| Basic Information | |
|---|---|
| Family ID | F032074 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 181 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MSLNICIDCNFEKKKCQCVVPTKKISWWRKILNWFR |
| Number of Associated Samples | 125 |
| Number of Associated Scaffolds | 181 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 91.71 % |
| % of genes near scaffold ends (potentially truncated) | 14.92 % |
| % of genes from short scaffolds (< 2000 bps) | 67.96 % |
| Associated GOLD sequencing projects | 112 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.22 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (59.669 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (34.254 % of family members) |
| Environment Ontology (ENVO) | Unclassified (82.320 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (92.265 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 15.62% β-sheet: 0.00% Coil/Unstructured: 84.38% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.22 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 181 Family Scaffolds |
|---|---|---|
| PF00476 | DNA_pol_A | 21.55 |
| PF08291 | Peptidase_M15_3 | 13.81 |
| PF01612 | DNA_pol_A_exo1 | 6.08 |
| PF11753 | DUF3310 | 3.31 |
| PF13361 | UvrD_C | 1.66 |
| PF13640 | 2OG-FeII_Oxy_3 | 1.10 |
| PF00145 | DNA_methylase | 0.55 |
| PF13392 | HNH_3 | 0.55 |
| PF00961 | LAGLIDADG_1 | 0.55 |
| PF13578 | Methyltransf_24 | 0.55 |
| PF00856 | SET | 0.55 |
| PF02945 | Endonuclease_7 | 0.55 |
| PF12705 | PDDEXK_1 | 0.55 |
| COG ID | Name | Functional Category | % Frequency in 181 Family Scaffolds |
|---|---|---|---|
| COG0749 | DNA polymerase I, 3'-5' exonuclease and polymerase domains | Replication, recombination and repair [L] | 21.55 |
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 0.55 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 59.67 % |
| All Organisms | root | All Organisms | 40.33 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 34.25% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 14.36% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 9.39% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 8.29% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 4.42% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 3.87% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 3.31% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 3.31% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 2.76% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 2.76% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 1.10% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 1.10% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.10% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 1.10% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 1.10% |
| Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water | 1.10% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.55% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.55% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 0.55% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 0.55% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.55% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.55% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 0.55% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.55% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.55% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.55% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.55% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.55% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000149 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - August 2009 P16 10m | Environmental | Open in IMG/M |
| 3300001346 | Pelagic Microbial community sample from North Sea - COGITO 998_met_01 | Environmental | Open in IMG/M |
| 3300001355 | Pelagic Microbial community sample from North Sea - COGITO 998_met_08 | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300001718 | Marine viral communities from the Pacific Ocean - LP-48 | Environmental | Open in IMG/M |
| 3300001947 | Marine microbial communities from the Gulf of Maine, Canada - GS002 | Environmental | Open in IMG/M |
| 3300002482 | Marine viral communities from the Pacific Ocean - ETNP_2_30 | Environmental | Open in IMG/M |
| 3300002483 | Marine viral communities from the Pacific Ocean - ETNP_6_30 | Environmental | Open in IMG/M |
| 3300002488 | Marine viral communities from the Pacific Ocean - ETNP_2_60 | Environmental | Open in IMG/M |
| 3300004097 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaG | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006029 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006749 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006867 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006922 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG | Environmental | Open in IMG/M |
| 3300006925 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG | Environmental | Open in IMG/M |
| 3300006928 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG | Environmental | Open in IMG/M |
| 3300006929 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG | Environmental | Open in IMG/M |
| 3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007647 | Estuarine microbial communities from the Columbia River estuary - metaG 1370B-02 | Environmental | Open in IMG/M |
| 3300007725 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_H2O_MG | Environmental | Open in IMG/M |
| 3300007863 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459B_0.2um | Environmental | Open in IMG/M |
| 3300008218 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s6 | Environmental | Open in IMG/M |
| 3300008220 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_908 | Environmental | Open in IMG/M |
| 3300008999 | Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545 | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
| 3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
| 3300009413 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s12 | Environmental | Open in IMG/M |
| 3300009423 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423 | Environmental | Open in IMG/M |
| 3300009433 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 | Environmental | Open in IMG/M |
| 3300009435 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 | Environmental | Open in IMG/M |
| 3300009445 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110331 | Environmental | Open in IMG/M |
| 3300009472 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404 | Environmental | Open in IMG/M |
| 3300009550 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome | Environmental | Open in IMG/M |
| 3300009593 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome | Environmental | Open in IMG/M |
| 3300009605 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_M9 | Environmental | Open in IMG/M |
| 3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
| 3300010430 | Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samples | Environmental | Open in IMG/M |
| 3300011127 | Marine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_5, 0.02 | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300012953 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 Metagenome | Environmental | Open in IMG/M |
| 3300016791 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041412BS metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017706 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaG | Environmental | Open in IMG/M |
| 3300017708 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaG | Environmental | Open in IMG/M |
| 3300017710 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28 | Environmental | Open in IMG/M |
| 3300017714 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 | Environmental | Open in IMG/M |
| 3300017717 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25 | Environmental | Open in IMG/M |
| 3300017721 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_09 viral metaG | Environmental | Open in IMG/M |
| 3300017727 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20 | Environmental | Open in IMG/M |
| 3300017740 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 41 SPOT_SRF_2013-03-13 | Environmental | Open in IMG/M |
| 3300017746 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29 | Environmental | Open in IMG/M |
| 3300017748 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21 | Environmental | Open in IMG/M |
| 3300017750 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 28 SPOT_SRF_2011-11-29 | Environmental | Open in IMG/M |
| 3300017752 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22 | Environmental | Open in IMG/M |
| 3300017755 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09 | Environmental | Open in IMG/M |
| 3300017757 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22 | Environmental | Open in IMG/M |
| 3300017758 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30 | Environmental | Open in IMG/M |
| 3300017765 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28 | Environmental | Open in IMG/M |
| 3300017770 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2) | Environmental | Open in IMG/M |
| 3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
| 3300017783 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10 | Environmental | Open in IMG/M |
| 3300017824 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017967 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018421 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019716 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FRC_0-1_MG | Environmental | Open in IMG/M |
| 3300019738 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLT_0-1_MG | Environmental | Open in IMG/M |
| 3300019765 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW13Sep16_MG | Environmental | Open in IMG/M |
| 3300020266 | Marine microbial communities from Tara Oceans - TARA_E500000178 (ERX556082-ERR598951) | Environmental | Open in IMG/M |
| 3300020349 | Marine microbial communities from Tara Oceans - TARA_E500000081 (ERX289006-ERR315859) | Environmental | Open in IMG/M |
| 3300020352 | Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556084-ERR599144) | Environmental | Open in IMG/M |
| 3300020388 | Marine microbial communities from Tara Oceans - TARA_B100001063 (ERX555965-ERR599064) | Environmental | Open in IMG/M |
| 3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
| 3300020452 | Marine microbial communities from Tara Oceans - TARA_B100001173 (ERX556054-ERR599078) | Environmental | Open in IMG/M |
| 3300020595 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160412_1 | Environmental | Open in IMG/M |
| 3300021356 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245 | Environmental | Open in IMG/M |
| 3300021365 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1 | Environmental | Open in IMG/M |
| 3300021368 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO550 | Environmental | Open in IMG/M |
| 3300021373 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282 | Environmental | Open in IMG/M |
| 3300021379 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO247 | Environmental | Open in IMG/M |
| 3300021389 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127 | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300022066 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28 (v2) | Environmental | Open in IMG/M |
| 3300022072 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3) | Environmental | Open in IMG/M |
| 3300022074 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2) | Environmental | Open in IMG/M |
| 3300022178 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3) | Environmental | Open in IMG/M |
| 3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
| 3300023112 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_2_MG | Environmental | Open in IMG/M |
| 3300024230 | Seawater microbial communities from Monterey Bay, California, United States - 48D | Environmental | Open in IMG/M |
| 3300024529 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_21 | Environmental | Open in IMG/M |
| 3300025048 | Marine viral communities from the Subarctic Pacific Ocean - LP-49 (SPAdes) | Environmental | Open in IMG/M |
| 3300025070 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025083 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025084 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025099 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025102 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025110 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025127 | Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025264 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025577 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423 (SPAdes) | Environmental | Open in IMG/M |
| 3300025632 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 (SPAdes) | Environmental | Open in IMG/M |
| 3300025652 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes) | Environmental | Open in IMG/M |
| 3300025685 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404 (SPAdes) | Environmental | Open in IMG/M |
| 3300025816 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 (SPAdes) | Environmental | Open in IMG/M |
| 3300025892 | Pelagic Microbial community sample from North Sea - COGITO 998_met_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300026125 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_C_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300026183 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300028125 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SB | Environmental | Open in IMG/M |
| 3300029448 | Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082 | Environmental | Open in IMG/M |
| 3300034418 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_100987743 | 3300000101 | Marine | MSLNICMDCNFEKKKCQCVPDIPEPTKVKISWWKRIFFWAR* |
| DelMOSum2010_101000803 | 3300000101 | Marine | MSLNICIDCNFEKKKCQCVSDILKSAKVKISWWKKLIFWR* |
| DelMOSum2010_102208112 | 3300000101 | Marine | MSLNICMDCSFEKKKCQCVPNIPEPVKVKISWWKRIFFWAR* |
| DelMOSum2011_101735762 | 3300000115 | Marine | MSLNICMDCSFEKKKCQCVPNIPEPXKVKISWWKRIFFWAR* |
| DelMOSpr2010_100976772 | 3300000116 | Marine | MSLNICRDCNFEKKKCQCVVAVEPPKVKITWWRKILNWFK* |
| DelMOSpr2010_101767212 | 3300000116 | Marine | MSLNICIDCKFEKKKCQCTAEENKTPEVKMTWWRKIIYYLIG* |
| LPaug09P1610mDRAFT_10348232 | 3300000149 | Marine | MSLNICIDCSFEKKKCQCVAQPTKKISWWRRIFFWAR* |
| JGI20151J14362_100710353 | 3300001346 | Pelagic Marine | MSLNICIDCNFQKKVCQCVVVPPKKISWWKKILNFFK* |
| JGI20151J14362_101154072 | 3300001346 | Pelagic Marine | MSLNICKDCKFEKKKCQCVVEKTKTNWWKRIFFWAR* |
| JGI20151J14362_101259432 | 3300001346 | Pelagic Marine | MSLNICIECKFEKKKCQCVIQPLKKVSWWKKILNWFR* |
| JGI20158J14315_100256872 | 3300001355 | Pelagic Marine | MSLNICMDCNFQKKVCQCVIIPPKKISWWRRILNWFK* |
| JGI24006J15134_101121621 | 3300001450 | Marine | MSLNICMDCNFEKKKCQCVPDISESTKVKISWWKRIFFWAR* |
| JGI24003J15210_100434472 | 3300001460 | Marine | MSLNICIDCSFEKKRCQCVADIPEPIKISWWKKIINWFF* |
| JGI24003J15210_100542063 | 3300001460 | Marine | MSLNICIDCNFEKKKCQCVEELPKVEVKISWWRKIINWFV* |
| JGI24003J15210_100917443 | 3300001460 | Marine | MSLNICIDCSFEKKKCQCFLDTPKPTKISWWKKIINWFF* |
| JGI24523J20078_10198302 | 3300001718 | Marine | MSLNICMDCSFEKKKCQCVPDIPEPIKIKISWWKKLIFWR* |
| GOS2218_10206573 | 3300001947 | Marine | MSLNICMDCSFEKKKCQCVPEPIKTKISWWKRLIFWR* |
| JGI25127J35165_10025856 | 3300002482 | Marine | MSLNICLDCNFEKKKCQCVXEPPKVKMSWWKRIIYFLIG* |
| JGI25132J35274_100021623 | 3300002483 | Marine | MSLNICIDCNFEKKKCQCIVEPPKTKISWWRKIIKFLIG* |
| JGI25128J35275_10026365 | 3300002488 | Marine | MSLNICLDCNFEKKKCQCVIEPPKVKMSWWKRIIYFLIG* |
| Ga0055584_1021493091 | 3300004097 | Pelagic Marine | MSLNICIDCKFEKKKCQCVVAVEPPEVKMTWWRKILNWFK* |
| Ga0075462_100081882 | 3300006027 | Aqueous | MSLNICIDCNFEKKKCQCVVPTKKISWWRKILNWFR* |
| Ga0075466_10207874 | 3300006029 | Aqueous | MSLNICMDCNFQKKFCQCVIKPPKVKISWWKKIIKFLIG* |
| Ga0098038_10095634 | 3300006735 | Marine | MSLNICLDCNFEKKKCQCVVEPPKVKMSWWRKIIYFLVG* |
| Ga0098038_10255118 | 3300006735 | Marine | MSLNICVDCKFEKKKCKCKEKPPTVELKSSWWRRIFFWTR* |
| Ga0098038_10886102 | 3300006735 | Marine | MSLNICIDCKFEKKKCQCVIEPPKVKMSWWRKIIYFLVG* |
| Ga0098038_11155082 | 3300006735 | Marine | MSLNVCIDCHLEKKKCECEISSAKVKISWWRKIIYFLIG* |
| Ga0098038_11736052 | 3300006735 | Marine | MSLNICMDCNFEKKRCQCVIEPPKVKISWWRKIIKFLIG* |
| Ga0098042_10691802 | 3300006749 | Marine | MSLNVCIDCNFEKKKCKCVVEPPKKVSWWRRIFFWTR* |
| Ga0098048_11815342 | 3300006752 | Marine | MSLNICLDCNFEKKKCQCVIEPPKVKISWWKKIIHFLIG* |
| Ga0070749_100991993 | 3300006802 | Aqueous | MSLNICIDCKFEKKKCQCTAEENETPEVKMTWWRKIIYYLIG* |
| Ga0070749_107654543 | 3300006802 | Aqueous | MSLNICMDCKFEKKKCQCVEISKVKISWWQKFINWWAGVND* |
| Ga0075467_100376425 | 3300006803 | Aqueous | MSLNICMDCNFEKKKCQCIVEKIIVKISWWKRILNWFR* |
| Ga0075476_101295563 | 3300006867 | Aqueous | MSLNICIDCKFEKKKCQCTAKENKTPEVKMTWWRKIIYYLIG* |
| Ga0070746_104734861 | 3300006919 | Aqueous | KMSLNICTDCNFEKKKCQCVPDIPEPTKVKISWWKRIFFWAR* |
| Ga0098045_10352081 | 3300006922 | Marine | MSLNICVDCSFEKKKCQCVAQPTKKISWWRRIFFW |
| Ga0098050_11614802 | 3300006925 | Marine | MSLNICMNCKFEKKKCQCVEISEVKISWWQKFINWWAGIYD* |
| Ga0098041_10179424 | 3300006928 | Marine | MSLNICVDCSFEKKKCQCVAQPTKKISWWRRIFFWTR* |
| Ga0098041_11303852 | 3300006928 | Marine | MSLNICLDCNFEKKKCQCVVEPPKVKMSWWRKIIYFFIG* |
| Ga0098041_12856181 | 3300006928 | Marine | MSLNICVDCSFEKKKCQCVAQPTKKISWWRRIFFWAR* |
| Ga0098036_12208012 | 3300006929 | Marine | MSLNICLDCNFEKKKCQCVVEPPKVKMSWWRRIIYFLIG* |
| Ga0098036_12601191 | 3300006929 | Marine | MSLNVCVDCNFEKKKCQCVVEPPKKVSWWRRIFFWTR* |
| Ga0070753_12924362 | 3300007346 | Aqueous | MSLNICMDCKFEKKKCQCVEISKVKISWWQKFINWWAGIND* |
| Ga0099849_10298872 | 3300007539 | Aqueous | MSLNICVDCNFEKKKCQCIVEKIIVKISWWKRILNWFR* |
| Ga0102855_11015881 | 3300007647 | Estuarine | MSLNICIDCSFEKKKCQCVAQPTKKISWWRRIFFWA |
| Ga0102951_11589193 | 3300007725 | Water | MSLNICMDCKFEKKKCQCVEISKVKISWWKKFINWWAGI* |
| Ga0105744_11896931 | 3300007863 | Estuary Water | MSLNICIDCNFEKKKCECEVKPIKKVSWWRRIFFW |
| Ga0114904_10136364 | 3300008218 | Deep Ocean | MSLNICIDCNFEKKRCQCVEELPKVEVKISWWRKIINWFV* |
| Ga0114910_10126683 | 3300008220 | Deep Ocean | MSLNICMDCNFEKKKCQCIVEKIIVKISWWKKILNWFR* |
| Ga0102816_10967991 | 3300008999 | Estuarine | MSLNICMDCKFEKKKCQCVVEPVKVKLSWWKRIFFWAR* |
| Ga0102963_12308433 | 3300009001 | Pond Water | MSLNICMNCKFEKKKCQCVEISKVKISWWKKFINWWAGI* |
| Ga0115566_107052911 | 3300009071 | Pelagic Marine | MSLNICIECKFEKKKCQCVIQPPKKVSWWKKILNWFR* |
| Ga0115566_108483341 | 3300009071 | Pelagic Marine | EKMSLNICIDCNFQKKVCQCVVVPPKKISWWKKILNFFK* |
| Ga0114918_102283132 | 3300009149 | Deep Subsurface | MSLNICMDCKFEKKKCQCVEISEIKISWWQKFINWWAGIND* |
| Ga0114902_10614202 | 3300009413 | Deep Ocean | MSLNICMDCSFEKKRCQCVPDIPKPTKVKVSWWKKIINWFF* |
| Ga0115548_10999372 | 3300009423 | Pelagic Marine | MSLNICIDCKFEKKKCQCVIQPPKKVSWWKKIFFWNK* |
| Ga0115545_12452581 | 3300009433 | Pelagic Marine | GEKMSLNICMDCKFEKKKCQCVEISKVKISWWKKFINWWAGI* |
| Ga0115546_10189013 | 3300009435 | Pelagic Marine | MSLNICKDCKFEKKKCQCKVKPVVVKLNWWRRIFFWTR* |
| Ga0115546_10660022 | 3300009435 | Pelagic Marine | MSLNICMDCKFEKKKCQCVEISKVKISWWQKFINWWAGI* |
| Ga0115546_10857322 | 3300009435 | Pelagic Marine | MSLNICIECKFEKKKCQCVTQPTKKVSWWRRIFFWTR* |
| Ga0115553_12739432 | 3300009445 | Pelagic Marine | MSLNICIDCKFEKKKCQCVIQPPKKVSWWKKILNWFR* |
| Ga0115554_13888562 | 3300009472 | Pelagic Marine | MSLNICIECKFEKKKCQCVIQPPKKVSWWKKIFFW |
| Ga0115013_112636811 | 3300009550 | Marine | MSLNICMDCNFEKKRCQCVIELPKVKISWWKKIIKFL |
| Ga0115011_103162742 | 3300009593 | Marine | MSLNICMDCNFEKKRCQCVIEPPEKISWWRKIIKFLIG* |
| Ga0114906_12052271 | 3300009605 | Deep Ocean | NICMDCSFEKKRCQCVPDIPKPTKVKVSWWKKIINWFF* |
| Ga0129351_10464476 | 3300010300 | Freshwater To Marine Saline Gradient | MSLNICIDCKFEKKKCQCTAEENKTPEVKMTWWKKIIYYLIG* |
| Ga0118733_1020047544 | 3300010430 | Marine Sediment | MSLNICMDCKFEKKKCQCVEISKVKISWWQKFINWWADIND* |
| Ga0151665_10056642 | 3300011127 | Marine | MSLNICKDCKFEKKKCQCVVEKTKTHEVKISWWKRIFFWTR* |
| Ga0160423_106774272 | 3300012920 | Surface Seawater | MSLNICIDCKFEKKRCQCVIEPPKVKMSWWRKIIYFLVG* |
| Ga0163179_100040684 | 3300012953 | Seawater | MSLNICINCNFEKKKCQCIVEEIIVKISWWKKILNWFR* |
| Ga0182095_14457682 | 3300016791 | Salt Marsh | EKMSLNICIDCNFEKKKCQCVVPTKKISWWRKILNWFK |
| Ga0181377_10109522 | 3300017706 | Marine | MSLNICVDCNFEKKKCECVIQPPKKVSWWRRIFFWTR |
| Ga0181377_10265773 | 3300017706 | Marine | MSLNICMDCNFEKKKCQCVVEKIIVKISWWKKILNWFR |
| Ga0181369_10250094 | 3300017708 | Marine | MSLNICLDCNFEKKRCQCVVEPPKVKMSWWRKIIYFLVG |
| Ga0181403_10077582 | 3300017710 | Seawater | MSLNICIDCSFEKKKCQCVAQPTKKISWWRRIFFWAR |
| Ga0181403_10507132 | 3300017710 | Seawater | MSLNVCIDCKFEKKKCKCEEKPAVVKSSWWKRIFFWTR |
| Ga0181412_11462561 | 3300017714 | Seawater | MSLNICIDCNFEKKKCQCVVPPKKVSWWRRIFFWT |
| Ga0181404_10781352 | 3300017717 | Seawater | MSLNICADCKFEKKKCKCEVKPVVIKSSWWRRIFFWTR |
| Ga0181404_11383741 | 3300017717 | Seawater | MSLNICMNCKFEKKKCQCVEISEVKISWWQKFINWWAGIYD |
| Ga0181373_10173002 | 3300017721 | Marine | MSLNICIDCNFEKKKCKCEAKPAVVKSSWWRRIFFWTR |
| Ga0181373_10993401 | 3300017721 | Marine | MSLNVCIDCHLEKKKCECEISSAKVKISWWRKIIYFL |
| Ga0181401_10009073 | 3300017727 | Seawater | MSLNICKDCNFEKKKCQCVVAVEPPKVKMTWWRKIIYYLIG |
| Ga0181401_10567381 | 3300017727 | Seawater | GEKMSLNVCIDCKFEKKKCKCEEKPAVVKSSWWKRIFFWTR |
| Ga0181401_10867324 | 3300017727 | Seawater | MSLNICMDCKFEKKKCQCVEISEVKISWWQKFINWWAGIYD |
| Ga0181401_11270971 | 3300017727 | Seawater | NICIDCSFEKKKCQCFLDTPKPTKISWWKKIINWFF |
| Ga0181418_10508622 | 3300017740 | Seawater | MSLNICMDCSFEKKKCQCVPDIPKPAKVKLSWWKRIFFWAR |
| Ga0181389_10739321 | 3300017746 | Seawater | KMSLNICMDCSFEKKKCQCVAQPTKKISWWRRIFFWAR |
| Ga0181393_10135712 | 3300017748 | Seawater | MSLNICVDCKFEKKKCKCKVKPIVIKSSWWRRIFFWTR |
| Ga0181393_11731101 | 3300017748 | Seawater | MSLNICMDCSFEKKKCQCVAQPTKKISWWRRIFFWA |
| Ga0181405_11800951 | 3300017750 | Seawater | SLNICIDCSFEKKKCQCVAQPTKKISWWRRIFFWAR |
| Ga0181400_10126681 | 3300017752 | Seawater | MVLNICVDCKFEKKKCKCKVKPIVIKSSWWRRIFFWTR |
| Ga0181411_10408693 | 3300017755 | Seawater | MSLNICMDCSFEKKRCQCTVDIPKPAKVKISWWKRIFFWAR |
| Ga0181420_12157612 | 3300017757 | Seawater | MSLNICIDCSFEKKKCQCVPDIPEPAKVKLSWWKRIFFWAR |
| Ga0181409_10029232 | 3300017758 | Seawater | MSLNICIDCNFEKKKCQCVVPPKKVSWWRRIFFWTR |
| Ga0181413_10581822 | 3300017765 | Seawater | MSLNICMDCNFEKKRCQCVIEPPKVKISWWRKIIKFLIG |
| Ga0187217_12199242 | 3300017770 | Seawater | SLNICIDCSFEKKKCQCVPDIPEPSKVKISWWKRIFFWAR |
| Ga0181380_10038172 | 3300017782 | Seawater | MSLNICMDCSFEKKKCQCVPNIPKPVKVKISWWKRIFFWAR |
| Ga0181379_11110322 | 3300017783 | Seawater | MSLNICMDCNFEKKRCQCVIEPPKVKISWWRKIIKLLIG |
| Ga0181552_100902833 | 3300017824 | Salt Marsh | MSLNICRDCNFEKKKCQCVVAVEPPKVKITWWRKILNWFK |
| Ga0181590_101012813 | 3300017967 | Salt Marsh | MSLNICIDCNFEKKKCQCVVPTKKISWWRKILNWFK |
| Ga0181553_100867123 | 3300018416 | Salt Marsh | MSLNICIDCKFEKKKCQCTAEENKTPEVKMTWWRKIIYYLIG |
| Ga0181592_106576663 | 3300018421 | Salt Marsh | MSLNICMDCKFEKKKCQCVEISKVKISWWQKFINWWAGVND |
| Ga0193984_10112183 | 3300019716 | Sediment | MSLNICIDCKFEKKKCQCTAEENETPEVKMTWWRKIIYYLIG |
| Ga0193994_10247812 | 3300019738 | Sediment | MSLNICRDCNFEKKKCQCTAEENKTPEVKMTWWKKIIYYLIG |
| Ga0194024_10887112 | 3300019765 | Freshwater | MSLNICIDCNFEKKKCQCVVPTKKISWWRKILNWF |
| Ga0211519_10219662 | 3300020266 | Marine | MSLNICIDCKFEKKKCQCVVAVEPPEVKMTWWRKILNWFK |
| Ga0211511_10196673 | 3300020349 | Marine | MSLNICMDCNFEKKKCQCVVEEIIVKISWWKRILNWFK |
| Ga0211505_10185453 | 3300020352 | Marine | MSLNICMDCSFEKKKCQCTVDIPKPAKVKISWWKRIFFWAR |
| Ga0211678_100474054 | 3300020388 | Marine | MSLNICIDCSFEKKKCQCVAQPTKKVSWWRRIFFWAR |
| Ga0211678_101671763 | 3300020388 | Marine | MSLNVCVDCKFEKKKCKCTAKPIVVKSSWWRRIFFWT |
| Ga0211576_100179141 | 3300020438 | Marine | MSLNLCKVCNLAKKNCECVVETFKKISWWRRIFFWNR |
| Ga0211545_100191776 | 3300020452 | Marine | MSLNICINCNFEKKKCQCIVEEIIVKISWWKKILNWFR |
| Ga0206126_100606414 | 3300020595 | Seawater | MSLNICKDCKFEKKKCQCVVEKTKTNWWKRIFFWAR |
| Ga0213858_100191575 | 3300021356 | Seawater | MSLNICKNCKFEKKKCQCKSEPIKISWWKKIIRFLIG |
| Ga0206123_103637512 | 3300021365 | Seawater | MSLNICIECKFEKKKCQCVIQPPKKVSWWKKILNWFR |
| Ga0213860_100186856 | 3300021368 | Seawater | MSLNICIDCKFEKKKCQCTAKENKTPKVKMTWWRKIIYYLIG |
| Ga0213860_100692892 | 3300021368 | Seawater | MSLNICIDCNFEKKKCQCIAEPPKTKISWWRRILNWFK |
| Ga0213865_1000293720 | 3300021373 | Seawater | MSLNICIDCKFEKKKCQCTAKENKTPEVKMTWWRKIIYYLIG |
| Ga0213864_101874832 | 3300021379 | Seawater | MSLNICKDCKFEKKKCQCKSEPIKISWWKKIIRFLIG |
| Ga0213868_100415834 | 3300021389 | Seawater | MSLNICIDCNFEKKKCQCVVPTKKISWWRKILNWFR |
| Ga0222718_101284851 | 3300021958 | Estuarine Water | MSLNICMDCKFEKKKCQCVEISEIKISWWQKFINWWAGIND |
| Ga0224902_1029932 | 3300022066 | Seawater | MSLNICMDCKFEKKKCQCVVEPVKVKLSWWKRIFFWNR |
| Ga0196889_10078122 | 3300022072 | Aqueous | MSLNICMDCNFEKKKCQCIVEKIIVKISWWKRILNWFR |
| Ga0224906_10153602 | 3300022074 | Seawater | MSLNICLDCNFEKKKCQCVIEPPKVKMSWWKRIIYFLIG |
| Ga0224906_10426082 | 3300022074 | Seawater | MSLNICLDCNFEKKKCKCKVKPVEVKSSWWRRIFFWTR |
| Ga0196887_10269643 | 3300022178 | Aqueous | MSLNICIDCNFEKKKCQCVSDILKSAKVKISWWKKLIFWR |
| Ga0196899_10465603 | 3300022187 | Aqueous | MSLNICMDCNFEKKKCQCVPDIPEPTKVKISWWKRIFFWAR |
| (restricted) Ga0233411_101100133 | 3300023112 | Seawater | MSLNICKDCKFEKKKCQCVVAVEPPKVEMSWWRKIIYFLIG |
| Ga0228638_10598443 | 3300024230 | Seawater | MSLNICRDCNFEKKKCQCVAAVEPPKVKITWWRKIIYYLIG |
| (restricted) Ga0255044_102852833 | 3300024529 | Seawater | MSLNICKDCNFENKKCQCVVAVEPPKVEMSWWRKIIYFLIG |
| Ga0207905_10098222 | 3300025048 | Marine | MSLNICMDCSFEKKKCQCVPDIPEPIKIKISWWKKLIFWR |
| Ga0207905_10130283 | 3300025048 | Marine | MSLNICMDCSFEKKKCQCVPNIPEPVKVKISWWKRIFFWAR |
| Ga0208667_10110002 | 3300025070 | Marine | MSLNICVDCSFEKKKCQCVAQPTKKISWWRRIFFWAR |
| Ga0208667_10141863 | 3300025070 | Marine | MSLNVCIDCHLEKKKCECEISSAKVKISWWRKIIYFLIG |
| Ga0208667_10144682 | 3300025070 | Marine | MSLNICIDCNFEKKKCECKVKPIKKVSWWRRIFFWTR |
| Ga0208791_10092973 | 3300025083 | Marine | MSLNVCVDCKFEKKKCKCTAKPIVVKSSWWRRIFFWTR |
| Ga0208298_10081472 | 3300025084 | Marine | MSLNICLDCNFEKKKCQCVIEPPKVKISWWKKIIHFLIG |
| Ga0208157_100352116 | 3300025086 | Marine | MSLNICIDCKFEKKKCQCVIEPPKVKMSWWRKIIYFLVG |
| Ga0208157_10041376 | 3300025086 | Marine | MSLNVCVDCNFEKKKCQCVVPPKKVSWWRRIFFWTR |
| Ga0208157_10217532 | 3300025086 | Marine | MSLNICLDCNFEKKKCQCVVEPPKVKMSWWRKIIYFLVG |
| Ga0208157_10471462 | 3300025086 | Marine | MSLNVCVDCKFEKKKCQCVVVPPKKVSWWRRIFFWTR |
| Ga0208669_100031419 | 3300025099 | Marine | MSLNICVDCSFEKKKCQCVTQPTKKISWWRRIFFWAR |
| Ga0208669_10379971 | 3300025099 | Marine | GEKMSLNVCVDCKFEKKKCKCIAKPIVVKSSWWKRIFFWTR |
| Ga0208666_10130512 | 3300025102 | Marine | MSLNVCIDCNFEKKKCKCVVQPPKKVSWWRRIFFWTR |
| Ga0208666_10230156 | 3300025102 | Marine | MSLNICVDCKFEKKKCKCKEKPPTVELKSSWWRRIFFWTR |
| Ga0208158_10025523 | 3300025110 | Marine | MSLNICVDCSFEKKKCQCVAQPTKKISWWRRIFFWTR |
| Ga0208158_100610910 | 3300025110 | Marine | MSLNVCIDCNFEKKKCKCVVEPPKKVSWWRRIFFWTR |
| Ga0208158_10439471 | 3300025110 | Marine | SLNICVDCKFEKKKCKCKEKPPTVELKSSWWRRIFFWTR |
| Ga0208158_11545672 | 3300025110 | Marine | MSLNICLDCNFEKKKCQCVVEPPKVKMSWWRKIIYFFIG |
| Ga0209535_10026995 | 3300025120 | Marine | MSLNICMDCNFNKKKCQCVVEKIIVKISWWKKILNWFR |
| Ga0209535_10070913 | 3300025120 | Marine | MSLNICIDCSFEKKRCQCVADIPEPIKISWWKKIINWFF |
| Ga0209535_10327768 | 3300025120 | Marine | MSLNICIDCNFEKKKCECEVKPIKKVSWWRRIFFWTR |
| Ga0209535_10352723 | 3300025120 | Marine | MSLNICMDCSFEKKKCQCVAQPTKKISWWRRIFFWAR |
| Ga0209535_10439063 | 3300025120 | Marine | MSLNICIDCNFEKKKCQCVEELPKVEVKISWWRKIINWFV |
| Ga0209535_10620576 | 3300025120 | Marine | MSLNICMDCNFEKKKCQCVPDISESTKVKISWWKRIFFWAR |
| Ga0209535_10804812 | 3300025120 | Marine | MSLNICIDCSFEKKKCQCVPDIPEPSKVKISWWKRIFFWAR |
| Ga0209535_10996912 | 3300025120 | Marine | MSLNICIDCSFEKKKCQCFLDTPKPTKISWWKKIINWFF |
| Ga0209535_11336512 | 3300025120 | Marine | MSLNICMDCSFEKKKCQCVPDIPKPAKVKISWWKRIFFWAR |
| Ga0209348_10172733 | 3300025127 | Marine | MSLNICLDCNFEKKKCQCVVEPPKVKMSWWKRIIYFLIG |
| Ga0209634_10162785 | 3300025138 | Marine | MSLNICIDCSFEKRKCQCVLDTPKPTKISWWKRIFFWAR |
| Ga0209634_10177621 | 3300025138 | Marine | MSLNICMDCNFEKKKCQCVFDISESTKVKISWWKRIFFWAR |
| Ga0209634_11632883 | 3300025138 | Marine | SLNICIDCSFEKKRCQCVADIPEPIKISWWKKIINWFF |
| Ga0209645_100307924 | 3300025151 | Marine | MSLNICIDCNFEKKKCQCIVEPPKTKISWWRKIIKFLIG |
| Ga0208029_10145873 | 3300025264 | Deep Ocean | MSLNICIDCNFEKKRCQCVEELPKVEVKISWWRKIINWFV |
| Ga0209304_10101092 | 3300025577 | Pelagic Marine | MSLNICIDCKFEKKKCQCVIQPPKKVSWWKKIFFWNK |
| Ga0209194_10066638 | 3300025632 | Pelagic Marine | MSLNICIECKFEKKKCQCVTQPTKKVSWWRRIFFWTR |
| Ga0209194_10094064 | 3300025632 | Pelagic Marine | MSLNICKDCKFEKKKCQCKVKPVVVKLNWWRRIFFWTR |
| Ga0209194_11269171 | 3300025632 | Pelagic Marine | MSLNICMDCKFEKKKCQCVEISKVKISWWQKFINWWAGIND |
| Ga0208134_10235403 | 3300025652 | Aqueous | MSLNICVDCNFEKKKCQCIVEKIIVKISWWKRILNWFR |
| Ga0208134_10314152 | 3300025652 | Aqueous | MSLNICMDCNFQKKFCQCVIKPPKVKISWWKKIIKFLIG |
| Ga0209095_10176293 | 3300025685 | Pelagic Marine | MSLNICMDCNFQKKVCQCVIIPPKKISWWRRILNWFK |
| Ga0209095_10388524 | 3300025685 | Pelagic Marine | MSLNICIECKFEKKKCQCVIQPPKKVSWWRKIFFWNK |
| Ga0209193_10121083 | 3300025816 | Pelagic Marine | MSLNICIDCNFQKKVCQCVVVPPKKISWWKKILNFFK |
| Ga0209193_11470423 | 3300025816 | Pelagic Marine | MSLNICMDCKFEKKKCQCVEISKVKISWWKKFINWWAGI |
| Ga0209630_101566882 | 3300025892 | Pelagic Marine | MSLNICIECKFEKKKCQCVIQPLKKVSWWKKILNWFR |
| Ga0209962_10809623 | 3300026125 | Water | MSLNICMNCKFEKKKCQCVEISKVKISWWKKFINWWAGI |
| Ga0209932_10838982 | 3300026183 | Pond Water | MSLNICMNCKFEKKKCQCVEISKVKISWWKKFINWWAG |
| Ga0256368_10042582 | 3300028125 | Sea-Ice Brine | MSLNICMDCSFAKKRCQCVPDIPEPIKVKISWWKKLIFWR |
| Ga0256368_10109302 | 3300028125 | Sea-Ice Brine | MSLNICMDCSFEKKKCQCVPDIPEPIKVKISWWKKLIFWR |
| Ga0183755_10122003 | 3300029448 | Marine | MSLNICMDCNFEKKKCQCIVEKIIVKISWWKKILNWFR |
| Ga0348337_117854_3_119 | 3300034418 | Aqueous | MSLNICIDCKFEKKKCQCTAEENKTPEVKMTWWKKIIYY |
| ⦗Top⦘ |