383 0.56
PF01391Collagen 0.56
PF13188PAS_8 0.56

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 180 Family Scaffolds
COG0744Penicillin-binding protein 1B/1F, peptidoglycan transglycosylase/transpeptidaseCell wall/membrane/envelope biogenesis [M] 10.56
COG4953Membrane carboxypeptidase/penicillin-binding protein PbpCCell wall/membrane/envelope biogenesis [M] 10.56
COG5009Membrane carboxypeptidase/penicillin-binding proteinCell wall/membrane/envelope biogenesis [M] 10.56
COG0628Predicted PurR-regulated permease PerMGeneral function prediction only [R] 1.67
COG3237Uncharacterized conserved protein YjbJ, UPF0337 familyFunction unknown [S] 1.67
COG1295Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase)Function unknown [S] 0.56
COG3328Transposase (or an inactivated derivative)Mobilome: prophages, transposons [X] 0.56
COG3547TransposaseMobilome: prophages, transposons [X] 0.56


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms55.56 %
UnclassifiedrootN/A44.44 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2199352025|deepsgr__Contig_27092All Organisms → cellular organisms → Bacteria3717Open in IMG/M
2228664021|ICCgaii200_c0675108Not Available865Open in IMG/M
3300000363|ICChiseqgaiiFebDRAFT_10824610All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium939Open in IMG/M
3300000787|JGI11643J11755_11645550All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1465Open in IMG/M
3300002407|C687J29651_10281525All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium525Open in IMG/M
3300002681|Ga0005471J37259_108517All Organisms → cellular organisms → Bacteria → Proteobacteria610Open in IMG/M
3300004025|Ga0055433_10098597Not Available661Open in IMG/M
3300004052|Ga0055490_10064869Not Available979Open in IMG/M
3300004137|Ga0058883_1470767Not Available658Open in IMG/M
3300004156|Ga0062589_102327006Not Available551Open in IMG/M
3300004156|Ga0062589_102553197Not Available529Open in IMG/M
3300004463|Ga0063356_100378039All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1808Open in IMG/M
3300004463|Ga0063356_100620538Not Available1467Open in IMG/M
3300004463|Ga0063356_101160248All Organisms → cellular organisms → Bacteria → Proteobacteria1118Open in IMG/M
3300005168|Ga0066809_10070055All Organisms → cellular organisms → Bacteria816Open in IMG/M
3300005175|Ga0066673_10530268Not Available691Open in IMG/M
3300005183|Ga0068993_10360879Not Available533Open in IMG/M
3300005294|Ga0065705_10109623All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria4689Open in IMG/M
3300005294|Ga0065705_10710605Not Available648Open in IMG/M
3300005295|Ga0065707_10005777All Organisms → cellular organisms → Bacteria → Proteobacteria3427Open in IMG/M
3300005445|Ga0070708_100925912All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium818Open in IMG/M
3300005446|Ga0066686_10696014Not Available686Open in IMG/M
3300005471|Ga0070698_100718181All Organisms → cellular organisms → Bacteria942Open in IMG/M
3300005471|Ga0070698_102020598Not Available530Open in IMG/M
3300005526|Ga0073909_10012597All Organisms → cellular organisms → Bacteria2607Open in IMG/M
3300005536|Ga0070697_100128473All Organisms → cellular organisms → Bacteria → Proteobacteria2124Open in IMG/M
3300005543|Ga0070672_101125992Not Available698Open in IMG/M
3300005836|Ga0074470_11274722Not Available701Open in IMG/M
3300005844|Ga0068862_101077613Not Available798Open in IMG/M
3300005886|Ga0075286_1006229All Organisms → cellular organisms → Bacteria1360Open in IMG/M
3300006049|Ga0075417_10058678All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1680Open in IMG/M
3300006844|Ga0075428_101921421Not Available614Open in IMG/M
3300006845|Ga0075421_101925039Not Available632Open in IMG/M
3300006845|Ga0075421_102130185Not Available594Open in IMG/M
3300006852|Ga0075433_10300793All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1420Open in IMG/M
3300006853|Ga0075420_100848070Not Available787Open in IMG/M
3300006854|Ga0075425_100200172All Organisms → cellular organisms → Bacteria2295Open in IMG/M
3300006876|Ga0079217_10010546All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2959Open in IMG/M
3300006903|Ga0075426_10021685All Organisms → cellular organisms → Bacteria4592Open in IMG/M
3300006903|Ga0075426_10147292Not Available1698Open in IMG/M
3300006914|Ga0075436_100119094All Organisms → cellular organisms → Bacteria1846Open in IMG/M
3300006914|Ga0075436_100821631Not Available693Open in IMG/M
3300006918|Ga0079216_10115051Not Available1334Open in IMG/M
3300006954|Ga0079219_11232123Not Available651Open in IMG/M
3300007076|Ga0075435_101637729Not Available565Open in IMG/M
3300009081|Ga0105098_10566648Not Available587Open in IMG/M
3300009147|Ga0114129_10028753All Organisms → cellular organisms → Bacteria → Proteobacteria7876Open in IMG/M
3300009147|Ga0114129_10356061All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1938Open in IMG/M
3300009147|Ga0114129_11431134All Organisms → cellular organisms → Bacteria852Open in IMG/M
3300009162|Ga0075423_13083615Not Available510Open in IMG/M
3300009167|Ga0113563_11926837All Organisms → cellular organisms → Bacteria705Open in IMG/M
3300009553|Ga0105249_10998124Not Available906Open in IMG/M
3300009678|Ga0105252_10000414All Organisms → cellular organisms → Bacteria30082Open in IMG/M
3300009678|Ga0105252_10043432All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1682Open in IMG/M
3300009805|Ga0105079_1045968Not Available510Open in IMG/M
3300009809|Ga0105089_1089331Not Available533Open in IMG/M
3300009818|Ga0105072_1053179Not Available773Open in IMG/M
3300010391|Ga0136847_10046909All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium687Open in IMG/M
3300010400|Ga0134122_13010272Not Available525Open in IMG/M
3300011120|Ga0150983_15600657All Organisms → cellular organisms → Bacteria862Open in IMG/M
3300011432|Ga0137428_1007128All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium3075Open in IMG/M
3300011433|Ga0137443_1054349Not Available1096Open in IMG/M
3300011442|Ga0137437_1003124All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium5897Open in IMG/M
3300012040|Ga0137461_1000182All Organisms → cellular organisms → Bacteria14574Open in IMG/M
3300012159|Ga0137344_1021928All Organisms → cellular organisms → Bacteria1037Open in IMG/M
3300012174|Ga0137338_1077788All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium719Open in IMG/M
3300012202|Ga0137363_10047366All Organisms → cellular organisms → Bacteria3064Open in IMG/M
3300012205|Ga0137362_10334168Not Available1312Open in IMG/M
3300012207|Ga0137381_11445513Not Available579Open in IMG/M
3300012228|Ga0137459_1247785Not Available515Open in IMG/M
3300012353|Ga0137367_10344575All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1061Open in IMG/M
3300012361|Ga0137360_10233583Not Available1503Open in IMG/M
3300012486|Ga0157331_1016666Not Available612Open in IMG/M
3300012532|Ga0137373_10731343Not Available736Open in IMG/M
3300012922|Ga0137394_10292192Not Available1393Open in IMG/M
3300012923|Ga0137359_10079670All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2874Open in IMG/M
3300012923|Ga0137359_10689863Not Available890Open in IMG/M
3300012931|Ga0153915_10354239All Organisms → cellular organisms → Bacteria1651Open in IMG/M
3300012938|Ga0162651_100046737Not Available674Open in IMG/M
3300012958|Ga0164299_10158495All Organisms → cellular organisms → Bacteria1262Open in IMG/M
3300014321|Ga0075353_1077750All Organisms → cellular organisms → Bacteria739Open in IMG/M
3300014861|Ga0180061_1041068Not Available742Open in IMG/M
3300014873|Ga0180066_1005700All Organisms → cellular organisms → Bacteria1973Open in IMG/M
3300014883|Ga0180086_1212502Not Available500Open in IMG/M
3300015259|Ga0180085_1172657Not Available651Open in IMG/M
3300015371|Ga0132258_11463520All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1725Open in IMG/M
3300015371|Ga0132258_11480115All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1715Open in IMG/M
3300015371|Ga0132258_11920634Not Available1490Open in IMG/M
3300015372|Ga0132256_100006980All Organisms → cellular organisms → Bacteria9719Open in IMG/M
3300015372|Ga0132256_100660072All Organisms → cellular organisms → Bacteria1161Open in IMG/M
3300015372|Ga0132256_101940737Not Available696Open in IMG/M
3300017792|Ga0163161_11521563Not Available588Open in IMG/M
3300017930|Ga0187825_10006391All Organisms → cellular organisms → Bacteria3943Open in IMG/M
3300017997|Ga0184610_1014404All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2045Open in IMG/M
3300017997|Ga0184610_1146196Not Available774Open in IMG/M
3300018028|Ga0184608_10007279All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria3654Open in IMG/M
3300018031|Ga0184634_10000116All Organisms → cellular organisms → Bacteria17224Open in IMG/M
3300018052|Ga0184638_1049242All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1533Open in IMG/M
3300018052|Ga0184638_1057649All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1418Open in IMG/M
3300018053|Ga0184626_10020852Not Available2658Open in IMG/M
3300018054|Ga0184621_10036914Not Available1587Open in IMG/M
3300018056|Ga0184623_10044722All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2014Open in IMG/M
3300018063|Ga0184637_10075551All Organisms → cellular organisms → Bacteria2065Open in IMG/M
3300018071|Ga0184618_10003174All Organisms → cellular organisms → Bacteria4326Open in IMG/M
3300018072|Ga0184635_10358144Not Available559Open in IMG/M
3300018073|Ga0184624_10007042All Organisms → cellular organisms → Bacteria3746Open in IMG/M
3300018073|Ga0184624_10133671Not Available1082Open in IMG/M
3300018074|Ga0184640_10093854All Organisms → cellular organisms → Bacteria → PVC group1299Open in IMG/M
3300018074|Ga0184640_10263060Not Available783Open in IMG/M
3300018074|Ga0184640_10311485Not Available714Open in IMG/M
3300018076|Ga0184609_10059675All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1646Open in IMG/M
3300018077|Ga0184633_10004304All Organisms → cellular organisms → Bacteria6479Open in IMG/M
3300018077|Ga0184633_10028469All Organisms → cellular organisms → Bacteria2793Open in IMG/M
3300018077|Ga0184633_10269802Not Available872Open in IMG/M
3300018077|Ga0184633_10613551Not Available512Open in IMG/M
3300018078|Ga0184612_10001140All Organisms → cellular organisms → Bacteria12838Open in IMG/M
3300018079|Ga0184627_10041421All Organisms → cellular organisms → Bacteria2359Open in IMG/M
3300018081|Ga0184625_10008579All Organisms → cellular organisms → Bacteria4666Open in IMG/M
3300018081|Ga0184625_10089849All Organisms → cellular organisms → Bacteria1579Open in IMG/M
3300018082|Ga0184639_10048470Not Available2191Open in IMG/M
3300018082|Ga0184639_10499909Not Available613Open in IMG/M
3300018084|Ga0184629_10026202All Organisms → cellular organisms → Bacteria2476Open in IMG/M
3300018084|Ga0184629_10032636All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2265Open in IMG/M
3300018084|Ga0184629_10105440All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1384Open in IMG/M
3300018422|Ga0190265_10156946All Organisms → cellular organisms → Bacteria → Proteobacteria2234Open in IMG/M
3300018422|Ga0190265_12488200All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria617Open in IMG/M
3300019263|Ga0184647_1120901Not Available685Open in IMG/M
3300019789|Ga0137408_1366524Not Available987Open in IMG/M
3300019879|Ga0193723_1037090All Organisms → cellular organisms → Bacteria1456Open in IMG/M
3300019881|Ga0193707_1001449All Organisms → cellular organisms → Bacteria8637Open in IMG/M
3300019886|Ga0193727_1082333Not Available975Open in IMG/M
3300020003|Ga0193739_1005884Not Available3312Open in IMG/M
3300020018|Ga0193721_1016279Not Available1956Open in IMG/M
3300020063|Ga0180118_1085645Not Available718Open in IMG/M
3300020583|Ga0210401_10927228Not Available730Open in IMG/M
3300021081|Ga0210379_10040757All Organisms → cellular organisms → Bacteria1825Open in IMG/M
3300021090|Ga0210377_10074512All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2306Open in IMG/M
3300021344|Ga0193719_10021284All Organisms → cellular organisms → Bacteria2773Open in IMG/M
3300022756|Ga0222622_10502121All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium867Open in IMG/M
3300022756|Ga0222622_11342154All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300024241|Ga0233392_1006730All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1024Open in IMG/M
3300025324|Ga0209640_10019282All Organisms → cellular organisms → Bacteria5953Open in IMG/M
3300025905|Ga0207685_10740738Not Available538Open in IMG/M
3300025910|Ga0207684_11544583Not Available539Open in IMG/M
3300025917|Ga0207660_11112736All Organisms → cellular organisms → Bacteria643Open in IMG/M
3300025939|Ga0207665_10081831All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2224Open in IMG/M
3300025949|Ga0207667_11164045Not Available752Open in IMG/M
3300026014|Ga0208776_1018202All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium593Open in IMG/M
3300026535|Ga0256867_10011811All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium3817Open in IMG/M
3300027027|Ga0209844_1021757Not Available511Open in IMG/M
3300027364|Ga0209967_1002856All Organisms → cellular organisms → Bacteria2256Open in IMG/M
3300027552|Ga0209982_1031588All Organisms → cellular organisms → Bacteria833Open in IMG/M
3300027573|Ga0208454_1000332All Organisms → cellular organisms → Bacteria30073Open in IMG/M
3300027637|Ga0209818_1037427All Organisms → cellular organisms → Bacteria1131Open in IMG/M
3300027682|Ga0209971_1007651All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2565Open in IMG/M
3300027722|Ga0209819_10003643All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria4886Open in IMG/M
3300027873|Ga0209814_10065845All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1519Open in IMG/M
3300028047|Ga0209526_10084648All Organisms → cellular organisms → Bacteria2233Open in IMG/M
3300028145|Ga0247663_1004663All Organisms → cellular organisms → Bacteria1774Open in IMG/M
3300028380|Ga0268265_11764546Not Available625Open in IMG/M
3300028381|Ga0268264_12072206Not Available578Open in IMG/M
3300028814|Ga0307302_10443087Not Available643Open in IMG/M
3300030006|Ga0299907_10086395All Organisms → cellular organisms → Bacteria2558Open in IMG/M
3300030006|Ga0299907_10498123Not Available964Open in IMG/M
(restricted) 3300031197|Ga0255310_10020127All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1716Open in IMG/M
3300031720|Ga0307469_10790644Not Available869Open in IMG/M
3300031720|Ga0307469_11635966Not Available619Open in IMG/M
3300031720|Ga0307469_12407691Not Available514Open in IMG/M
3300031740|Ga0307468_100662319All Organisms → cellular organisms → Bacteria865Open in IMG/M
3300031965|Ga0326597_10008087All Organisms → cellular organisms → Bacteria14234Open in IMG/M
3300031965|Ga0326597_10019158All Organisms → cellular organisms → Bacteria → Proteobacteria8871Open in IMG/M
3300032770|Ga0335085_11092549All Organisms → cellular organisms → Bacteria → Proteobacteria855Open in IMG/M
3300033417|Ga0214471_10296837All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1315Open in IMG/M
3300033480|Ga0316620_10162162All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1812Open in IMG/M
3300033513|Ga0316628_101036757All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1089Open in IMG/M
3300033513|Ga0316628_101950226Not Available780Open in IMG/M
3300034115|Ga0364945_0002244All Organisms → cellular organisms → Bacteria5319Open in IMG/M
3300034150|Ga0364933_182842Not Available548Open in IMG/M
3300034178|Ga0364934_0063112Not Available1376Open in IMG/M
3300034643|Ga0370545_034861Not Available922Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment17.22%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil9.44%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere9.44%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil7.78%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.56%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.89%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere3.33%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment2.22%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.22%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.22%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.22%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.22%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.22%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand2.22%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.67%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere1.67%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment1.67%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.67%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.67%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere1.67%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment1.11%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.11%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.11%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.11%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.11%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil1.11%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil1.11%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment0.56%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.56%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.56%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.56%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.56%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.56%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.56%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.56%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.56%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.56%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.56%
Sandy SoilEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil0.56%
Deep Subsurface SedimentEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment0.56%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.56%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.56%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.56%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.56%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.56%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2199352025Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOILEnvironmentalOpen in IMG/M
2228664021Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000363Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000787Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300002407Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1EnvironmentalOpen in IMG/M
3300002681Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF120 (Metagenome Metatranscriptome, Counting Only)EnvironmentalOpen in IMG/M
3300004025Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D1EnvironmentalOpen in IMG/M
3300004052Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D2EnvironmentalOpen in IMG/M
3300004137Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF202 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300005168Soil and rhizosphere microbial communities from Laval, Canada - mgLPCEnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005183Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1EnvironmentalOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005295Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3EnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005446Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135EnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005836Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBBEnvironmentalOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300005886Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_205EnvironmentalOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006876Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200EnvironmentalOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300006918Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100EnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009081Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009167Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2)EnvironmentalOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009678Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100EnvironmentalOpen in IMG/M
3300009805Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_0_10EnvironmentalOpen in IMG/M
3300009809Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_30_40EnvironmentalOpen in IMG/M
3300009818Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40EnvironmentalOpen in IMG/M
3300010391Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300011432Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT718_2EnvironmentalOpen in IMG/M
3300011433Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT300_2EnvironmentalOpen in IMG/M
3300011442Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT138_2EnvironmentalOpen in IMG/M
3300012040Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT746_2EnvironmentalOpen in IMG/M
3300012159Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT500_2EnvironmentalOpen in IMG/M
3300012174Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT366_2EnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012228Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT700_2EnvironmentalOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012486Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.120510EnvironmentalOpen in IMG/M
3300012532Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300012938Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t2i015EnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300014321Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D1EnvironmentalOpen in IMG/M
3300014861Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT27_16_10DEnvironmentalOpen in IMG/M
3300014873Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200B_16_10DEnvironmentalOpen in IMG/M
3300014883Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT760_16_10DEnvironmentalOpen in IMG/M
3300015259Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_10DEnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300017930Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5EnvironmentalOpen in IMG/M
3300017997Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coexEnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018031Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1EnvironmentalOpen in IMG/M
3300018052Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2EnvironmentalOpen in IMG/M
3300018053Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1EnvironmentalOpen in IMG/M
3300018054Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1EnvironmentalOpen in IMG/M
3300018056Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1EnvironmentalOpen in IMG/M
3300018063Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2EnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018072Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2EnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300018074Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2EnvironmentalOpen in IMG/M
3300018076Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coexEnvironmentalOpen in IMG/M
3300018077Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1EnvironmentalOpen in IMG/M
3300018078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coexEnvironmentalOpen in IMG/M
3300018079Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1EnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300018082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2EnvironmentalOpen in IMG/M
3300018084Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300019263Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019789Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300019879Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2EnvironmentalOpen in IMG/M
3300019881Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2EnvironmentalOpen in IMG/M
3300019886Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2EnvironmentalOpen in IMG/M
3300020003Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2EnvironmentalOpen in IMG/M
3300020018Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2EnvironmentalOpen in IMG/M
3300020063Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT730_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redoEnvironmentalOpen in IMG/M
3300021090Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redoEnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300024241Subsurface microbial communities from Mancos shale, Colorado, United States - Mancos A_50_July_PBEnvironmentalOpen in IMG/M
3300025324Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026014Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_205 (SPAdes)EnvironmentalOpen in IMG/M
3300026535Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (HiSeq)EnvironmentalOpen in IMG/M
3300027027Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_0_10 (SPAdes)EnvironmentalOpen in IMG/M
3300027364Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes)Host-AssociatedOpen in IMG/M
3300027552Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes)Host-AssociatedOpen in IMG/M
3300027573Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 (SPAdes)EnvironmentalOpen in IMG/M
3300027637Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027682Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes)Host-AssociatedOpen in IMG/M
3300027722Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028145Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK04EnvironmentalOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300030006Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67EnvironmentalOpen in IMG/M
3300031197 (restricted)Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031965Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300033417Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155EnvironmentalOpen in IMG/M
3300033480Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_BEnvironmentalOpen in IMG/M
3300033513Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_CEnvironmentalOpen in IMG/M
3300034115Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17EnvironmentalOpen in IMG/M
3300034150Sediment microbial communities from East River floodplain, Colorado, United States - 25_j17EnvironmentalOpen in IMG/M
3300034178Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17EnvironmentalOpen in IMG/M
3300034643Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_120 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
deepsgr_000526002199352025SoilMLATILIIVMILLQTGALSLGLMAIPRFAAAASLKRKSALLNKRIRERP
ICCgaii200_067510822228664021SoilMLATLLIVVMILLQTGALSLGIMVGRRIITAKASVSRRWFY
ICChiseqgaiiFebDRAFT_1082461023300000363SoilMLATILIVVMILLQTGAFSLGLMFDLRFITAKARLIRKSAH*
JGI11643J11755_1164555023300000787SoilMLATLLIVVMILLQTGALSLGIMVGRRIITAKASVSRRWFY*
C687J29651_1028152513300002407SoilIAVMILLQTGALSLGLMVGRRFITAAASLNRKSALLNKHNRERP*
Ga0005471J37259_10851713300002681Forest SoilRRDMLATILIVVMILLQTGALSLGLMVDRRFITAATSLNRKSAHSTIHNRERP*
Ga0055433_1009859723300004025Natural And Restored WetlandsMLATILIVIMILLQTGALSLGLMVGRRVITAAVGSNRKSAQNNR*
Ga0055490_1006486923300004052Natural And Restored WetlandsVFATILIVVMIFLQTGALSLGVALARRFLTAAAGSKGKSTLLNGVNN
Ga0058883_147076713300004137Forest SoilILLQTGALSLGLVVGPSFITEAARLNRKSALLNKHNRERP*
Ga0062589_10232700613300004156SoilIYMLASILIVFMILLQTGALSFGLMMDRRFITPAAGSKRKSSHSNNP*
Ga0062589_10255319723300004156SoilMLATILIVAMILLQTGALSLSFMIDRRFITAAVSSKRKSSAHSTIHKRER
Ga0063356_10037803913300004463Arabidopsis Thaliana RhizosphereMLATLLIVVMILLQTGALSLGLMVDRRFISAAVSLNRKLTH*
Ga0063356_10062053833300004463Arabidopsis Thaliana RhizosphereMLASILIVFMILLQTGALSFGLMMDRRFITPAAGSKRKSSHSNNP*
Ga0063356_10116024823300004463Arabidopsis Thaliana RhizosphereMLATFLIVVMILLQTGALSLGLMVDRRSIAAAVSLNRKLAAQKK*
Ga0066809_1007005523300005168SoilMLATILIVVMILLQTGALSLGLMVDRRFITAAASLNRKSAHSTIHNRERP*
Ga0066673_1053026813300005175SoilMLATILVVVMILLQTGALSLGLMVDRRFITAAVRLNRKSAH*
Ga0068993_1036087923300005183Natural And Restored WetlandsMLATILIVIMILLQAGVLSLGLMVGRRVITAAAGSNRKSAHKQ*
Ga0065705_1010962343300005294Switchgrass RhizosphereMLATLLIVVMILLQTGALSLGLMVDLRLIVAAVSLNRKLAA*
Ga0065705_1071060513300005294Switchgrass RhizosphereMLATLLIVVMILLQTGALSLGLMVDRRLIVAAMSLNRKLAR*
Ga0065707_1000577733300005295Switchgrass RhizosphereMLATILIVVMILLQTGALSLGLMVDRRFITAAASLNRKSAHSTIHNRERH*
Ga0070708_10092591213300005445Corn, Switchgrass And Miscanthus RhizosphereMLATILIVVMILLQTGALSLGLLVGRRFIAAAVSLNRKSAHSTIHNRE
Ga0066686_1069601423300005446SoilMPATILIVVMILLQTGVLSLGLMVGRRFITEAASVKRKSSLLKKHNRERP*
Ga0070698_10071818123300005471Corn, Switchgrass And Miscanthus RhizosphereMLATILIVVMILLQTGALSLGLMVGRRFITAAASLNRKSAH*
Ga0070698_10202059823300005471Corn, Switchgrass And Miscanthus RhizosphereMRATILIVVMILLQTGVLSLGLMVGRRFITEAASVKRKSSLLKKHNRERP*
Ga0073909_1001259733300005526Surface SoilMLATILIIVMILLQTGALSLGLMAIPRFAAAASLKRKSALLNKRIRERP*
Ga0070697_10012847323300005536Corn, Switchgrass And Miscanthus RhizosphereMLATILIVVMILLQTGVFSLGLMVGRRFITEAARLNRKSALLNKHNRERS*
Ga0070672_10112599213300005543Miscanthus RhizosphereMLATILIIVMILLQTGAFSLGLMAIPRFAAAASLKRKLALLNKRIRERP*
Ga0074470_1127472213300005836Sediment (Intertidal)MRAATLIVVMIFLQTGLLSLGLLLGRRFITVAASFKYKWLI*
Ga0068862_10107761323300005844Switchgrass RhizosphereMLATILIIVMILLQTGALSLGLMAIPRFAAAASLKRKLALLNKRIRERP*
Ga0075286_100622933300005886Rice Paddy SoilMLATILIVFMILLQTGALSLGLMVDRRFITAKARLIRKSAH*
Ga0075417_1005867833300006049Populus RhizosphereMRATILIVVMILLQTGVLSLGLMVGRTFITEAESVKRKSALLNKHNRERP*
Ga0075428_10192142123300006844Populus RhizosphereMLATILIIVMILLQTGAFSLGLMAIPRFAAAASLKRKSALLNKRIRERP*
Ga0075421_10192503913300006845Populus RhizosphereMLAAILIVVMILLQTGVLSLGLMIDRRFITAKTSLARKAALLQKHDRERP*
Ga0075421_10213018513300006845Populus RhizosphereATIFVVMILLQTGALLLSFMIDRRLITAVVRLKCKSAYSTKRKWERP*
Ga0075433_1030079313300006852Populus RhizosphereMLATILIVVMILLQTGVFSLGLMLGRQFITEAVRLNRKSALLNKHNWERP*
Ga0075420_10084807013300006853Populus RhizosphereMLATILIVVMILLQTGALSLGLMVDRRFITAAASLNRKSAHS
Ga0075425_10020017213300006854Populus RhizosphereMLATILIVFMILLQTGALSLGLMMDRRFITPAAGSKRKSSHSTIT*
Ga0079217_1001054643300006876Agricultural SoilLIVVMILLQTGALSLGLMVDRRFIIAKASLTGKSL*
Ga0075426_1002168563300006903Populus RhizosphereMLATILIIVMILLQTGALALGLKVDRRFITAAVSLTRQSA
Ga0075426_1014729213300006903Populus RhizosphereGVLSLGLMVGCRFIAEAASFNRKSALLNKHNRERP*
Ga0075436_10011909423300006914Populus RhizosphereMLATILIIVMILLQTGALALGLKVDRRFITAAVSLTRQSAH*
Ga0075436_10082163123300006914Populus RhizosphereMLAFILIVAMILLQTGVLSLGLMVGRRFIAEAASFNRKSALLNKHNRERP*
Ga0079216_1011505123300006918Agricultural SoilMLATILIVVMILLQTGALSLGLMVDRRFIIAKASLTRKSL*
Ga0079219_1123212323300006954Agricultural SoilMLASILIVFMILLQTGALSFGLMIDRRFITPAAGSKRKSSHSN
Ga0075435_10163772923300007076Populus RhizosphereMLATILIVVMILLQTGVFSLGLMLGRQFITEAVRLNRKSALLNKHNRERP*
Ga0105098_1056664813300009081Freshwater SedimentMLATILIVVMILLQTGALSLGLMVGRRFVTAAASFNRKSALNNT*
Ga0114129_1002875363300009147Populus RhizosphereMRATILIVVMILLQTGALSLGLMVGRRFITEAASLKRKSALLNKHNQERP*
Ga0114129_1035606123300009147Populus RhizosphereMRATILIVVMISLQTGALSLGLIVGRRFITEAASLNRKPAPRNKQRP*
Ga0114129_1143113413300009147Populus RhizosphereATILIVVMILLQTGALSLGLMVGPRFITEAASLNRKSALPNKHNRQRP*
Ga0075423_1308361513300009162Populus RhizosphereMLATILIVFMILLQTGALSLGLMMDRRFITPAAGSK
Ga0113563_1192683713300009167Freshwater WetlandsMLATILIVVMILLQTGVLSLGLMVGHRFITEAAGSNRKSAHSTTHNRERH*
Ga0105249_1099812413300009553Switchgrass RhizosphereMLATILIVAMILLQTGALSLSFMIDRRFITAAVSSKRKSARSTIHKREWR*
Ga0105252_1000041453300009678SoilMLATILIFVMILLQTGALSLGLMIGHGFITAAVGSNRKFTLLNSVYNRERR*
Ga0105252_1004343233300009678SoilMLATILIVVMILLQTGAMQLGLMVGRRFFTAAASSNGRSILLNSVYNRERC*
Ga0105079_104596813300009805Groundwater SandMLATILFAVMILLQTGALSLGLTVGRRFITAAAGSNGKYSRPNSVYHRERH*
Ga0105089_108933123300009809Groundwater SandMLATILIAAMILLQTGALSLGLMVGRRFITAAASLNLKSALLNKHNRE
Ga0105072_105317913300009818Groundwater SandMRATILIVVMILLQTGVLSLGLMVGRRFITEAASLNRKSALLN
Ga0136847_1004690913300010391Freshwater SedimentMLATILIFVMILLQTGALSLGLMVGRRFITAAAGSNRKSTLLNIVYNRERR*
Ga0134122_1301027223300010400Terrestrial SoilMLATFLIVVMILLQTGALSLALMVDRRFMTAAVNRKLAAQ
Ga0150983_1560065713300011120Forest SoilQRRDMLATILIVVMILLQTGALSLGLMVDRRFITAATSLNRKSAHSTIHNRERP*
Ga0137428_100712823300011432SoilMRATLLIVVMILLQTGVLSLGLMVGRRFYSRAASVNRKSALFNKHNPQRR*
Ga0137443_105434913300011433SoilMLATILIVVMILLQTGALSLSLMVDRRFIIAAVSSKRKSVHSTIDNRERP*
Ga0137437_100312453300011442SoilMLATILIFVMILLQTGALSLGLIIGRTIINAVAGSNRKSILLNSVYNRERP*
Ga0137461_100018233300012040SoilMLSTILIVVMILLQTGALSLGLRVRRKFIPAAASLNRKSALLNKRNRDRP*
Ga0137344_102192823300012159SoilMLATILIVVMILLQTGALSFGLMVDRRFIAAAASLNRKSAHSTIHNRERP*
Ga0137338_107778813300012174SoilMLATILIAVMILLQTGALSLGLMVGGRFIIAAASLNRK
Ga0137363_1004736643300012202Vadose Zone SoilMLATILIVVMILLQTGALSLGLMVDRRFITAAASLNRKSAQRP*
Ga0137362_1033416843300012205Vadose Zone SoilLATILIVVMILLQTGALSLGLMVDRRFITARRRA*
Ga0137381_1144551313300012207Vadose Zone SoilATILIVVMILLQTGVLSLGLMVGRRFITEAASVKRKSSLLKKHNRERP*
Ga0137459_124778523300012228SoilMLATILIVVMILLQTGALSLSLMVDRRFIIAAVSSKRKSVHSTIDNRE
Ga0137367_1034457523300012353Vadose Zone SoilMRATILIVVMILLQTGALSLGFMVGRRFITEAASVKRKSALFNKHNRE
Ga0137360_1023358333300012361Vadose Zone SoilMLATILIVVMILLQTGALSLGLMVDRRFITAATSLNRKSAHSTIHNRERP*
Ga0157331_101666613300012486SoilMLATILIIVMILLQTGALSLGLMAIPRFAAAASLKRKSALLNK
Ga0137373_1073134323300012532Vadose Zone SoilMRATILIVVMILLQTGALSLGFMVGRRFINEAASVKRKSALFNKHNRERP*
Ga0137394_1029219243300012922Vadose Zone SoilLVVVMILLQTGALSLGLMVDRRFITAAARLNRKSAH*
Ga0137359_1007967013300012923Vadose Zone SoilMLATILIVAMILLQTGALSLGLMVDRRFITAAARLNRKSAH*
Ga0137359_1068986313300012923Vadose Zone SoilMILLQTGALSLGLMVDRRFITAAASLNRKSAQRP*
Ga0153915_1035423933300012931Freshwater WetlandsMLAIILIVLTILLQTGAWSLGLMADRRLITAAVSLIHKSALLNKHNQERP*
Ga0162651_10004673723300012938SoilMLATILIIVMILLQTGALSLGLMVDRRFITAAASLNRKSALLNRHNRERP*
Ga0164299_1015849513300012958SoilMLATILIIVMILLQTGALSLGLMAIPRFAAAASLKRKSALLNKRIRER
Ga0075353_107775013300014321Natural And Restored WetlandsMLATILIVVMISLQSGALSLGLMVDRRLITAAASLNRKSALLNKHNRARP*
Ga0180061_104106823300014861SoilMRATLLIVVMILLQTGVLSLGLMVGRRFYSRAASVNRKSALFN
Ga0180066_100570033300014873SoilMLATILIAVMILLQTGALSLGLMVGRRFITAAASLNRKSAL
Ga0180086_121250213300014883SoilMLATILVVVMILLQTGALSLGLMVDRRFITSAFSFNRKSTRWREV*
Ga0180085_117265713300015259SoilMLATILIAVMILLQTGALSLGRMVRRRFITAAASLNRKSALLNKHIR
Ga0132258_1146352033300015371Arabidopsis RhizosphereMLATILIIVMILLQTGALSLGLMAGPRFAAAASLKRKSTLLNKAMRERP*
Ga0132258_1148011543300015371Arabidopsis RhizosphereMLATILIAVMIPLQTGVLSLGLMVGRRFITEAARSNRKPAHSTIRNRERP
Ga0132258_1192063433300015371Arabidopsis RhizosphereMLATILIVVMILLQTGALSLSFMIDRRFITAAVSAKRKSARSTIHKREWR*
Ga0132256_100006980143300015372Arabidopsis RhizosphereMLATTLIVVMILLQTGALSLGLMVDRRFITAAASLNRKSAHS
Ga0132256_10066007213300015372Arabidopsis RhizosphereMLATILIIVMILLQTGALSLGLMAIPRFAAAASLKRKSA
Ga0132256_10194073713300015372Arabidopsis RhizosphereSYMLATILIIVMILLQTGALSLGLMAIPRFAAAASLKRKSALLNKRIRERP*
Ga0163161_1152156333300017792Switchgrass RhizosphereMLATILIIVMILLQTGAFSLGLMAIPRFAAAASLKRKLALLNKRIRERP
Ga0187825_1000639133300017930Freshwater SedimentMLAIILIVLTILLQTGAWSLGLMADRRLITAAVSLIHKSALLNKHNQERP
Ga0184610_101440413300017997Groundwater SedimentMLATILIVVMILLQTGALSLGLMVDRRFITAAASLNRKSAHSTIHNRERP
Ga0184610_114619633300017997Groundwater SedimentVLATILIVVMILLQAGALSLGLMIGRRFITAAVSSNRKSAR
Ga0184608_1000727933300018028Groundwater SedimentMLATILIVVMILLQTGALSLGLMVDRRFITAAASLNRKSALLNRHNRERP
Ga0184634_1000011613300018031Groundwater SedimentMLATILIVVMILLQTGALSLGLMVGRRFITAAASLNRKSAH
Ga0184638_104924223300018052Groundwater SedimentMLATILIVVMILLQTGALSFGLMVDRRFIAAAASLNRKSAHSTIHNRERP
Ga0184638_105764933300018052Groundwater SedimentMLAIILIVVMILLQTGALSLGLMVGRRIITAAASLNRKSAH
Ga0184626_1002085233300018053Groundwater SedimentMSLQESDMRATILIIVMILLQAGALSLGLMIGRRFITAAVSSNRKSAH
Ga0184621_1003691423300018054Groundwater SedimentMLATILIVVMILLQTGALSLGLMVDRRLITAAASLNRKSAHST
Ga0184623_1004472223300018056Groundwater SedimentMSLQGSDMLATILIVVMILLQAGALSLGLMIGRRFITAAVSSNRKSAH
Ga0184637_1007555133300018063Groundwater SedimentMLATILILAMILLHTGALSLGLMVGPRFITGAARWNRKSALLNKHNRERP
Ga0184618_1000317463300018071Groundwater SedimentMLATILIVVMILLQTGALSLGLMVDRRFITGAASLKRKSAVLNRHNRERP
Ga0184635_1035814413300018072Groundwater SedimentMLATILIVVMILLQTGALSLGLMVDRRFITAAASLNRKSTHSTIHNRERP
Ga0184624_1000704253300018073Groundwater SedimentMLATILIIVMILLQTGALSLGLMAIPRFAAAASLKRKSALLNKRIRERS
Ga0184624_1013367133300018073Groundwater SedimentMLATVLIVVMILLQTGALSLGLMVDRRFITAAASLNRKSVHSTIHNRERP
Ga0184640_1009385413300018074Groundwater SedimentMLATILIVVMILQQTGALSLGLMVSLRFITAAAGSNRNSTLLNRVYNRERR
Ga0184640_1026306023300018074Groundwater SedimentMLATILIIVMMLLQTGALSLGLMAIPRFAAAASLKRKSPLLNKRIRERP
Ga0184640_1031148513300018074Groundwater SedimentLQTGALSLGLMVGRRFITVAAGSNRKSTVLNSVCNRERR
Ga0184609_1005967533300018076Groundwater SedimentMLATILIVVMILLQTGALSLGLMVDRRFITAAASLKRKSALLNRHNRERP
Ga0184633_1000430433300018077Groundwater SedimentMLATILIAVMILLQTGALSLGLMVGRRFISAAASLNRKSALLNKHNRERP
Ga0184633_1002846913300018077Groundwater SedimentMLATILIVVMILLQTRALSLGLMVGRRFITAAASLNRKSAH
Ga0184633_1026980233300018077Groundwater SedimentMLATILIVVMILLQTGALSLGLMVGLRFIPSAAGSNRKLVLLN
Ga0184633_1061355113300018077Groundwater SedimentMLATILIVVMILLQTGALSLGLMVGRRFITAAATLNRKSAH
Ga0184612_1000114063300018078Groundwater SedimentMRATILIIVMILLQAGALSLGLMIGRRFITAAVSSNRKSAH
Ga0184627_1004142133300018079Groundwater SedimentMLATILIFVMILLQTGALSLSLTVGRRFIAAAAGTNRKSTLLNSVYNREQR
Ga0184625_1000857933300018081Groundwater SedimentMLATILIIVMILLQTGAFSLGLMAIPRFAAAASLKRKSALLNKRIRERP
Ga0184625_1008984933300018081Groundwater SedimentMLATILIVVMILLQTGALSLGLMVDRRFITAAASLNRKSAHSTIHNRERS
Ga0184639_1004847033300018082Groundwater SedimentMLATILIVVMILLQTGALSLGLMVGLRFIPSAAGSNRKLVLLNKHNRELR
Ga0184639_1049990913300018082Groundwater SedimentMLATILIVVMILLQTGALSLGLMVGRRFITAAATLNRKSA
Ga0184629_1002620233300018084Groundwater SedimentMLATILIVVMILLQTGAMQLGLMVGRRFFTAAASSNGRSILLNSVYNRERC
Ga0184629_1003263623300018084Groundwater SedimentMLATILIAVMILLQTGALALGLMVGRRFITAAASLNRKSALLNKANRERP
Ga0184629_1010544023300018084Groundwater SedimentMLATILIVVMILLQTGALSLGLTIGRRFIAAAASLNRKSALLNKHNRGRP
Ga0190265_1015694633300018422SoilMLATILIVVMILLQTGALSLVLMVDRRLITSAVSFNRKSTH
Ga0190265_1248820013300018422SoilMLVTILIVVMILLQTGALSLGLMVDRRFITAALSLNRKSAH
Ga0184647_112090123300019263Groundwater SedimentMLATILIVAMILLQTGALSLSFMIDRRFITAAVSSKRKSARSTIHKREWR
Ga0137408_136652423300019789Vadose Zone SoilMRATILIVVMILLQTGVLSLGLMVGRRFITEAASVKRKSSLLKKHNRERP
Ga0193723_103709033300019879SoilMLATILIIVMILLQTGALSLGLMAAPLFAAAASLKRKSALLNKPMRERP
Ga0193707_100144933300019881SoilMLATILIVAMILLQTGALSLGLMVDRRFITGAVSLNRKSAH
Ga0193727_108233323300019886SoilMLATILIIVMILLKTGALSLGLMAIPRFAAAASLKRKSALLNKRIRERP
Ga0193739_100588423300020003SoilMLATILIVVMILLQTGVLSLGLMVGRRFITAAASLNRKSAH
Ga0193721_101627913300020018SoilTILIVVMILLQTGALSLGLMVDRRFITGAVSLNRKSAH
Ga0180118_108564533300020063Groundwater SedimentILLQTGALSLGLMVGRRFITAAASLNRKSALLNKHNRERP
Ga0210401_1092722823300020583SoilMLATILIVVMILLQTGALSLGLVVGRRFITEAARLNRKSALLNKHNRERP
Ga0210379_1004075723300021081Groundwater SedimentMLATILIFVMILLQTGALSLGLMVGRTFINAVAGSNRKSILLNSVYNRERP
Ga0210377_1007451233300021090Groundwater SedimentMLATILIVVMILLQTGALSLGLMVDRRLITAAVSLNRKSAH
Ga0193719_1002128433300021344SoilLATILVVVMILLQTGALSLGLMVDRRFITAAASLNRKSAH
Ga0222622_1050212113300022756Groundwater SedimentMLATILIVVMILLQTGALSLGLMVDRRFITAAASLNRKSTHSTIHN
Ga0222622_1134215423300022756Groundwater SedimentYACTTVLIVVMILLQTGALSLGLMVDRRFITAAASLNRKSTHSTIHNRERP
Ga0233392_100673013300024241Deep Subsurface SedimentQTGALSLGLMVGRRFITEAVSLNRKSALLNRLNRERP
Ga0209640_1001928263300025324SoilMLATILIVVMILQQTGALSLGLMVGRRFITAVAGSNGKSTLLNSVYNRERRQRRRAR
Ga0207685_1074073823300025905Corn, Switchgrass And Miscanthus RhizosphereMLATILIIVMILLQTGALSLGLMAIPRFAAAASLKRKS
Ga0207684_1154458313300025910Corn, Switchgrass And Miscanthus RhizosphereMLATILIVVMILLQTGALSLGLAVGPRFITEAARLNRKSALLNKHNRERP
Ga0207660_1111273623300025917Corn RhizosphereMLASILIVFMILLQTGALSFGLMMDRRFITPAAGSKRKSSHSNNP
Ga0207665_1008183113300025939Corn, Switchgrass And Miscanthus RhizosphereMLATILIVVMILLQTGVFSLGLMVGRRFITEAARLNRKSALLNKHNRERS
Ga0207667_1116404513300025949Corn RhizosphereMLASILIVFMILLQTGALSFGLMMDRRFITPAAGSKRKSSH
Ga0208776_101820223300026014Rice Paddy SoilMLATILIVFMILLQTGALSLGLMVDRRFITTKARLIRKSAH
Ga0256867_1001181163300026535SoilMLAIILIVAMILLQTGALSLGLMVGRRFITAVVSLNRKSPR
Ga0209844_102175713300027027Groundwater SandMLATILFAVMILLQTGALSLGLTVGRRFITAAAGSNGKYSRPNSVYHRERH
Ga0209967_100285623300027364Arabidopsis Thaliana RhizosphereMLATILIVVMILLQTGAFSLGLMFDLRFITAKARLIRKSAH
Ga0209982_103158823300027552Arabidopsis Thaliana RhizosphereLIVAMILLQTGALSLGLMVDRRFFTAKARLNRKSAH
Ga0208454_100033253300027573SoilMLATILIFVMILLQTGALSLGLMIGHGFITAAVGSNRKFTLLNSVYNRERR
Ga0209818_103742723300027637Agricultural SoilLIVVMILLQTGALSLGLMVDRRFIIAKASLTGKSL
Ga0209971_100765113300027682Arabidopsis Thaliana RhizosphereMLATILIVAMILLQTGALSLGLMVDRRFFTAKARLNRKSAH
Ga0209819_1000364363300027722Freshwater SedimentMLATILIVVMILLQTGALSLGLMVDRRFITAAASLNRKSALNNT
Ga0209814_1006584533300027873Populus RhizosphereMRATILIVVMILLQTGVLSLGLMVGRTFITEAESVKRKSALLNKHNRERP
Ga0209526_1008464833300028047Forest SoilMLATILIVVMILLQTGALSLGLVVGPRFITEAARLNR
Ga0247663_100466323300028145SoilMLVTIMIVAMILLQTGALSLGFLVDRRFFAAAAGTKRKSALSTIGNREQA
Ga0268265_1176454613300028380Switchgrass RhizosphereMLATILIIVMILLQTGALSLGLMAIPRFAAAASLKRKLALLNKRIRERP
Ga0268264_1207220623300028381Switchgrass RhizosphereMLATILIIVMILLQTGAFSLGLMAIPRFAAAASLKRKLALLNK
Ga0307302_1044308713300028814SoilIVVMILLQTGALSLGLMVDRRFITAAASLNRKSAHSTIHNRERP
Ga0299907_1008639533300030006SoilMLATILIVGMILLHTGALSLGLMAGRRLITAAASLSPKQRDNSCL
Ga0299907_1049812313300030006SoilMLAIILIVAMILLQTGALSLGLMIGRRFITAVVSLNRKSPR
(restricted) Ga0255310_1002012733300031197Sandy SoilMLATLLIVVMILLQTGALSLGLMVDRRFIDAATSLIRKLTH
Ga0307469_1079064423300031720Hardwood Forest SoilMLATILIVVMILLQTGVFSLGLAVGPRFITEAARLNRKSALLNKHNRERP
Ga0307469_1163596613300031720Hardwood Forest SoilMLATILIVVMILLQTGVFSLGLMLGRRFITEAVRLNRKSALFNKHSRERP
Ga0307469_1240769113300031720Hardwood Forest SoilVVMILLQTGVLSLGLMVGRRFITEAASVKRKSALLKKHNRERP
Ga0307468_10066231923300031740Hardwood Forest SoilMLATILIVVMILLQTGALSLGLMLGRRFITEAVRLNRKSALFNKHSRERP
Ga0326597_1000808713300031965SoilMLATILITVMILPQTGALSLGLMVGRRFITAAATLNRKSALLNKHIRERP
Ga0326597_1001915813300031965SoilMLATILIAVMILLQTGALSLGLMVGRRFITSAASLNRKSALLNKHNRERL
Ga0335085_1109254913300032770SoilMLATILIVVMILLQTGALSLGLMVGRRFITEAASLKRESALLNKHNPERP
Ga0214471_1029683733300033417SoilMRTTILIAVMILLQTGALSLGLMTGHRLFTAALGWNRKSVH
Ga0316620_1016216213300033480SoilMLAIILIVLTILLQTGAWSLGLMADRRLITAAVSLKHKSALLKKHNQERP
Ga0316628_10103675733300033513SoilQTGAWSLGLMADRRLITAAVSLIHKSALLNKHNQERP
Ga0316628_10195022613300033513SoilMLAIILIVLTILLQTGAWSLGLMADRRLITAAVSLNHKSALLNKHNQERP
Ga0364945_0002244_801_9533300034115SedimentMLATILIVVMILLQTGALSLGLMVDRRFITAAASLNRKSVHSTIHNRERP
Ga0364933_182842_160_3093300034150SedimentMLATILIIVMILLQTGALSLGLMAITRFAAAASLKRKSALLNKRIRERP
Ga0364934_0063112_593_7573300034178SedimentVLATILIVVMILLQTSALSLGLMVGGKFITAAASSNRKSTLLNSVNNQERAKGG
Ga0370545_034861_13_1653300034643SoilMLATSLIVVMILLQTGALSLGLMVDRRFITAAASLNRKSVHSTIHNRERP


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.