Metagenome / Metatranscriptome Family F032136

Overview

Basic Information

• Family ID: F032136
• Family Type: Metagenome / Metatranscriptome
• Number of Sequences: 180
• Average Sequence Length: 44 residues
• Representative Sequence: MYLTSFVTTRIGVELAAVQRKLPDCVVVGLQLYSARTFHVTL
• Number of Associated Samples: 83
• Number of Associated Scaffolds: 180

Quality Assessment

• Transcriptomic Evidence: Yes
• Most common taxonomic group: Unclassified
• % of genes with valid RBS motifs: 92.70 %
• % of genes near scaffold ends (potentially truncated): 97.22 %
• % of genes from short scaffolds (< 2000 bps): 98.33 %
• Associated GOLD sequencing projects: 83
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.46

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Unclassified (69.444 % of family members)
• NCBI Taxonomy ID: N/A
• Taxonomy: N/A

Most Common Ecosystem

• GOLD Ecosystem: Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (73.333 % of family members)
• Environment Ontology (ENVO): Unclassified (91.111 % of family members)
• Earth Microbiome Project Ontology (EMPO): Host-associated → Plant → Plant surface (87.222 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 54.29%
  β-sheet: 0.00%
  Coil/Unstructured: 45.71%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 180 Family Scaffolds
PF04195	Transposase_28	1.11
PF02992	Transposase_21	1.11
PF10551	MULE	0.56
PF14223	Retrotran_gag_2	0.56
PF00665	rve	0.56
PF13456	RVT_3	0.56
PF00078	RVT_1	0.56

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 180 Family Scaffolds
COG2801	Transposase InsO and inactivated derivatives	Mobilome: prophages, transposons [X]	0.56
COG2826	Transposase and inactivated derivatives, IS30 family	Mobilome: prophages, transposons [X]	0.56
COG3316	Transposase (or an inactivated derivative), DDE domain	Mobilome: prophages, transposons [X]	0.56
COG4584	Transposase	Mobilome: prophages, transposons [X]	0.56

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	69.44 %
All Organisms	root	All Organisms	30.56 %

Level 2

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	69.44 %
cellular organisms	root	All Organisms → cellular organisms	30.56 %

Level 3

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	69.44 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	30.56 %

Level 4

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	69.44 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	30.56 %

Level 5

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	69.44 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	30.56 %

Level 6

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	69.44 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	30.56 %

Level 7

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	69.44 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	30.56 %

Level 8

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	69.44 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	30.56 %

Level 9

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	69.44 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	30.56 %

Level 10

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	69.44 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	30.56 %

Level 11

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	69.44 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	30.56 %

Level 12

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	69.44 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	30.00 %

Level 13

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	69.44 %
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	30.00 %

Level 14

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	69.44 %
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	30.00 %

Level 15

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	69.44 %
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	30.00 %

Level 16

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	69.44 %
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	30.00 %

Level 17

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	69.44 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	30.00 %

Level 18

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	69.44 %
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	26.67 %
BOP clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade	0.56 %

Level 19

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	69.44 %
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	26.67 %
Oryzoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae	0.56 %

Level 20

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	69.44 %
Panicodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae	26.11 %
Oryzeae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae	0.56 %
Andropogonodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae	0.56 %

Level 21

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	69.44 %
Paniceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	26.11 %
Andropogoneae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	0.56 %
Oryzinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae	0.56 %

Level 22

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	69.44 %
Panicinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae	25.00 %
Oryza	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	0.56 %
Sorghinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae	0.56 %

Level 23

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	69.44 %
Panicum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	25.00 %
Sorghum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum	0.56 %
Oryza	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	0.56 %

Level 24

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	69.44 %
Panicum sect. Hiantes	section	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes	17.78 %
Panicum miliaceum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	4.44 %
Sorghum bicolor	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	0.56 %
Oryza	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	0.56 %

Level 25

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	69.44 %
Panicum virgatum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	17.78 %
Panicum miliaceum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	4.44 %
Sorghum bicolor	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	0.56 %
Oryza	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	0.56 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300005331|Ga0070670_102172093	Not Available	512
3300009011|Ga0105251_10588974	Not Available	527
3300009092|Ga0105250_10450200	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	578
3300009975|Ga0105129_121879	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	502
3300009980|Ga0105135_112307	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	676
3300009980|Ga0105135_127894	Not Available	523
3300009980|Ga0105135_129573	Not Available	512
3300009981|Ga0105133_118912	Not Available	596
3300009989|Ga0105131_119250	Not Available	662
3300009989|Ga0105131_121877	Not Available	638
3300009989|Ga0105131_142184	Not Available	511
3300009992|Ga0105120_1023678	Not Available	692
3300009994|Ga0105126_1051185	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	524
3300009995|Ga0105139_1042255	Not Available	778
3300009995|Ga0105139_1068007	Not Available	657
3300009995|Ga0105139_1082955	Not Available	606
3300009995|Ga0105139_1104103	Not Available	547
3300010371|Ga0134125_12034924	Not Available	624
3300010371|Ga0134125_12313616	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	584
3300010371|Ga0134125_12630920	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	547
3300010397|Ga0134124_11288469	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	753
3300010397|Ga0134124_11349516	Not Available	737
3300010403|Ga0134123_11479996	Not Available	722
3300012949|Ga0153798_10266891	Not Available	567
3300012949|Ga0153798_10274083	Not Available	554
3300014968|Ga0157379_12488315	Not Available	517
3300015270|Ga0182183_1084448	Not Available	523
3300015273|Ga0182102_1042601	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	518
3300015278|Ga0182099_1018090	Not Available	740
3300015280|Ga0182100_1068289	Not Available	575
3300015284|Ga0182101_1022270	Not Available	818
3300015293|Ga0182103_1037363	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	698
3300015297|Ga0182104_1065597	Not Available	626
3300015297|Ga0182104_1089886	Not Available	561
3300015301|Ga0182184_1025038	Not Available	800
3300015301|Ga0182184_1088242	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	527
3300015301|Ga0182184_1102268	Not Available	500
3300015310|Ga0182162_1063540	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	655
3300015310|Ga0182162_1068707	Not Available	637
3300015311|Ga0182182_1034055	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	781
3300015311|Ga0182182_1084847	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	575
3300015312|Ga0182168_1032992	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	842
3300015312|Ga0182168_1111399	Not Available	546
3300015313|Ga0182164_1047134	Not Available	747
3300015313|Ga0182164_1074701	Not Available	636
3300015313|Ga0182164_1101369	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	567
3300015313|Ga0182164_1120623	Not Available	530
3300015315|Ga0182120_1026031	Not Available	916
3300015315|Ga0182120_1065406	Not Available	672
3300015315|Ga0182120_1098808	Not Available	576
3300015315|Ga0182120_1139945	Not Available	501
3300015316|Ga0182121_1128189	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	531
3300015317|Ga0182136_1072892	Not Available	647
3300015319|Ga0182130_1023546	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	914
3300015319|Ga0182130_1064751	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	662
3300015319|Ga0182130_1090529	Not Available	589
3300015320|Ga0182165_1031485	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	886
3300015320|Ga0182165_1044660	Not Available	787
3300015320|Ga0182165_1049295	Not Available	761
3300015320|Ga0182165_1117712	Not Available	551
3300015320|Ga0182165_1125024	Not Available	538
3300015327|Ga0182114_1002991	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	1813
3300015327|Ga0182114_1038744	Not Available	870
3300015327|Ga0182114_1052345	Not Available	784
3300015327|Ga0182114_1057713	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	756
3300015327|Ga0182114_1074425	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	689
3300015327|Ga0182114_1129151	Not Available	554
3300015328|Ga0182153_1036995	Not Available	843
3300015328|Ga0182153_1071628	Not Available	672
3300015328|Ga0182153_1141252	Not Available	519
3300015329|Ga0182135_1154264	Not Available	503
3300015331|Ga0182131_1147809	Not Available	514
3300015332|Ga0182117_1039459	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	896
3300015332|Ga0182117_1131379	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	563
3300015333|Ga0182147_1073343	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	705
3300015333|Ga0182147_1124488	Not Available	573
3300015334|Ga0182132_1003894	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	1729
3300015334|Ga0182132_1153211	Not Available	525
3300015335|Ga0182116_1013241	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	1299
3300015335|Ga0182116_1116385	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	608
3300015336|Ga0182150_1091487	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	639
3300015336|Ga0182150_1140388	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	540
3300015337|Ga0182151_1088636	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	647
3300015337|Ga0182151_1130688	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	556
3300015337|Ga0182151_1149957	Not Available	525
3300015338|Ga0182137_1054435	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	818
3300015338|Ga0182137_1172046	Not Available	511
3300015339|Ga0182149_1069794	Not Available	727
3300015339|Ga0182149_1106746	Not Available	617
3300015339|Ga0182149_1121232	Not Available	586
3300015339|Ga0182149_1127686	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	573
3300015340|Ga0182133_1105593	Not Available	650
3300015348|Ga0182115_1013790	Not Available	1896
3300015348|Ga0182115_1124487	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	819
3300015348|Ga0182115_1182669	Not Available	672
3300015348|Ga0182115_1243829	Not Available	572
3300015348|Ga0182115_1280092	Not Available	528
3300015348|Ga0182115_1291684	Not Available	515
3300015349|Ga0182185_1001227	Not Available	3227
3300015349|Ga0182185_1027136	Not Available	1365
3300015349|Ga0182185_1170477	Not Available	653
3300015349|Ga0182185_1193083	Not Available	615
3300015349|Ga0182185_1280648	Not Available	509
3300015350|Ga0182163_1148956	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	727
3300015350|Ga0182163_1196428	Not Available	632
3300015350|Ga0182163_1213086	Not Available	605
3300015350|Ga0182163_1253143	Not Available	552
3300015352|Ga0182169_1106753	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	899
3300015352|Ga0182169_1217618	Not Available	623
3300015352|Ga0182169_1238633	Not Available	592
3300015352|Ga0182169_1248958	Not Available	578
3300015353|Ga0182179_1091239	Not Available	900
3300015353|Ga0182179_1116972	Not Available	810
3300015353|Ga0182179_1186362	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	657
3300015353|Ga0182179_1187043	Not Available	656
3300015353|Ga0182179_1192082	Not Available	648
3300015353|Ga0182179_1226855	Not Available	599
3300015353|Ga0182179_1275717	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	545
3300015353|Ga0182179_1280076	Not Available	540
3300015353|Ga0182179_1320493	Not Available	506
3300015354|Ga0182167_1190276	Not Available	752
3300015354|Ga0182167_1197650	Not Available	736
3300015354|Ga0182167_1205095	Not Available	720
3300015354|Ga0182167_1207620	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	715
3300015354|Ga0182167_1229501	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	674
3300015354|Ga0182167_1236071	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	662
3300015354|Ga0182167_1261291	Not Available	622
3300015354|Ga0182167_1271350	Not Available	608
3300015354|Ga0182167_1272462	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	606
3300015354|Ga0182167_1284199	Not Available	590
3300015354|Ga0182167_1300418	Not Available	570
3300015354|Ga0182167_1328847	Not Available	538
3300017408|Ga0182197_1073486	Not Available	662
3300017408|Ga0182197_1123551	Not Available	544
3300017408|Ga0182197_1125469	Not Available	541
3300017412|Ga0182199_1115176	Not Available	631
3300017412|Ga0182199_1186202	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	522
3300017412|Ga0182199_1190228	Not Available	518
3300017414|Ga0182195_1208063	Not Available	516
3300017414|Ga0182195_1222626	Not Available	501
3300017421|Ga0182213_1236880	Not Available	523
3300017432|Ga0182196_1032897	Not Available	852
3300017435|Ga0182194_1070314	Not Available	674
3300017439|Ga0182200_1077628	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	655
3300017440|Ga0182214_1087372	Not Available	655
3300017447|Ga0182215_1091466	Not Available	673
3300017693|Ga0182216_1017755	Not Available	1278
3300017693|Ga0182216_1067542	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	804
3300017693|Ga0182216_1124414	Not Available	637
3300017693|Ga0182216_1155703	Not Available	583
3300017693|Ga0182216_1215010	Not Available	511
3300025923|Ga0207681_11821404	Not Available	508
3300025972|Ga0207668_10704681	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	888
3300025986|Ga0207658_12099383	Not Available	514
3300026075|Ga0207708_10216816	Not Available	1532
3300026088|Ga0207641_12301564	Not Available	538
3300028050|Ga0268328_1015386	Not Available	849
3300028050|Ga0268328_1072873	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	500
3300028053|Ga0268346_1036399	Not Available	538
3300028056|Ga0268330_1057295	Not Available	520
3300028058|Ga0268332_1021740	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	790
3300028058|Ga0268332_1071222	Not Available	523
3300028058|Ga0268332_1078172	Not Available	505
3300028061|Ga0268314_1021816	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	694
3300028061|Ga0268314_1028348	Not Available	635
3300028064|Ga0268340_1085152	Not Available	506
3300028151|Ga0268308_1024342	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	561
3300028248|Ga0268312_1029866	Not Available	546
3300028262|Ga0268310_1051011	Not Available	507
3300028381|Ga0268264_11656487	Not Available	650
3300028470|Ga0268307_1010455	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	657
3300028470|Ga0268307_1014093	Not Available	601
3300028472|Ga0268315_1013684	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	628
3300032465|Ga0214493_1021835	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	1395
3300032689|Ga0214497_1108879	Not Available	596
3300032761|Ga0314733_1104591	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	528
3300033530|Ga0314760_1114940	Not Available	663
3300033539|Ga0314762_1101218	Not Available	533

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	95.00%
Environmental	Environmental	3.89%
Engineered	Engineered	1.11%

Class

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	95.00%
Terrestrial	Environmental → Terrestrial	3.89%
Bioreactor	Engineered → Bioreactor	1.11%

Category

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	82.22%
Unclassified	Host-Associated → Plants → Unclassified	7.78%
Soil	Environmental → Terrestrial → Soil	3.89%
Rhizosphere	Host-Associated → Plants → Rhizosphere	3.89%
Rhizoplane	Host-Associated → Plants → Rhizoplane	1.11%
Unclassified	Engineered → Bioreactor → Unclassified	1.11%

Type

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	82.22%
Unclassified	Host-Associated → Plants → Unclassified → Unclassified	7.78%
Unclassified	Environmental → Terrestrial → Soil → Unclassified	3.33%
Soil	Host-Associated → Plants → Rhizosphere → Soil	2.22%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	1.67%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	1.11%
Unclassified	Engineered → Bioreactor → Unclassified → Unclassified	1.11%
Loam	Environmental → Terrestrial → Soil → Loam	0.56%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	82.22%
Unclassified	Host-Associated → Plants → Unclassified → Unclassified → Unclassified	7.78%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	3.33%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	2.22%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	1.67%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	1.11%
Unclassified	Engineered → Bioreactor → Unclassified → Unclassified → Unclassified	1.11%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	0.56%

Habitat

Habitat	Taxonomy	Distribution
Switchgrass Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere	73.33%
Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere	8.89%
Switchgrass Associated	Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated	7.78%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	3.33%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	2.22%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	1.11%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.11%
Switchgrass Degrading	Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Switchgrass Degrading	1.11%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	0.56%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.56%

Associated Samples

Taxon OID	Sample Name	Habitat Type
3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Host-Associated
3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Host-Associated
3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Host-Associated
3300009975	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_187 metaG	Host-Associated
3300009980	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_219 metaG	Host-Associated
3300009981	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_208 metaG	Host-Associated
3300009989	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_197 metaG	Host-Associated
3300009992	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_108 metaG	Host-Associated
3300009994	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_171 metaG	Host-Associated
3300009995	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_227 metaG	Host-Associated
3300010371	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1	Environmental
3300010397	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4	Environmental
3300010403	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3	Environmental
3300012949	Switchgrass enrichment cultures co-assembly	Engineered
3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Host-Associated
3300015270	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_22AUG2016_LD1 MG	Host-Associated
3300015273	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_09MAY2016_LD1 MG	Host-Associated
3300015278	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015280	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015284	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015293	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MG	Host-Associated
3300015297	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MG	Host-Associated
3300015301	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MG	Host-Associated
3300015310	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015311	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MG	Host-Associated
3300015312	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MG	Host-Associated
3300015313	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015315	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MG	Host-Associated
3300015316	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_31MAY2016_LD1 MG	Host-Associated
3300015317	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_20JUN2016_LD1 MG	Host-Associated
3300015319	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015320	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015327	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015328	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MG	Host-Associated
3300015329	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MG	Host-Associated
3300015331	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015332	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015333	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MG	Host-Associated
3300015334	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015335	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015336	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MG	Host-Associated
3300015337	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MG	Host-Associated
3300015338	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MG	Host-Associated
3300015339	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MG	Host-Associated
3300015340	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015348	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015349	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG	Host-Associated
3300015350	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015352	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG	Host-Associated
3300015353	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015354	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG	Host-Associated
3300017408	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017412	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MG	Host-Associated
3300017414	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017421	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_03OCT2016_LD1 MG	Host-Associated
3300017432	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017435	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017439	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MG	Host-Associated
3300017440	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_03OCT2016_LD1 MG	Host-Associated
3300017447	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_03OCT2016_LD1 MG	Host-Associated
3300017693	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MG	Host-Associated
3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)	Host-Associated
3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)	Host-Associated
3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)	Host-Associated
3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)	Environmental
3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)	Host-Associated
3300028050	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_17JUL2017_LD1	Host-Associated
3300028053	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_28AUG2017_LD1	Host-Associated
3300028056	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_17JUL2017_LD1	Host-Associated
3300028058	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_07AUG2017_LD1	Host-Associated
3300028061	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_05JUN2017_LD1	Host-Associated
3300028064	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_28AUG2017_LD1	Host-Associated
3300028151	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_05JUN2017_LD1	Host-Associated
3300028248	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_05JUN2017_LD1	Host-Associated
3300028262	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_05JUN2017_LD1	Host-Associated
3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)	Host-Associated
3300028470	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_15MAY2017_LD1	Host-Associated
3300028472	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_05JUN2017_LD1	Host-Associated
3300032465	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)	Host-Associated
3300032689	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_12JUL2016_LR2 (Metagenome Metatranscriptome)	Host-Associated
3300032761	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome)	Host-Associated
3300033530	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_28AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated
3300033539	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_28AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0070670_1021720931	3300005331	Switchgrass Rhizosphere	MYLTSFVTTRIGVELAAVQRKLPDCVVVGLQLYSARTFHVTL
Ga0105251_105889741	3300009011	Switchgrass Rhizosphere	MYLISLVTTRIGVELAVVRRKLPDRVVVGLQLCSVRT
Ga0105250_104502001	3300009092	Switchgrass Rhizosphere	MYLASLVTTRIGVELAAVQDNLPDCVVVGLQLYSAKTFHVTPSLWIYKGGQGPPQN
Ga0105129_1218792	3300009975	Switchgrass Associated	MYLTSLVTTQIGVELAAVQRKLPDRDVVGLQLYSAR
Ga0105135_1123071	3300009980	Switchgrass Associated	IGVELATVQRKLPDYIVVGLQIYSARTFHVTLFPRIYKGGQGPPSKHINT*
Ga0105135_1278941	3300009980	Switchgrass Associated	MYHSSLVTTRIGIELAAVQRRLPDCVVVGLQLYSARTFHVTL
Ga0105135_1295732	3300009980	Switchgrass Associated	MYLTSLVTTWIGVELAAVQRKLPDRAVVGLQRYSVW
Ga0105133_1189121	3300009981	Switchgrass Associated	MYLTTFVTTRIGVELAAVQMKLPDCVVVELQLYSARTFHVTLSPRIYK
Ga0105131_1192501	3300009989	Switchgrass Associated	MYLTSFATTRIGVELAAVQKKLHDCVVVRFQLYSARTIHVTLSPRIY
Ga0105131_1218771	3300009989	Switchgrass Associated	MYLTSLVITRIDVELAAVQRKLPDCVVVGLQLYLARTFHVTLSLRIYKGGQGLPPKDINT
Ga0105131_1421841	3300009989	Switchgrass Associated	MYLTSLVTTRIGVELAVVQRKLSDCVVVGLQLYLARTFHVNLSARIYKGGQVLPR
Ga0105120_10236782	3300009992	Switchgrass Associated	MVYRTPLVTTQLGIELAVVQEKLPDCVVVGLQLYSARTFHVTLSPRIY
Ga0105126_10511852	3300009994	Switchgrass Associated	MYLISFVTIRIGVELVAVQRKLPDRAIVGFQLYSAKTFHVN
Ga0105139_10422552	3300009995	Switchgrass Associated	MYLTSLVTTRIGVELATVQRKLPDCVVVGFQLYWARNFHVTLSHRIYKGGQGPPQKNFNT
Ga0105139_10680071	3300009995	Switchgrass Associated	MYLISLVTTRIGVELLGVYRNLPHRIVVGLQLYSARTFHVTLSPRIYK
Ga0105139_10829551	3300009995	Switchgrass Associated	MNLTSLVTTRIGVELAAVQRKLPDCVVIGLQLYWAWTFHVTLSLRIYKGGQGPPRKTSTP
Ga0105139_11041031	3300009995	Switchgrass Associated	MYLISFVTARICIELAIVQRKLPDCVVVGLQMYLSRTFRVTQSPR
Ga0134125_120349241	3300010371	Terrestrial Soil	MYLTSFVTTQIGVELAAVQRKQPARVVIGLKLYSARTFHVTMCPRIYNGEQGPP
Ga0134125_123136162	3300010371	Terrestrial Soil	MYLTSLITTRIGVELAVVQRKLPDCIIVGLQLYSARTFFVTLYHRIYKGGQGPPP
Ga0134125_126309202	3300010371	Terrestrial Soil	MYLTSFVTTRIGVELDAVQRKLPDCIVVGLQLNSARTFH
Ga0134124_112884692	3300010397	Terrestrial Soil	MYLTSFVTIRIGIDLATVQRKLPDYIVVGFQLYWT
Ga0134124_113495162	3300010397	Terrestrial Soil	MYLAYFVTTRIGIELAAVQRKLPDRVVVGLQLYSARTFHLTMFPRIYKGRQGLLQNTSTPKAI
Ga0134123_114799961	3300010403	Terrestrial Soil	MYLTSLVTTRIGVELATVQRKLPDCVVVELQLYSTRTFHITMS
Ga0153798_102668911	3300012949	Switchgrass Degrading	MYLTSFVTIRIGIELAAVQRKLPDCVVVGFQLYSTRTFHVTLSARIYKGRQGPPPKKSSIPN
Ga0153798_102740831	3300012949	Switchgrass Degrading	MYLTSFVTTRIGVELAAIQRKLPDCVVVGFQLYSTRTFHVTLFPQIYKDGQ
Ga0157379_124883151	3300014968	Switchgrass Rhizosphere	MYLTSFVTIQIGIELAAVQMKLPDCVVVGLQLYWARTFYVTLSPRIYKGG
Ga0182183_10844482	3300015270	Switchgrass Phyllosphere	MYLTFLVTTRIGVELAAVQRKLPDCVVVVLQLYSARTFHLTLS
Ga0182102_10426012	3300015273	Switchgrass Phyllosphere	MYLTFVVTTRIGVELAAVQRKLPDCVIVGLQLYSARNFHVTL
Ga0182099_10180902	3300015278	Switchgrass Phyllosphere	MYLTSFVTIRIGIEQAVVQRKLPDCVVVGLHLYPARTFHVVRVPQLYNGGQ
Ga0182100_10682891	3300015280	Switchgrass Phyllosphere	MYLTPFVTTRIGVELAAVQRKLPDHVVVGLQLYSARTFHVTL
Ga0182101_10222702	3300015284	Switchgrass Phyllosphere	MYLTFLVTTRISVELAAIQRKLPDCAVVGHQLYSARTFHVT
Ga0182103_10373631	3300015293	Switchgrass Phyllosphere	MYLTSFVTTRIGVELSAVQRKLPDCVVVGLQLYSARTFHVTLT
Ga0182104_10655971	3300015297	Switchgrass Phyllosphere	MYLTSFVNTRIGVELAAVQKKLHDCVVVEFQLYSARTFHVTLSSRIYKGG
Ga0182104_10898861	3300015297	Switchgrass Phyllosphere	MYLTYFVTTRIGVELAAVQRKLLDCVVVGLQLYSARTFHVNLS
Ga0182184_10250381	3300015301	Switchgrass Phyllosphere	MYLTSFLTTRIGIELVAVQRKLPNCVVVGLQLYSART
Ga0182184_10882421	3300015301	Switchgrass Phyllosphere	MYLTSLVTTRIGIELAAVQRKLPDCVVVGLQLCSARTFYVTLFP
Ga0182184_11022681	3300015301	Switchgrass Phyllosphere	MYLTSFVTTRISVELAVVQRKLPDYVVLGFQLYSARTFLVTLSPRIYKGGGRAGVPSK
Ga0182162_10635401	3300015310	Switchgrass Phyllosphere	MYLTSLVTTRIGIELVAVQRKLPDWVVVGLQLYSARSFHVTLSLRIY
Ga0182162_10687072	3300015310	Switchgrass Phyllosphere	MYPNSPVTTRIGVELAAVQRKLPDCVIVGLQLHSTRAFHVTLSPWIYKGGQG
Ga0182182_10340551	3300015311	Switchgrass Phyllosphere	MYLTSFVTNRIGVKLAAVQGKLSERVVEGLQLYLARTFHVTLSPRIYKGRQ
Ga0182182_10848471	3300015311	Switchgrass Phyllosphere	MYLTSFVNTRIGIELAAVQRKLPDCVVVEFQLYSAKTFH
Ga0182168_10329921	3300015312	Switchgrass Phyllosphere	MYLTSFVTIRIDIELAAGQRKLPDYVVVGLQLYSARTFH
Ga0182168_11113992	3300015312	Switchgrass Phyllosphere	MYLTSSITTRIGVELAAVQRKLPDYIVVGLQLYSTRTFHVTLSLRI
Ga0182164_10471341	3300015313	Switchgrass Phyllosphere	MYLTSLVTTRIGVELAEVQMKLSDCIVVGFQLYLARTFHVTLSPRI
Ga0182164_10747011	3300015313	Switchgrass Phyllosphere	MYLTSFVNTQIGVELAAVQRKLPDYVVVEFQLYSARTLHVTL
Ga0182164_11013691	3300015313	Switchgrass Phyllosphere	MYLTSLVTTRIDVELVVVQRKLPDCIVVGIQLYSARTF
Ga0182164_11206231	3300015313	Switchgrass Phyllosphere	MYLTSLVTTRIGVELAAVQRELPNSVVVGLQLYSAR
Ga0182120_10260311	3300015315	Switchgrass Phyllosphere	MYLTSLVTTRIGIELAAVQKKLPNLVAVGLQLYSARTFH
Ga0182120_10654061	3300015315	Switchgrass Phyllosphere	MYLISFVTIRIGVELAVVQRKLADCVVVGLQLYSARTFHVTLTSQTI*
Ga0182120_10988081	3300015315	Switchgrass Phyllosphere	MYLTSLVTTRIDVELATIQRKLPNCVVVGFQLYLA
Ga0182120_11399452	3300015315	Switchgrass Phyllosphere	MNLTSLVTTRIGVELAAVQRKLPDCVVIGLQLYWAWTF
Ga0182121_11281891	3300015316	Switchgrass Phyllosphere	MYLTSFVTTRIGIELAPVQKKLPNCVVLGLQQYSARIFHVTLSPRIYKGRQAPPPNNHQH
Ga0182121_11443471	3300015316	Switchgrass Phyllosphere	MYLTFLVTTRVGVELAAVQQKLLDCVVVGLQLYSDRIFHVTLSTRIYKGGLGPPPNIINT
Ga0182136_10728921	3300015317	Switchgrass Phyllosphere	MYLTSFAITRTGVELAAVQRKLPDCVVVGLQLYSVRTFHVTLSP
Ga0182130_10235461	3300015319	Switchgrass Phyllosphere	MYLTSFVTTRIGVELATAQRKLPDRVVVGFQLYSARTFHVTMSP
Ga0182130_10647511	3300015319	Switchgrass Phyllosphere	MYLTSFVTTQIGVELAAVQRKLSHCVVVGFPLYSARTFHVTLSPRIYKGGQGPPQNR
Ga0182130_10905291	3300015319	Switchgrass Phyllosphere	MYLTFLVTTRIGVELAAVQRKLPDLVVAGFQLYSARTFHVILS
Ga0182165_10314852	3300015320	Switchgrass Phyllosphere	MYLTSFVTTLIGVVLAVVQRKLPDCIVVGLQLCSARTF
Ga0182165_10446601	3300015320	Switchgrass Phyllosphere	MYLTSSVTTRIGVELAAVQRKLPDCVIIGFQLYSSRTFHVT
Ga0182165_10492951	3300015320	Switchgrass Phyllosphere	MYLTSLVTTRIGVELAAVQRKLPDCFVVGLQLYPARIF
Ga0182165_11177122	3300015320	Switchgrass Phyllosphere	MYLTSPVTTQIGVEIVAVQRKLPDLVVVGLQLYSAR
Ga0182165_11250241	3300015320	Switchgrass Phyllosphere	MYLTTFVTTRLGVELAAIQMELPDCVVVGLQLYSARTF
Ga0182114_10029913	3300015327	Switchgrass Phyllosphere	MYLTSFVTTRIGIELAAVQRKLPDCVVVGLQLYSAWTF
Ga0182114_10387441	3300015327	Switchgrass Phyllosphere	MYLTSLVTTRIDVELAAVQKKLLDLIVVGLQLYSARNF
Ga0182114_10523451	3300015327	Switchgrass Phyllosphere	MYLISFVTTRLGVELVAVQRKLSDCVVVGLQLYSAR
Ga0182114_10577131	3300015327	Switchgrass Phyllosphere	MYLTSFVTTRIDIELAAVQRKLPDCVVVGLQLYSART
Ga0182114_10744252	3300015327	Switchgrass Phyllosphere	MYLTSFVTTRIGVELAAVQRKLPDCVVVGPQLDSARTFHVILSPRRYKDGQ
Ga0182114_11291511	3300015327	Switchgrass Phyllosphere	MYLTSFVTTRICIELAAVQRKLSDYVVVGLQLYSSRTFHVTLSLRIYKGGQGPPPNDHQ
Ga0182153_10369951	3300015328	Switchgrass Phyllosphere	MYLIFFVTIRIGIELAAVQMKLPDCVVVGLQLYWAR
Ga0182153_10716281	3300015328	Switchgrass Phyllosphere	MYLTSVVTTRIGVELAAVQRKLSDRVVVRLQLYSTRTFHVTLSPRIYK
Ga0182153_11412521	3300015328	Switchgrass Phyllosphere	MYLTSLVTPRIGVELAVVQRKIPDCIVVGLQLYSVRTFHVT
Ga0182135_11542641	3300015329	Switchgrass Phyllosphere	MYLTSFVTIRISVEQAVVQRKLPDCVVVGLQLCSASTFHVTLSP
Ga0182131_11478091	3300015331	Switchgrass Phyllosphere	MYLTSLVTTRIGVELAAVQRKLPDLVVAGFQLYSARTFHVILS
Ga0182117_10394591	3300015332	Switchgrass Phyllosphere	MYLIYLVTTRIDVGLAAVQKKLPNCIVVGLQLYLARTFLVTLSP
Ga0182117_11313791	3300015332	Switchgrass Phyllosphere	MYLTSLITTRIGVELTAVRRKLPDRIVVELQLYSARTFH
Ga0182117_11506451	3300015332	Switchgrass Phyllosphere	MYLTSIVTIRIDVELAAIQSKLSDRAIVGLQLYLTRT
Ga0182147_10733431	3300015333	Switchgrass Phyllosphere	MYLTSLVTTRIGLELVAVQKKLPDRVVVGLRLYSARTFH
Ga0182147_11244881	3300015333	Switchgrass Phyllosphere	MYLTSFVTTRIGVGLAAVQRKLPDCVVVGLQLYSARTFHVT
Ga0182132_10038943	3300015334	Switchgrass Phyllosphere	TTQIGVELAAVQRKLPDCVVVGLQLYSAKTFHVTLSPRIYKGGQGTPRNI*
Ga0182132_11532112	3300015334	Switchgrass Phyllosphere	MYFTSFVTTRIGVGLAAVQRKLPDCVVVGFQLYSARTFH
Ga0182116_10132411	3300015335	Switchgrass Phyllosphere	MYLASLVTTRIGVELAAIQRKLPDRDVVGLKLYSARTFH
Ga0182116_11163852	3300015335	Switchgrass Phyllosphere	LYLTFVVTTRIGVELAVSQGKLPDLVGVGLQQCSLGLSM*
Ga0182150_10914872	3300015336	Switchgrass Phyllosphere	MYLISLVTTRIDVELAAVQRKLPDRVVVGPQLYSARTFHVTLFLRIYKGG
Ga0182150_11403882	3300015336	Switchgrass Phyllosphere	MYLTSLVTTQIGVELVAVQGKLPDHVVVRLQLYWARTF
Ga0182151_10886361	3300015337	Switchgrass Phyllosphere	LTSFVTIRIGIELDVVQRKLPDYVVVGFQLYSVRIFHVTLSPRIYKGGQVPPRNT*
Ga0182151_11306882	3300015337	Switchgrass Phyllosphere	MYLTSFVTTRIGIELTAVQMKLSDCVVVGLQLYSARTFHV
Ga0182151_11499571	3300015337	Switchgrass Phyllosphere	MYLTSLVTTRIGVELATVQTKLPDCVVVGFQLYSASTF
Ga0182137_10544352	3300015338	Switchgrass Phyllosphere	MYLTCLVTTQIGVELAAVQRKLPDRVVVGLQLYSA
Ga0182137_11720461	3300015338	Switchgrass Phyllosphere	MYLTSLVNTQIGVELAVVQKRLPDRVVVGLQLYWVR
Ga0182149_10697941	3300015339	Switchgrass Phyllosphere	MYLTCFATIRIGVELASVQENYPTMLVGLQLYWARTFHVTLSLRNI
Ga0182149_11067461	3300015339	Switchgrass Phyllosphere	MYLTSLVTARIGVELAEVQMKLSNCVVVGFQLYLARTFHVTLSPRIYKGRQGPSRNTSTPKAIQ
Ga0182149_11212322	3300015339	Switchgrass Phyllosphere	KLPDRVIVGLQLYSARTFHVTQSPRIYKGGQGSPSKNINT*
Ga0182149_11276861	3300015339	Switchgrass Phyllosphere	MYLTSFVTTRIGVGLAAVQRKLPDCVVVGFQLYSA
Ga0182133_11055931	3300015340	Switchgrass Phyllosphere	MYLISLVTTRICVELAEVQMKLSDCIVVGFQLYLARTFQVTLSPRIYKGR
Ga0182115_10137902	3300015348	Switchgrass Phyllosphere	MYLTSFVTTRIGIELAAVQRKLPDYVVVGLQLYSARTFRVTLS
Ga0182115_11244872	3300015348	Switchgrass Phyllosphere	MYLTSLVTTRIGVELAPVQRKLPDCVVIGLQPYSARTFHVTLSPR
Ga0182115_11826692	3300015348	Switchgrass Phyllosphere	MYLTSFVTARIGIELAAVQRKLPDRAVVGLQLYSA
Ga0182115_12438292	3300015348	Switchgrass Phyllosphere	MYLTTLVTTRIEVELAVVQRKLPDCVVVGLHLYSARTFHVILSPWIYKGG
Ga0182115_12800921	3300015348	Switchgrass Phyllosphere	MYFTSFITTRIGIKLAAVQGKLPECVVEGLQLYSARTFH
Ga0182115_12916841	3300015348	Switchgrass Phyllosphere	MYLTSLVTTQIGVELAVVQRKLPDCVVVGFQLYSAR
Ga0182185_10012276	3300015349	Switchgrass Phyllosphere	MYLTFFVNTQIGVELAAVQRKLPDYVVVEFQLYSAR
Ga0182185_10271362	3300015349	Switchgrass Phyllosphere	MYLTSLVTTRIGVELAAVQRKLPDCVEVGLQLYSARSFYVTL
Ga0182185_11704771	3300015349	Switchgrass Phyllosphere	MYLTSFVTTRIGIELAAVQRKLPDRVVVGLQLYSARTFHVT
Ga0182185_11930831	3300015349	Switchgrass Phyllosphere	MYLTSLVTTRIGVELAAVQRKLPDCIVVGLQLYSARTFHVT
Ga0182185_12806482	3300015349	Switchgrass Phyllosphere	MYLTSFVTTQIGVELAAVQRNLPDRVVVGLQLYSAR
Ga0182163_11489561	3300015350	Switchgrass Phyllosphere	MYLTSFVTIRIGIELTAVLRKLPDYVVVGFQLYSARTFH
Ga0182163_11964281	3300015350	Switchgrass Phyllosphere	MYLTSLVTTRIGVELAAVQRKLTDCVVIGLQPYSARTFHVTLSPR
Ga0182163_12130861	3300015350	Switchgrass Phyllosphere	MYLTSFVTTRIGIELATVQRKLPDCVVVGLQLYSARIFH
Ga0182163_12531431	3300015350	Switchgrass Phyllosphere	MYLISLITTRIGLELAAVQRKLPDRVVVGLQLYSART
Ga0182169_11067531	3300015352	Switchgrass Phyllosphere	MYLTSFVTTRIGIELAAVQRKLSDYVVVELQLYSARTFHVTLSPRIYKGGQ
Ga0182169_12176181	3300015352	Switchgrass Phyllosphere	MYLNSFVTTRIGVELAAVQRKLPDCVVVGLQLYSAR
Ga0182169_12386331	3300015352	Switchgrass Phyllosphere	MHLISFVTTRIGVELAAVQRKLSDYVVVGLQLYSARTFHVTLSARIY
Ga0182169_12489582	3300015352	Switchgrass Phyllosphere	MYLTSFVPTRIGVELAAVQRKLPDYVVVGLQLYSARTFHV
Ga0182179_10912392	3300015353	Switchgrass Phyllosphere	MYLIFLVTTRIGVELVEVRRKLSDRVVVGLQLYSARTFHVTLSPRIYKGGQ
Ga0182179_11169722	3300015353	Switchgrass Phyllosphere	MYLTSFVTTRIGIKLAAVQRKLPDCVVVGLQLYSARTFHV
Ga0182179_11863621	3300015353	Switchgrass Phyllosphere	MYLNSLVTIRIGIELAAVQRKLLDYIVVGLQLNSARTFHVTLSPRIYKG
Ga0182179_11870431	3300015353	Switchgrass Phyllosphere	MESPTQIGVELAAVQRKLPDCTVVGLQLYSARTFHVTLSPR
Ga0182179_11920821	3300015353	Switchgrass Phyllosphere	MYLTSLVTTQIGLELAAVQKKLLDCVVVGLQLYSARTIHVT
Ga0182179_12268551	3300015353	Switchgrass Phyllosphere	MYLTSFVTTRIGVELAAIQRKLPDCVIVGLQLYSARTFHVT
Ga0182179_12757172	3300015353	Switchgrass Phyllosphere	MDVLNPFVTTRIGVVLAAVQRKLPDRVVEGLQLYLASTFHVTPSPRIYK
Ga0182179_12800761	3300015353	Switchgrass Phyllosphere	MYLTPLVTTQIGVELAAVQRKLPGLVVVGLQLYSARSFHVTQSPRI
Ga0182179_13204931	3300015353	Switchgrass Phyllosphere	MYLTSLVTTQIGVELAAVQRKLPDRVVVGLQLYLA
Ga0182167_11902762	3300015354	Switchgrass Phyllosphere	MYLTSFVTTRIGVELAAVQRKLPDRVVVGLQLYSDRAFYVNLFPRIYKGGKGPPPKLINI
Ga0182167_11976501	3300015354	Switchgrass Phyllosphere	MYLTYLVTTRLGVELAAVQRKLPDYIVVGLQLYLARIFRVTLSP
Ga0182167_12050951	3300015354	Switchgrass Phyllosphere	MYLTSFVTTRIGVELAVVHRKLSDSVIVGLQLYSARTFHVTLSL
Ga0182167_12076202	3300015354	Switchgrass Phyllosphere	MYLTSFVTTRIGVELAAVQRKLPDRVVVGLQLYSARTF
Ga0182167_12295011	3300015354	Switchgrass Phyllosphere	MYLTSLVTTRIGVELAAVQRKQPDLVVVGLQLYSARTLHVTLSPRIYKG
Ga0182167_12360712	3300015354	Switchgrass Phyllosphere	MYLTSLVTTRIGVELAVVQRKLPNYVVVGLQLYSARTFHVTLSL
Ga0182167_12612911	3300015354	Switchgrass Phyllosphere	MYLISLIIIRIGVELAAVQRKLPDCVVVGLQLYSA
Ga0182167_12713501	3300015354	Switchgrass Phyllosphere	MYLTSLVTTRIGVKLAVVQRKLPDCVVVGLQLYSA
Ga0182167_12724621	3300015354	Switchgrass Phyllosphere	MYLISFITPRIGVELAAIQRKLSDCVVVVGLQLYSARTFHVTLSPRIYKGRQG
Ga0182167_12841992	3300015354	Switchgrass Phyllosphere	MYLTSFVTTRIGIELAVVQRKLPNCVVVGLQLYSAKTFH
Ga0182167_13004181	3300015354	Switchgrass Phyllosphere	MYLTSFVTTRIDIELAAVRMKLPDCVVVGLQLYSARTFNV
Ga0182167_13288471	3300015354	Switchgrass Phyllosphere	MYLISLVTSRIGVELAAVQRKTIRLYIVGFQLYSAWTFHVTLFPWIYKGGQGPPQNTSTPKAIQITTHDV
Ga0182197_10734861	3300017408	Switchgrass Phyllosphere	MYLTSFVTIRICVELAAVQRKLINCIVVGLQLYLARTFHVTLSLRIYKSGQGPP
Ga0182197_11235511	3300017408	Switchgrass Phyllosphere	MYLISLETTRIGIELAAVRRKLPDHVVVGLQLYSARTFHVTLSLRIYK
Ga0182197_11254691	3300017408	Switchgrass Phyllosphere	MYLTSLVTTRIGVELAAVQRKLPYCVVVGLQLYSARI
Ga0182199_11151761	3300017412	Switchgrass Phyllosphere	MYLTSFVNTQIGVELAAVQRKLPDYVVVEFQLYSARTLHVTLFPRI
Ga0182199_11862022	3300017412	Switchgrass Phyllosphere	MYLTSFVTTRIGVVLAAVQRKLPDRVVEGLQLYLASTFHVTPSPRIYKGGQEPPQNTSTS
Ga0182199_11902281	3300017412	Switchgrass Phyllosphere	MYLTSFVTIRIDTELAVVQRKLLNSVVVGLQLYSARTFHVTLPP
Ga0182195_12080631	3300017414	Switchgrass Phyllosphere	MYLTSLVTTRIGVELTVVQRKLPDCVVVGLQLYSART
Ga0182195_12226261	3300017414	Switchgrass Phyllosphere	MYLTSFLTTRIGIELVAVQRKLPDCVVVGLQLYSARTFHVT
Ga0182213_12368801	3300017421	Switchgrass Phyllosphere	MYLTFLATTRIGVELAAVQRKLPDCIVVGLQLYSARTFHVT
Ga0182196_10328971	3300017432	Switchgrass Phyllosphere	MYLTSFVTIRIGVELAAVQRKLLDCVVVGLQLYTAR
Ga0182194_10703141	3300017435	Switchgrass Phyllosphere	MYLISLVTIQISVELAVVQRKLPDCTIVGLQLYLARTFHVNLSPQIYK
Ga0182200_10776281	3300017439	Switchgrass Phyllosphere	MYLTSFVTTRIGVELAAVQGKLPDCVIVRLQLYSARS
Ga0182214_10873721	3300017440	Switchgrass Phyllosphere	MYLIYFVTTRIGVELAAVQRKLPDCVVVGLQLYSARTFHVNLSPR
Ga0182215_10914661	3300017447	Switchgrass Phyllosphere	MYLTSLVTTRIGVELAEVQMKLSDCVVVGFQLYLARTFHVTL
Ga0182216_10177552	3300017693	Switchgrass Phyllosphere	MYLTSLVTTRIGVRLAAVQRKLSDCVVGGLQLYSARTFHVTLS
Ga0182216_10675422	3300017693	Switchgrass Phyllosphere	MNLTSFVTIRIGIELAVVQRKLPDYVVVGFQLYSVRIFHVTLSPRIYKGGQGPPLNN
Ga0182216_11244141	3300017693	Switchgrass Phyllosphere	MYLISLVTTRIGIELAAVQRKLPDCIVVGLQLYSARTFHVT
Ga0182216_11557031	3300017693	Switchgrass Phyllosphere	FVTTQIGVELAAVQEKLPDWVAVGLQLYSVRIHVTLSPKVYKGG
Ga0182216_12150101	3300017693	Switchgrass Phyllosphere	MYLTSLVTTRIEVELAAVQRKLPDCVVVGLQLYSARTF
Ga0207681_118214041	3300025923	Switchgrass Rhizosphere	MYLTSLVTTRIGVELAAVQRKLPDCVVVGFQLYSARSFHVTL
Ga0207668_107046811	3300025972	Switchgrass Rhizosphere	MYLTSLVTTQIGVELAVVQRKLPVCVVVGLQLCSAR
Ga0207658_120993831	3300025986	Switchgrass Rhizosphere	MYLTSFVTTRISVGLAAVQRKLPDCVVVGFQLYLARTFHITLSPRIYK
Ga0207708_102168161	3300026075	Corn, Switchgrass And Miscanthus Rhizosphere	MYLISFVTSRIGIELAAVQRKLPDCVVVGLQLYSAR
Ga0207641_123015641	3300026088	Switchgrass Rhizosphere	MDVPYLSCKTTRIGVELAAVQRKLPDCIVVELQLYSVRTFHVTMSPQIYKGGQGPPPNN
Ga0268328_10153861	3300028050	Phyllosphere	MMYLISFVTTRIGIELAAVQRKLPDYVAVGLQLYSARTFHVILSPRIYK
Ga0268328_10728731	3300028050	Phyllosphere	MYLTSFVTIRIGVELAAVQRKLPDCVVVGLQLYSARTFQVTLSPR
Ga0268346_10363991	3300028053	Phyllosphere	MYLTSLVTTRIGVELAAVQRKLPDCVVVGLQLYSARTFH
Ga0268330_10572951	3300028056	Phyllosphere	MYLTSFVTTRIGVELAVVQRKLPDCVVVGLQLYSARTF
Ga0268332_10217401	3300028058	Phyllosphere	MYLNSLVTIRIGVELAAVQRKLLDYVVVGLQLNSARTFHVTLSPR
Ga0268332_10712221	3300028058	Phyllosphere	MDVPYLITTRIGVELAAVQRKLPDCVVVGFRLYSARTFHVTRS
Ga0268332_10781721	3300028058	Phyllosphere	MYLTSLVTIRIGVELAAVQRNLLDLVVVRLQLYSAWIFH
Ga0268314_10218161	3300028061	Phyllosphere	MYLTSFVTTRIGVELAAVQSKLPDCVVVEFQLYSART
Ga0268314_10283481	3300028061	Phyllosphere	MYLTSSVTTRIVVELAAVQRKLPDYIIIGFQLYSARTFHVTLSPQ
Ga0268340_10851521	3300028064	Phyllosphere	YLISLVTTRIGVELAAVQQKLPDHVVVELQLYLARTFLVTLSTQTI
Ga0268308_10243422	3300028151	Phyllosphere	MYLTSFVTIRIGVELAAVQRKLPDRVVVGLQLYSARTFH
Ga0268312_10298661	3300028248	Phyllosphere	MYLTSLLTIRIGVELAAVQRNLLDLVVVRLQLYSAWI
Ga0268310_10510111	3300028262	Phyllosphere	MYLTSLVTTRIGVELAAVQRKLPDCIVEGLQLYSARTFQVTLSP
Ga0268264_116564871	3300028381	Switchgrass Rhizosphere	MYLTSFVTTRIGVELAAVQRKLPDRVVVGLQLYSART
Ga0268307_10104552	3300028470	Phyllosphere	MYLTSFVTTQIGIELAAVQRKLPDCVVVGLQLYSARTF
Ga0268307_10140931	3300028470	Phyllosphere	MYLTSLVTTRIGVELAAVQRKLPDRVVVGLQLYLARSSQDPKAFSSQ
Ga0268315_10136841	3300028472	Phyllosphere	MYLASFVTTRIGVELAAVQRKLPDYVVVGLQLYSARTFRVTLSPLIYKD
Ga0214493_10218353	3300032465	Switchgrass Phyllosphere	MYLTSLVTTRIGVELSTVQRKLPDRIVVGLQLYSARTFHV
Ga0214497_11088792	3300032689	Switchgrass Phyllosphere	MYLTSLVTTRIGVELAVVQRKLPDLVVVGLQLYSASTFHVILS
Ga0314733_11045911	3300032761	Switchgrass Phyllosphere	MYLTSFVTIRIGIELATVQRKLPDCVIVGFQLYSAKTFHVTLPPR
Ga0314760_11149401	3300033530	Switchgrass Phyllosphere	VTTRIGVELAAVQTKLSDCVVVEFQLYSARTFHVTLSPRIYKDGQGPPQNINT
Ga0314762_11012181	3300033539	Switchgrass Phyllosphere	MYLTSLVTTRIGVKLAAVQRKLPDCVVVGFQLYSTRTFNVTS