| Basic Information | |
|---|---|
| Family ID | F032066 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 181 |
| Average Sequence Length | 45 residues |
| Representative Sequence | SNQGNTCVDCGGNAGQITDIEADSSPGSPTGMRQLQFGLRVTF |
| Number of Associated Samples | 148 |
| Number of Associated Scaffolds | 181 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 98.34 % |
| % of genes from short scaffolds (< 2000 bps) | 92.82 % |
| Associated GOLD sequencing projects | 137 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.21 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (94.475 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (22.652 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.177 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.514 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.21 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 181 Family Scaffolds |
|---|---|---|
| PF14559 | TPR_19 | 24.86 |
| PF13432 | TPR_16 | 22.65 |
| PF00294 | PfkB | 6.08 |
| PF02133 | Transp_cyt_pur | 2.76 |
| PF00578 | AhpC-TSA | 2.21 |
| PF13620 | CarboxypepD_reg | 1.66 |
| PF12895 | ANAPC3 | 1.66 |
| PF07719 | TPR_2 | 1.10 |
| PF13435 | Cytochrome_C554 | 1.10 |
| PF16338 | AGL_N | 1.10 |
| PF13414 | TPR_11 | 0.55 |
| PF07944 | Glyco_hydro_127 | 0.55 |
| PF00486 | Trans_reg_C | 0.55 |
| PF03190 | Thioredox_DsbH | 0.55 |
| PF08534 | Redoxin | 0.55 |
| PF05495 | zf-CHY | 0.55 |
| PF00069 | Pkinase | 0.55 |
| COG ID | Name | Functional Category | % Frequency in 181 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 2.21 |
| COG1331 | Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains | General function prediction only [R] | 0.55 |
| COG3533 | Beta-L-arabinofuranosidase, GH127 family | Carbohydrate transport and metabolism [G] | 0.55 |
| COG4357 | Uncharacterized conserved protein, contains Zn-finger domain of CHY type | Function unknown [S] | 0.55 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 94.48 % |
| Unclassified | root | N/A | 5.52 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459005|F1BAP7Q02IPFDV | All Organisms → cellular organisms → Bacteria → Acidobacteria | 532 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101383683 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300001471|JGI12712J15308_10125730 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 656 | Open in IMG/M |
| 3300003350|JGI26347J50199_1006843 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1097 | Open in IMG/M |
| 3300004091|Ga0062387_100511205 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 841 | Open in IMG/M |
| 3300004092|Ga0062389_102027666 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 752 | Open in IMG/M |
| 3300004268|Ga0066398_10156290 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 575 | Open in IMG/M |
| 3300004479|Ga0062595_100464750 | All Organisms → cellular organisms → Bacteria | 935 | Open in IMG/M |
| 3300004635|Ga0062388_100101336 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2065 | Open in IMG/M |
| 3300005181|Ga0066678_10646827 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 704 | Open in IMG/M |
| 3300005187|Ga0066675_10147391 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1611 | Open in IMG/M |
| 3300005330|Ga0070690_101750917 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
| 3300005467|Ga0070706_101300407 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 667 | Open in IMG/M |
| 3300005468|Ga0070707_100454652 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1241 | Open in IMG/M |
| 3300005537|Ga0070730_10986519 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300005538|Ga0070731_10351571 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 979 | Open in IMG/M |
| 3300005556|Ga0066707_10824823 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
| 3300005576|Ga0066708_10042048 | All Organisms → cellular organisms → Bacteria | 2516 | Open in IMG/M |
| 3300005576|Ga0066708_10227911 | All Organisms → cellular organisms → Bacteria | 1178 | Open in IMG/M |
| 3300005713|Ga0066905_101227641 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 671 | Open in IMG/M |
| 3300005764|Ga0066903_104041417 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
| 3300005843|Ga0068860_100247227 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1736 | Open in IMG/M |
| 3300005843|Ga0068860_101128949 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 803 | Open in IMG/M |
| 3300005944|Ga0066788_10179550 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 546 | Open in IMG/M |
| 3300005994|Ga0066789_10184574 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
| 3300006028|Ga0070717_11399879 | Not Available | 635 | Open in IMG/M |
| 3300006163|Ga0070715_10058908 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1678 | Open in IMG/M |
| 3300006354|Ga0075021_11028861 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 538 | Open in IMG/M |
| 3300006797|Ga0066659_10518906 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 958 | Open in IMG/M |
| 3300006881|Ga0068865_101325595 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 641 | Open in IMG/M |
| 3300006893|Ga0073928_10954424 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 586 | Open in IMG/M |
| 3300007076|Ga0075435_100369451 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1231 | Open in IMG/M |
| 3300007258|Ga0099793_10250703 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 855 | Open in IMG/M |
| 3300007258|Ga0099793_10281121 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
| 3300007265|Ga0099794_10122352 | All Organisms → cellular organisms → Bacteria | 1310 | Open in IMG/M |
| 3300009038|Ga0099829_10403892 | All Organisms → cellular organisms → Bacteria | 1129 | Open in IMG/M |
| 3300009038|Ga0099829_10581097 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
| 3300009038|Ga0099829_11294018 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 603 | Open in IMG/M |
| 3300009088|Ga0099830_11602247 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 543 | Open in IMG/M |
| 3300009098|Ga0105245_10933388 | All Organisms → cellular organisms → Bacteria | 910 | Open in IMG/M |
| 3300009162|Ga0075423_12412461 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 573 | Open in IMG/M |
| 3300009545|Ga0105237_10292085 | All Organisms → cellular organisms → Bacteria | 1633 | Open in IMG/M |
| 3300009650|Ga0105857_1203589 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 575 | Open in IMG/M |
| 3300010043|Ga0126380_10801853 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 770 | Open in IMG/M |
| 3300010043|Ga0126380_11195894 | Not Available | 655 | Open in IMG/M |
| 3300010043|Ga0126380_11964530 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
| 3300010046|Ga0126384_10352327 | All Organisms → cellular organisms → Bacteria | 1227 | Open in IMG/M |
| 3300010046|Ga0126384_10949675 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 780 | Open in IMG/M |
| 3300010047|Ga0126382_11054536 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 717 | Open in IMG/M |
| 3300010358|Ga0126370_10104442 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1968 | Open in IMG/M |
| 3300010360|Ga0126372_10157019 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1828 | Open in IMG/M |
| 3300010360|Ga0126372_10730983 | All Organisms → cellular organisms → Bacteria | 971 | Open in IMG/M |
| 3300010360|Ga0126372_11689315 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 674 | Open in IMG/M |
| 3300010360|Ga0126372_12938023 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
| 3300010361|Ga0126378_13216743 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
| 3300010376|Ga0126381_100371060 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1984 | Open in IMG/M |
| 3300010376|Ga0126381_100840525 | All Organisms → cellular organisms → Bacteria | 1319 | Open in IMG/M |
| 3300010376|Ga0126381_104156678 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 562 | Open in IMG/M |
| 3300010379|Ga0136449_103898705 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 559 | Open in IMG/M |
| 3300010398|Ga0126383_12138113 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300010880|Ga0126350_10051022 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 692 | Open in IMG/M |
| 3300011120|Ga0150983_11943868 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 542 | Open in IMG/M |
| 3300011269|Ga0137392_11078860 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300011271|Ga0137393_10495079 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1049 | Open in IMG/M |
| 3300011271|Ga0137393_11781005 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
| 3300012096|Ga0137389_10193080 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1691 | Open in IMG/M |
| 3300012096|Ga0137389_10980434 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 725 | Open in IMG/M |
| 3300012189|Ga0137388_11249495 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 681 | Open in IMG/M |
| 3300012198|Ga0137364_10718208 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300012203|Ga0137399_10772756 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 809 | Open in IMG/M |
| 3300012203|Ga0137399_10940831 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300012211|Ga0137377_11811997 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 530 | Open in IMG/M |
| 3300012351|Ga0137386_11077047 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 568 | Open in IMG/M |
| 3300012356|Ga0137371_10987364 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 639 | Open in IMG/M |
| 3300012361|Ga0137360_10567313 | All Organisms → cellular organisms → Bacteria | 970 | Open in IMG/M |
| 3300012363|Ga0137390_10442833 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1275 | Open in IMG/M |
| 3300012363|Ga0137390_10871602 | Not Available | 856 | Open in IMG/M |
| 3300012582|Ga0137358_10623086 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300012683|Ga0137398_10514797 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
| 3300012685|Ga0137397_10908190 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 653 | Open in IMG/M |
| 3300012922|Ga0137394_10296238 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1383 | Open in IMG/M |
| 3300012923|Ga0137359_10401290 | All Organisms → cellular organisms → Bacteria | 1216 | Open in IMG/M |
| 3300012923|Ga0137359_10781819 | All Organisms → cellular organisms → Bacteria | 828 | Open in IMG/M |
| 3300012927|Ga0137416_11083762 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 718 | Open in IMG/M |
| 3300012927|Ga0137416_12057142 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
| 3300012929|Ga0137404_10944273 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
| 3300012944|Ga0137410_10019867 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4618 | Open in IMG/M |
| 3300012944|Ga0137410_11534751 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300012982|Ga0168317_1018235 | All Organisms → cellular organisms → Bacteria | 2096 | Open in IMG/M |
| 3300012986|Ga0164304_11660183 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
| 3300014169|Ga0181531_10119864 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1580 | Open in IMG/M |
| 3300014201|Ga0181537_10167261 | All Organisms → cellular organisms → Bacteria | 1510 | Open in IMG/M |
| 3300015077|Ga0173483_10982632 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
| 3300015264|Ga0137403_10563407 | All Organisms → cellular organisms → Bacteria | 1006 | Open in IMG/M |
| 3300015373|Ga0132257_101149190 | All Organisms → cellular organisms → Bacteria | 981 | Open in IMG/M |
| 3300015373|Ga0132257_101863699 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 773 | Open in IMG/M |
| 3300016270|Ga0182036_11753174 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
| 3300016371|Ga0182034_11530503 | Not Available | 585 | Open in IMG/M |
| 3300017932|Ga0187814_10230880 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300017936|Ga0187821_10180984 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 805 | Open in IMG/M |
| 3300017942|Ga0187808_10009916 | All Organisms → cellular organisms → Bacteria | 3698 | Open in IMG/M |
| 3300017955|Ga0187817_10616135 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 692 | Open in IMG/M |
| 3300017959|Ga0187779_10244212 | All Organisms → cellular organisms → Bacteria | 1135 | Open in IMG/M |
| 3300017994|Ga0187822_10090385 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 921 | Open in IMG/M |
| 3300018006|Ga0187804_10104718 | All Organisms → cellular organisms → Bacteria | 1165 | Open in IMG/M |
| 3300018012|Ga0187810_10058503 | All Organisms → cellular organisms → Bacteria | 1464 | Open in IMG/M |
| 3300018058|Ga0187766_10984075 | Not Available | 600 | Open in IMG/M |
| 3300018090|Ga0187770_10464440 | All Organisms → cellular organisms → Bacteria | 999 | Open in IMG/M |
| 3300018433|Ga0066667_11279898 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 640 | Open in IMG/M |
| 3300021088|Ga0210404_10436296 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300021171|Ga0210405_10316650 | All Organisms → cellular organisms → Bacteria | 1232 | Open in IMG/M |
| 3300021403|Ga0210397_10030537 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3360 | Open in IMG/M |
| 3300021403|Ga0210397_11365201 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
| 3300021403|Ga0210397_11459648 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
| 3300021405|Ga0210387_10347019 | All Organisms → cellular organisms → Bacteria | 1311 | Open in IMG/M |
| 3300021406|Ga0210386_10548582 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 999 | Open in IMG/M |
| 3300021432|Ga0210384_10165817 | All Organisms → cellular organisms → Bacteria | 1984 | Open in IMG/M |
| 3300021432|Ga0210384_11156617 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 678 | Open in IMG/M |
| 3300021433|Ga0210391_10361308 | All Organisms → cellular organisms → Bacteria | 1139 | Open in IMG/M |
| 3300021474|Ga0210390_10020675 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5356 | Open in IMG/M |
| 3300021479|Ga0210410_11376749 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 598 | Open in IMG/M |
| 3300021560|Ga0126371_11741182 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300021560|Ga0126371_12625840 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 610 | Open in IMG/M |
| 3300021560|Ga0126371_13230792 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300024330|Ga0137417_1364180 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1754 | Open in IMG/M |
| 3300025905|Ga0207685_10508635 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300025928|Ga0207700_10081731 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2524 | Open in IMG/M |
| 3300025929|Ga0207664_10541759 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1044 | Open in IMG/M |
| 3300025938|Ga0207704_10334597 | All Organisms → cellular organisms → Bacteria | 1173 | Open in IMG/M |
| 3300025939|Ga0207665_11293294 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300025961|Ga0207712_12098026 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
| 3300026332|Ga0209803_1209874 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300026514|Ga0257168_1068069 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
| 3300026547|Ga0209156_10033198 | All Organisms → cellular organisms → Bacteria | 2906 | Open in IMG/M |
| 3300026551|Ga0209648_10148112 | All Organisms → cellular organisms → Bacteria | 1857 | Open in IMG/M |
| 3300026934|Ga0207816_1043666 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
| 3300027011|Ga0207740_1024175 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 778 | Open in IMG/M |
| 3300027105|Ga0207944_1006569 | All Organisms → cellular organisms → Bacteria | 1036 | Open in IMG/M |
| 3300027109|Ga0208603_1062036 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 561 | Open in IMG/M |
| 3300027376|Ga0209004_1011306 | All Organisms → cellular organisms → Bacteria | 1328 | Open in IMG/M |
| 3300027459|Ga0207505_106275 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300027562|Ga0209735_1034371 | All Organisms → cellular organisms → Bacteria | 1068 | Open in IMG/M |
| 3300027643|Ga0209076_1128369 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 715 | Open in IMG/M |
| 3300027660|Ga0209736_1164225 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 586 | Open in IMG/M |
| 3300027671|Ga0209588_1090084 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 988 | Open in IMG/M |
| 3300027671|Ga0209588_1235005 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 563 | Open in IMG/M |
| 3300027846|Ga0209180_10504650 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 677 | Open in IMG/M |
| 3300027867|Ga0209167_10022825 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2986 | Open in IMG/M |
| 3300027875|Ga0209283_10092746 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1969 | Open in IMG/M |
| 3300027875|Ga0209283_10201086 | All Organisms → cellular organisms → Bacteria | 1324 | Open in IMG/M |
| 3300028381|Ga0268264_10257606 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1624 | Open in IMG/M |
| 3300028381|Ga0268264_11759185 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 630 | Open in IMG/M |
| 3300028381|Ga0268264_12033770 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 583 | Open in IMG/M |
| 3300028577|Ga0265318_10138126 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 895 | Open in IMG/M |
| 3300028795|Ga0302227_10387831 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 530 | Open in IMG/M |
| 3300030509|Ga0302183_10084830 | All Organisms → cellular organisms → Bacteria | 1249 | Open in IMG/M |
| 3300031240|Ga0265320_10133776 | All Organisms → cellular organisms → Bacteria | 1126 | Open in IMG/M |
| 3300031250|Ga0265331_10321414 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 693 | Open in IMG/M |
| 3300031682|Ga0318560_10760185 | Not Available | 523 | Open in IMG/M |
| 3300031718|Ga0307474_10326713 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1184 | Open in IMG/M |
| 3300031720|Ga0307469_10329059 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1273 | Open in IMG/M |
| 3300031736|Ga0318501_10678287 | Not Available | 568 | Open in IMG/M |
| 3300031753|Ga0307477_10191081 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1425 | Open in IMG/M |
| 3300031820|Ga0307473_10020575 | All Organisms → cellular organisms → Bacteria | 2677 | Open in IMG/M |
| 3300031821|Ga0318567_10868252 | Not Available | 511 | Open in IMG/M |
| 3300031823|Ga0307478_10189188 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1651 | Open in IMG/M |
| 3300031912|Ga0306921_10448179 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1504 | Open in IMG/M |
| 3300031912|Ga0306921_10491153 | All Organisms → cellular organisms → Bacteria | 1428 | Open in IMG/M |
| 3300031912|Ga0306921_11659535 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 692 | Open in IMG/M |
| 3300031954|Ga0306926_10971102 | All Organisms → cellular organisms → Bacteria | 1013 | Open in IMG/M |
| 3300031962|Ga0307479_10043737 | All Organisms → cellular organisms → Bacteria | 4298 | Open in IMG/M |
| 3300032059|Ga0318533_11136903 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 572 | Open in IMG/M |
| 3300032076|Ga0306924_11336876 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300032076|Ga0306924_11459757 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 727 | Open in IMG/M |
| 3300032205|Ga0307472_100012394 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4337 | Open in IMG/M |
| 3300032261|Ga0306920_101051760 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1183 | Open in IMG/M |
| 3300032770|Ga0335085_12120900 | Not Available | 567 | Open in IMG/M |
| 3300032782|Ga0335082_10603149 | All Organisms → cellular organisms → Bacteria | 959 | Open in IMG/M |
| 3300032892|Ga0335081_12335732 | Not Available | 558 | Open in IMG/M |
| 3300032897|Ga0335071_10217933 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1862 | Open in IMG/M |
| 3300033158|Ga0335077_10941702 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 866 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 22.65% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 10.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.39% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.97% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.87% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.87% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.87% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.87% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.76% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.76% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.76% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.21% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.66% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.66% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.66% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.10% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.10% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.10% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.10% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.10% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.10% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.10% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.10% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.10% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.55% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.55% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.55% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.55% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.55% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.55% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.55% |
| Weathered Mine Tailings | Environmental → Terrestrial → Geologic → Mine → Unclassified → Weathered Mine Tailings | 0.55% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.55% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.55% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.55% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.55% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459005 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
| 3300003350 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005944 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 | Environmental | Open in IMG/M |
| 3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009650 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-061 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012982 | Weathered mine tailings microbial communities from Hibbing, Minnesota, USA - DCWfield | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026934 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027011 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 29 (SPAdes) | Environmental | Open in IMG/M |
| 3300027105 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF018 (SPAdes) | Environmental | Open in IMG/M |
| 3300027109 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF008 (SPAdes) | Environmental | Open in IMG/M |
| 3300027376 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027459 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-ROWE17-A (SPAdes) | Environmental | Open in IMG/M |
| 3300027562 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Host-Associated | Open in IMG/M |
| 3300028795 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_1 | Environmental | Open in IMG/M |
| 3300030509 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Host-Associated | Open in IMG/M |
| 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Host-Associated | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E41_01027080 | 2170459005 | Grass Soil | VLAIPGNQCLDCFGTASAGQITDIEADSAPGAPVGMRQLQFGFRFVF |
| INPhiseqgaiiFebDRAFT_1013836831 | 3300000364 | Soil | CGGSAGQITDIEADAAPGSPVGMRQLQFGFRLTF* |
| JGI12712J15308_101257301 | 3300001471 | Forest Soil | SNQGNTCVDCGGNAGQITDIEADSSPGSPTGMRQLQFGLRVTF* |
| JGI26347J50199_10068431 | 3300003350 | Bog Forest Soil | LGFNANQGNTCIDTSCGANAGQITDIQGDNSPGSPTGMRQLQFGFRVTF* |
| Ga0062387_1005112052 | 3300004091 | Bog Forest Soil | HPVLGFNGNQGNTCIDTSCGATAGQITDIEGDNSPGSPTGMRQLQFGVKFIF* |
| Ga0062389_1020276661 | 3300004092 | Bog Forest Soil | ANQGNTCIDTSCGANAGQITDIQGDNSPGSPTGMRQLQFGFRVTF* |
| Ga0066398_101562901 | 3300004268 | Tropical Forest Soil | NLCVDCGGNAGQITNIEADASPNAPNGMRQLQFGLRFSF* |
| Ga0062595_1004647501 | 3300004479 | Soil | NHPVLGISNNFNGCVDCGGSAGQITDIEADAAPGSPVGMRQLQFGFRLTF* |
| Ga0062388_1001013363 | 3300004635 | Bog Forest Soil | NTCVDCGGSAGQITDIEADAAPGSPVGMRQLQFGVRVTF* |
| Ga0066678_106468271 | 3300005181 | Soil | RFDAYNVFNHPVLGFNLNQGNLCVDCTGRDPGRVQDIENDASPNAPNGMRQLQFGLRFSF |
| Ga0066675_101473913 | 3300005187 | Soil | FDAYNVFNHPVLAFSSTQGNTCIDCGGDSGRISDIENNNSPGSPAGMRQLQFGLRFTF* |
| Ga0070690_1017509171 | 3300005330 | Switchgrass Rhizosphere | GNLCVDCGGNAGQITNIEADASPNAPNGMRQLQFGLRFTF* |
| Ga0070706_1013004072 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | FNGCADCGGDAGQITDIEADAAPGAPIGMRQLQFGVKITF* |
| Ga0070707_1004546521 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | NLCIDCTGRDPGRIQDIEADASPNSPNGMRQLQFGLRFTF* |
| Ga0070730_109865192 | 3300005537 | Surface Soil | LGFNGSQGNTCVDCTGNAGQITDIENDNSPGSPTGMRQLQFGVRFTF* |
| Ga0070731_103515711 | 3300005538 | Surface Soil | DCGGNAGQITDIEADSSPGSPTGMRQLQFGLRVTF* |
| Ga0066707_108248231 | 3300005556 | Soil | SSTQGNTCIDCGGDSGRITDIENNTSPGSPSGMRQLQFGFRFLF* |
| Ga0066708_100420481 | 3300005576 | Soil | NQGNLCVDCTGRDPGRVQDIENDASPNAPNGMRQLQFGLRFSF* |
| Ga0066708_102279111 | 3300005576 | Soil | LGFSSTQGNTCVDCGGNAGQITAIEADASPNAPNGMRQLQFGLRFTF* |
| Ga0066905_1012276411 | 3300005713 | Tropical Forest Soil | ALPGNTCVDCGGSSGQITDIEADAAPGSPVGMRQLQFGVRLTF* |
| Ga0066903_1040414171 | 3300005764 | Tropical Forest Soil | SFQGGSGTCIDCSGNGRITDIESDASPGSPQGMRQLQFGLRLDF* |
| Ga0068860_1002472272 | 3300005843 | Switchgrass Rhizosphere | GFSSTQGNLCIDCGGNAGQVTNIEADASPNAPNGMRQLQFGLRFTF* |
| Ga0068860_1011289491 | 3300005843 | Switchgrass Rhizosphere | DCGGNAGQITNIEADASPNAPNGMRQLQFGLRFTF* |
| Ga0066788_101795502 | 3300005944 | Soil | FDAYNLFNHPVLAVPGNQCVDCGGSAGQITDIEADAAPGSPVGMRQLQFGVRVTF* |
| Ga0066789_101845741 | 3300005994 | Soil | YNLFNHPVLAVPGNQCVDCGGSAGQITDIEADSAPGSPVGMRQLQFGVRVTF* |
| Ga0070717_113998792 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | NHPVLNFPGNQCVDCGGSAGQITDIEADSAPGAPIGMRQLQFGFKATF* |
| Ga0070715_100589081 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | NLFNHPVLALPNGCVDCSNGGQISDIEADAAPGAPIGMRQLQFGFRFTF* |
| Ga0075021_110288611 | 3300006354 | Watersheds | GNTCVDCGGNAGQITDIENDTSPGSPTGMRQLQFGLRFTF* |
| Ga0066659_105189063 | 3300006797 | Soil | YNVFNHPVLGFSSTQGNTCIDCAGAGQIGSIEADASPNAPNGMRQLQFGVRFIF* |
| Ga0068865_1013255952 | 3300006881 | Miscanthus Rhizosphere | FDAYNVFNHPVLALPGNQCVDCGGSSGQITDIEADAAPGSPVGMRQLQFGVRLTF* |
| Ga0073928_109544241 | 3300006893 | Iron-Sulfur Acid Spring | NTCVDCGGSSGQITDIEADAAPGSPVGMRQLQFGVRITF* |
| Ga0075435_1003694512 | 3300007076 | Populus Rhizosphere | NSNQGNTCVDCGGNAGQITDIELDGSPGSPTGMRQLQFGLRFTF* |
| Ga0099793_102507031 | 3300007258 | Vadose Zone Soil | ALPDSCVDCGGTAGQITNIEADSAPGAPIGMRQLQFGVRVTF* |
| Ga0099793_102811212 | 3300007258 | Vadose Zone Soil | NHPVLAFSSTQGNTCIDCGSDSGRITDIENNNSPGSPSGMRQLQFGVRFTF* |
| Ga0099794_101223522 | 3300007265 | Vadose Zone Soil | NHPVLGFNSAQGNLSVDNGAGGRITAIETDASPNAPNGLRQLQFGVRLDF* |
| Ga0099829_104038921 | 3300009038 | Vadose Zone Soil | NHPVLALPNSCVDCGGGGQGGQITSIEADSAPGAPVGMRQLQFGIRVTF* |
| Ga0099829_105810971 | 3300009038 | Vadose Zone Soil | FNGSQGNTCVDCGSDSGRITDIENNNSPGSPSGMRQLQFGVRFTF* |
| Ga0099829_112940181 | 3300009038 | Vadose Zone Soil | IPGNTCVDCGGDAGLIRDIEDDASPGSPNGMRHLQFGFRVTF* |
| Ga0099830_116022472 | 3300009088 | Vadose Zone Soil | FRFDAYNVFNHPVLAFSSTQGNTCIDCGGDSGRISDIENNNSPGSPSGMRQLQFGLRFTF |
| Ga0105245_109333881 | 3300009098 | Miscanthus Rhizosphere | VFNHPVLGISNNFNGCVDCGGSAGQITDIEADAAPGSPVGMRQLQFGFRLAF* |
| Ga0075423_124124611 | 3300009162 | Populus Rhizosphere | NNFNGCVDCSGSAGQITDIEADAAPGSPVGMRQLQFGFRLTF* |
| Ga0105237_102920851 | 3300009545 | Corn Rhizosphere | NHPVLALPGNQCVDCGGSSGQITDIEADAAPGSPVGMRQLQFGVRLTF* |
| Ga0105857_12035892 | 3300009650 | Permafrost Soil | AYNVFNHPVLAVPGNTCIDCGGNAGQITDIEADAAPGSPVGMRQLQFGVRVTF* |
| Ga0126380_108018532 | 3300010043 | Tropical Forest Soil | GFNANQGNTCVDCGGTAGQITDIENVNSPGSPTGMRQLQFGFRVTF* |
| Ga0126380_111958941 | 3300010043 | Tropical Forest Soil | DCAGAGQIAAIEADASPNAPNGMRQLQFGLRFTF* |
| Ga0126380_119645302 | 3300010043 | Tropical Forest Soil | TCIDCGGDSGRISDIENNNSPGSPTGMRQLQFGVRFTF* |
| Ga0126384_103523271 | 3300010046 | Tropical Forest Soil | TIASGAGRIADIENDSSPGSPTGMRQLQFGVRLTF* |
| Ga0126384_109496752 | 3300010046 | Tropical Forest Soil | DAYNVFNHPVLGFNSNQGNLCVDCTGRDPGRVQDIEGDSSPNAPNGMRQLQFGLRFSF* |
| Ga0126382_110545362 | 3300010047 | Tropical Forest Soil | DAYNVFNHPVLAFSSTQGNTCVDCGSDSGRISNIENNNSPGSPSGMRQLQFGVRVTF* |
| Ga0126370_101044423 | 3300010358 | Tropical Forest Soil | FDAYNVFNHPVLAIPGNTCVDCGGTAGQITDIEGDGSPGSPTGMRQLQFGLRFTF* |
| Ga0126372_101570191 | 3300010360 | Tropical Forest Soil | FNHPVLGFNSNQGNACIDCAGGGIISAIEADASPNAPNGMRQLQFGVRFSF* |
| Ga0126372_107309831 | 3300010360 | Tropical Forest Soil | CVDCAGGGVISAIEADASPNAPNGMRQLQFGLRFSF* |
| Ga0126372_116893151 | 3300010360 | Tropical Forest Soil | AYNLFNHPVLGFPGNQCVDCGGSAGQITDIEADSAPGAPIGMRQLQFGFRVTF* |
| Ga0126372_129380231 | 3300010360 | Tropical Forest Soil | ISNGFNGCVDCTGNAGQITDIENDSSPGSPTGMRQLQFGVRFSF* |
| Ga0126378_132167431 | 3300010361 | Tropical Forest Soil | AYNVFNHPVLAIPGKTCVDCVDGGRITDIENDTSPGSPNGMRHLQFGFRVTF* |
| Ga0126381_1003710601 | 3300010376 | Tropical Forest Soil | FNHPVLGFSSTQGNTCIDCGGGGIISAIEADASPNAPNGMRQLQFGLRFFF* |
| Ga0126381_1008405251 | 3300010376 | Tropical Forest Soil | VDCGGTAGQITDIENVNSPGSPTGMRQLQFGFRLIF* |
| Ga0126381_1041566781 | 3300010376 | Tropical Forest Soil | GCVDCGGNAGQITDIQADSAPGSPVGMRQLQFGFRVTF* |
| Ga0136449_1038987051 | 3300010379 | Peatlands Soil | LGFNGNQGNTCIDCGGTAGQITDIENVNSPGSPSGMRQLQFGFRVTF* |
| Ga0126383_121381131 | 3300010398 | Tropical Forest Soil | SSTQGNTCIDCGGDSGRISDIENNNSPGSPSGMRQLQFGFRFLF* |
| Ga0126350_100510222 | 3300010880 | Boreal Forest Soil | VDCQGNASAGQITDIEADSAPGAPIGMRQLQFGVRVTF* |
| Ga0150983_119438681 | 3300011120 | Forest Soil | AYNVFNHPVLGFNSNQGNTCVDCSSNPDAGRIDNIEGDASPGSPIGMRQLQFGLRVKF* |
| Ga0137392_110788602 | 3300011269 | Vadose Zone Soil | NHPVLGFNGSQGNTCVDCGSDSGRITDIENNNSPGSPSGMRQLQFGVRFTF* |
| Ga0137393_104950791 | 3300011271 | Vadose Zone Soil | VDCGSDSGRITDIENNNSPGSPSGMRQLQFGVRFTF* |
| Ga0137393_117810051 | 3300011271 | Vadose Zone Soil | NVFNHPVLAIPGNTCVDCGGDAGLITDIENDASPGSPNGMRHLQFGFRVTF* |
| Ga0137389_101930801 | 3300012096 | Vadose Zone Soil | FRFDAYNLFNHPVLALPNNCVDCGGQSGQITDIEADSAPGAPIGMRQLQFGVRVTF* |
| Ga0137389_109804342 | 3300012096 | Vadose Zone Soil | VFNHPVLGFGSTQGNTCIDCSGAGRITSVEADASPNAPNGLRQLQFGFRFTF* |
| Ga0137388_112494952 | 3300012189 | Vadose Zone Soil | LALPNGCVDCANGGQISDIEADAAPGAPIGMRQLQFGVRVTF* |
| Ga0137364_107182081 | 3300012198 | Vadose Zone Soil | GNTCIDCAGAGKITAIEADASPNAPNGMRQLQFGLRFTF* |
| Ga0137399_107727561 | 3300012203 | Vadose Zone Soil | DAYNLFNHPVLALPNNCVDCGGQSGQITNIEADSAPGAPIGMRQLQFGVRVTF* |
| Ga0137399_109408312 | 3300012203 | Vadose Zone Soil | VFNHPVLGFNGSQGNTCVDCGSDSGRITDIENNNSPGSPSGMRQLQFGVKFTF* |
| Ga0137377_118119971 | 3300012211 | Vadose Zone Soil | CGGDSGRISDIENNNSPGSPSGMRQLQFGFRFTF* |
| Ga0137386_110770471 | 3300012351 | Vadose Zone Soil | NHPVLAIPGNTCVDCGGDAGLIRDIENDASPGSPNGMRHLQFGFRVTF* |
| Ga0137371_109873641 | 3300012356 | Vadose Zone Soil | NHPVLGFSSTQGNLCVDCSGAGQITAIEADASPNAPNGMRQLQFGLRFTF* |
| Ga0137360_105673131 | 3300012361 | Vadose Zone Soil | AYNIFNHPVLALPNSCFDCGGQSGQITDIEADSAPGAPIGMRQLQFGARVTF* |
| Ga0137390_104428332 | 3300012363 | Vadose Zone Soil | FGSTQGNTCVDCSGAGVINSIEADASPNAPNGMRQLQFGLRFTF* |
| Ga0137390_108716021 | 3300012363 | Vadose Zone Soil | MSFNSAQGNLSVDNGAGGRITAIEGDASPNAPNGLRQLQFGARFTF* |
| Ga0137358_106230862 | 3300012582 | Vadose Zone Soil | NHPVINFPGNTCIDCGGSGGQITDIEADSAPGSPVGMRQLQFGVRITF* |
| Ga0137398_105147971 | 3300012683 | Vadose Zone Soil | HPVLALPNSCVDCGGQSGQITDIEADSAPGSPVGMRQLQFGVRVTF* |
| Ga0137397_109081902 | 3300012685 | Vadose Zone Soil | AIPGNQCVDCGGDAGRITDIENDNSPGSPAGMRQLQFGVRLTF* |
| Ga0137394_102962383 | 3300012922 | Vadose Zone Soil | YNVFNHPVLGFNSAQGNLSVDNGAGGRITAIETDASPNAPNGLRQLQFGVRFDF* |
| Ga0137359_104012901 | 3300012923 | Vadose Zone Soil | LALPGNQCVDCLGLTTAGQITDIEADSAPGAPIGMRQLQFGARVTF* |
| Ga0137359_107818191 | 3300012923 | Vadose Zone Soil | SAQGNLSVDNGAGGRITAIETDASPNAPNGLRQLQFGVRLDF* |
| Ga0137416_110837621 | 3300012927 | Vadose Zone Soil | YNLFNHPVLALPNNCVDCGGQSGQITNIEADSAPGAPIGMRQLQFGVRVTF* |
| Ga0137416_120571421 | 3300012927 | Vadose Zone Soil | YNLFNHPVLALPNNCVDCGGQAGQITDIEHDSAPGAPIGMRQLQFGVRVTF* |
| Ga0137404_109442731 | 3300012929 | Vadose Zone Soil | NTCIDCGGDSGRITDIENNTSPGSPSGMRQLQFGFRFLF* |
| Ga0137410_100198675 | 3300012944 | Vadose Zone Soil | FNHPVLAFSSTQGNTCIDCGGDSGRITDIENNTSPGSPSGMRQLQFGFRFLF* |
| Ga0137410_115347512 | 3300012944 | Vadose Zone Soil | GSQGNTCVDCGGDSGVINHIENNNSPGSPSGMRQLQFGVRFTF* |
| Ga0168317_10182353 | 3300012982 | Weathered Mine Tailings | IDCSGSAGQITDIEADASPGSPNGMRQLQFGLRVTF* |
| Ga0164304_116601831 | 3300012986 | Soil | STQGNTCIDCGGDSGRISDIENNNSPGSPSGMRQMQFGFRFLF* |
| Ga0181531_101198643 | 3300014169 | Bog | AFNSNQGNLCVDCSTNPDAGRIDNIEGDSSPGSPIGMRQLEFGLRIRF* |
| Ga0181537_101672611 | 3300014201 | Bog | DCTGNAGQITDIEQDGSPGSPTGMRQLQFGLRVTF* |
| Ga0173483_109826322 | 3300015077 | Soil | CGSDSGRITDIENNNSPGSPSGMRQLQFGVRFIF* |
| Ga0137403_105634071 | 3300015264 | Vadose Zone Soil | FSSTQGNTCIDCGGDSGRITDIENNTSPGSPSGMRQLQFGFRFLF* |
| Ga0132257_1011491902 | 3300015373 | Arabidopsis Rhizosphere | DCGGNAGQITDIEADAAPGSPVGMRQLQFGFRLTF* |
| Ga0132257_1018636991 | 3300015373 | Arabidopsis Rhizosphere | GCVDCGGSAGQITDIEADAAPGSPVGMRQLQFGFRLTF* |
| Ga0182036_117531741 | 3300016270 | Soil | GNQCVDCGGSAGQITDIEADSAPGAPIGMRQLQFGFRVTF |
| Ga0182034_115305031 | 3300016371 | Soil | QGNTCIDCAGAGQITAIEADASANAPNGMRQLQFGLRFTF |
| Ga0187814_102308802 | 3300017932 | Freshwater Sediment | FNSNQGNTCIDCGGNAGQITDIEADSSAGSPTGMRQLQFGFRVTF |
| Ga0187821_101809841 | 3300017936 | Freshwater Sediment | STQGNTCIDCGGNAGQITDIENNFNGSSMRQLQFGLKLTF |
| Ga0187808_100099161 | 3300017942 | Freshwater Sediment | NTCIDCTGGGTITDIEGDASPGSPNGMRQIQFGLRVVF |
| Ga0187817_106161352 | 3300017955 | Freshwater Sediment | NANQGNTCIDCGGTAGQITDIQGDNSPGSPTGMRQLQFGFRVTF |
| Ga0187779_102442123 | 3300017959 | Tropical Peatland | FNHPVLGFNANQGNTCVDCGGNAGQITDIEADGSPGSPTGMRQLQFGLRFIF |
| Ga0187822_100903851 | 3300017994 | Freshwater Sediment | ANQGNTCVDCGGTAGQITDIENVNSPGSPTGMRQLQFGVRLTF |
| Ga0187804_101047182 | 3300018006 | Freshwater Sediment | NCLDCFGTASAGQITDIEADSAPGAPVGMRQLQFGFRFVF |
| Ga0187810_100585031 | 3300018012 | Freshwater Sediment | NTCVDCGGTAGQITDIENDNSPGSPTGMRQLQFGFRFIF |
| Ga0187766_109840751 | 3300018058 | Tropical Peatland | NHPVLGFNSNQGNTCVDCLSNPDAGRIDNIEADASPGSPIGMRQLQFGLRIRF |
| Ga0187770_104644403 | 3300018090 | Tropical Peatland | STNPNAGRITDIESDATPGTPSGMRQLQFGLRVTF |
| Ga0066667_112798981 | 3300018433 | Grasslands Soil | TQGNLCVDCTGRDPGRVQDIEADASPNAPNGMRQLQFGLRFSF |
| Ga0210404_104362962 | 3300021088 | Soil | RFDAYNLFNHPVLATPGNTCVDCGGNAGQITDIEADAAPGAPIGMRQLQFGFRFTF |
| Ga0210405_103166502 | 3300021171 | Soil | PGNTCVDCGGNAGQITDIEADSAPGAPIGMRQLQFGVRVTF |
| Ga0210397_100305371 | 3300021403 | Soil | FNSNQGNTCIDCGGNAGQITDIEADSSPGSPTGMRQLQFGLRVTF |
| Ga0210397_113652012 | 3300021403 | Soil | CLDCLGYSSAGQITDIEADSAPGAPIGMRQLQFGFKFIF |
| Ga0210397_114596481 | 3300021403 | Soil | NHPVLALPNSCVDCGGQSGQITDIEADSAPGAPIGMRQLQFGVRVTF |
| Ga0210387_103470191 | 3300021405 | Soil | VLGTPGNTCIDCGGSAGQITDIEADSAPGSPVGMRQLQFGVRVTF |
| Ga0210386_105485822 | 3300021406 | Soil | DCLGSSSAGQITDIEADSAPGAPIGMRQLQFGFKFIF |
| Ga0210384_101658171 | 3300021432 | Soil | PGNQCVDCGGSAGQITDIEADSAPGSPVGMRQLQFGVRVTF |
| Ga0210384_111566172 | 3300021432 | Soil | GNTCVDCGGSAGQITDIEADSAPGSPVGMRQLQFGVRVTF |
| Ga0210391_103613082 | 3300021433 | Soil | NTCVDCGGSAGQITDIEADSAPGSPVGMRQLQFGVRVTF |
| Ga0210390_100206755 | 3300021474 | Soil | IDTSCGANAGQITDIQGDNSPGSPTGMRQLQFGFRFIF |
| Ga0210410_113767491 | 3300021479 | Soil | RFDAFNLFNHPVLALPGNQCIDCFGAPSAGQITDIEADSAPGAPIGMRQLQFGVKFIF |
| Ga0126371_117411822 | 3300021560 | Tropical Forest Soil | FRFDVYNLFNHPVLAIPGNQCLDCFGASSAGQITDIEADSAPGAPVGMR |
| Ga0126371_126258402 | 3300021560 | Tropical Forest Soil | NHPVLGFNSNQGSTCVDCTIASGAGRIADIENDSSPGSPTGMRQLQFGVRVTF |
| Ga0126371_132307922 | 3300021560 | Tropical Forest Soil | DCFGAASAGQITDIEADSAPGAPVGMRQLQFGFRFVF |
| Ga0137417_13641803 | 3300024330 | Vadose Zone Soil | VFNHPVLAFSSTQGNTCIDCGGDSGRITDIENNTSPGSPSGMRQLQFGFRFLF |
| Ga0207685_105086352 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | AIPGNQCLDCFGTASAGQITDIEADSAPGAPVGMRQLQFGFRFVF |
| Ga0207700_100817311 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | AYNLFNHPVLNFPGNQCVDCGGSAGQITDIEADSAPGAPIGMRQLQFGFKATF |
| Ga0207664_105417591 | 3300025929 | Agricultural Soil | GSGTCIDCSQNGRVTDIENDASPGSPNGMRQLSFGLRLSF |
| Ga0207704_103345971 | 3300025938 | Miscanthus Rhizosphere | NFNGCVDCGGSAGQITDIEADAAPGSPVGMRQLQFGFRLTF |
| Ga0207665_112932941 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | NQGGSGTCIDCSGNGQINNIENDASPGSPNGMRQLSFGLRLSF |
| Ga0207712_120980261 | 3300025961 | Switchgrass Rhizosphere | FSSTPGNLCIDCGGNAGQITNIEADASPNAPNGMRQLQFGLRFTF |
| Ga0209803_12098742 | 3300026332 | Soil | GNLCVDCSGAGQITAIEADASPNAPNGMRQLQFGLRFTF |
| Ga0257168_10680691 | 3300026514 | Soil | LGFNSAQGNLSVDNGAGGRITAIETDASPNAPNGLRQLQFGVRLDF |
| Ga0209156_100331981 | 3300026547 | Soil | GNTCIDCGGDSGRISDIENNNSPGSPAGMRQLQFGLRFTF |
| Ga0209648_101481121 | 3300026551 | Grasslands Soil | NHPVLGFNSAQGNLSVDNGAGGRITAIETDASPNAPNGLRQLQFGVRLDF |
| Ga0207816_10436661 | 3300026934 | Tropical Forest Soil | ILGFNSNQGNTCLDCGGSAGKITDIEADASPGSPNGMRQLQFGVRVVF |
| Ga0207740_10241752 | 3300027011 | Tropical Forest Soil | VLGFNGNQGNTCVDCGGNAGQITDIEADSSPASPTGMRQLQFGLRFIF |
| Ga0207944_10065692 | 3300027105 | Forest Soil | DCFGTASAGQITDIEADSAPGAPVGMRQLQFGFRFVF |
| Ga0208603_10620362 | 3300027109 | Forest Soil | AYNVFNHPVLGFDANEGNTCIDCGGTAGQITNIQNDNSPGSPTGMRQLQFGVRVIF |
| Ga0209004_10113061 | 3300027376 | Forest Soil | PVIGISNNFNGCVDCGGSSGQISDIEADAAPGSPVGMRQLQFGVKLTF |
| Ga0207505_1062752 | 3300027459 | Soil | NTCVDCGGNAGQITDIENDSSPGSPTGMRQLQFGVRVTF |
| Ga0209735_10343712 | 3300027562 | Forest Soil | FNHPVLAVPGNQCVDCFGSANAGQITDIEADAAPGAPIGMRQLQFGVRVTF |
| Ga0209076_11283692 | 3300027643 | Vadose Zone Soil | NHPVLALPNSCVDCGGQSGQITNIEADSAPGAPIGMRQLQFGVRVTF |
| Ga0209736_11642252 | 3300027660 | Forest Soil | AYNVFNHPVLAIPGNTCVDCTGSAGQITDIEADAAPGSPVGMRQLQFGVRITF |
| Ga0209588_10900841 | 3300027671 | Vadose Zone Soil | LGFGSTQGNTCVDCGGGGIISAIEADASPNAPNGMRQLQFGLRFTF |
| Ga0209588_12350051 | 3300027671 | Vadose Zone Soil | ALPNGCVDCSNGGQISDIEADSAPGAPIGMRQLQFGFRFTF |
| Ga0209180_105046502 | 3300027846 | Vadose Zone Soil | CVDCGSDSGRITDIENNNSPGSPSGMRQLQFGVRFTF |
| Ga0209167_100228254 | 3300027867 | Surface Soil | PVLGFNSNQGNTCIDCGGNAGQITDIEADSSPGSPTGMRQLQFGLRVTF |
| Ga0209283_100927461 | 3300027875 | Vadose Zone Soil | DAYNVFNHPVLGFNGSQGNTCVDCGSDSGRIASIENNNSPGSPSGMRQLQFGVRFTF |
| Ga0209283_102010863 | 3300027875 | Vadose Zone Soil | TCVDCGSDSGRITDIENNNSPGSPSGMRQLQFGVRFTF |
| Ga0268264_102576063 | 3300028381 | Switchgrass Rhizosphere | GCVDCGGSAGQITDIEADAAPGSPVGMRQLQFGFRLTF |
| Ga0268264_117591851 | 3300028381 | Switchgrass Rhizosphere | FSSTQGNLCIDCGGNAGQVTNIEADASPNAPNGMRQLQFGLRFTF |
| Ga0268264_120337702 | 3300028381 | Switchgrass Rhizosphere | LCIDCGGNAGQITNIEADASPNAPNGMRQLQFGLRFTF |
| Ga0265318_101381262 | 3300028577 | Rhizosphere | LFNHPVLALPNGCVDCANGGQIGDIEADSAPGAPIGMRQLQFGFRFTF |
| Ga0302227_103878312 | 3300028795 | Palsa | HVNLGFNADQGNTCVDCGGNAGQITDIEADGSPGSPTGMRQLQFGLRVTF |
| Ga0302183_100848302 | 3300030509 | Palsa | DAYNVFNHVNYGFNSNQGNTCVDCAANADAGRVDDIEADGSPGSPTGMRQLQFGLRVTF |
| Ga0265320_101337761 | 3300031240 | Rhizosphere | VDCANGGQIGDIEADSAPGAPIGMRQLQFGFRFTF |
| Ga0265331_103214141 | 3300031250 | Rhizosphere | NLCVDCAGAGSSAGKITDIEADASPGSPNGMRQLQFGIRVIF |
| Ga0318560_107601852 | 3300031682 | Soil | CIDCTGAGQITAIEADASPNAPNGMRQLQFGLRATF |
| Ga0307474_103267132 | 3300031718 | Hardwood Forest Soil | VLGFSSTQGNLCVDCVGTNAGQVTDIESDTQMRQLQFALRFTF |
| Ga0307469_103290591 | 3300031720 | Hardwood Forest Soil | GFNSNQGNTCVDCGGNAGQITDIEGDGSPGSPTGMRQLQFGLRFTF |
| Ga0318501_106782872 | 3300031736 | Soil | FNSSQGNTCIDCSGAGQITAIEADASPNAPNGMRQLQFGLRATF |
| Ga0307477_101910811 | 3300031753 | Hardwood Forest Soil | HPVLGFNSNQGNTCVDCSSNPDAGRIDNIEGDSSPGSPIGMRQLQFGLRVKF |
| Ga0307473_100205754 | 3300031820 | Hardwood Forest Soil | NVFNHPVLAFSSTQGNTCIDCGSDSGRITDIENNNSPGSPSGMRQLQFGVRFTF |
| Ga0318567_108682521 | 3300031821 | Soil | IDCTGAGQITAIEADASPNAPNGMRQLQFGLRATF |
| Ga0307478_101891881 | 3300031823 | Hardwood Forest Soil | RFDAYNLFNHPVLALPGNQCIDCFGAPSAGQITDIEADSAPGAPIGMRQLQFGVKFIF |
| Ga0306921_104481793 | 3300031912 | Soil | GNTCVDCGGTAGQITDIENVNSPGSPSGMRQLQFGFRVFF |
| Ga0306921_104911531 | 3300031912 | Soil | IDCGGGGIISAIEADASPNAPNGMRQLQFGLRFFF |
| Ga0306921_116595352 | 3300031912 | Soil | QGNTCIDCTGAGQITAIEADASPNAPNGMRQLQFGLRATF |
| Ga0306926_109711021 | 3300031954 | Soil | FNHPVLGFNSNQGNTCVDCGGTAGQITDIENVNSPGSPTGMRQLQFGVRLTF |
| Ga0307479_100437375 | 3300031962 | Hardwood Forest Soil | IDCGSDSGRITDIENNNSPGSPSGMRQLQFGVRFTF |
| Ga0318533_111369032 | 3300032059 | Soil | PILGFGSTQGNTCVDCAGGGIISSIEADASPNAPNGMRQLQFGLRFTF |
| Ga0306924_113368761 | 3300032076 | Soil | FNHPVLGFNGNQGNTCVDCGGTAGQITDIENVNSPGSPTGMRQLQFGVRLTF |
| Ga0306924_114597572 | 3300032076 | Soil | CVDCAGGGIISSIEADASPNAPNGMRQLQFGLRFTF |
| Ga0307472_1000123941 | 3300032205 | Hardwood Forest Soil | FDAYNVFNHPVLAFSSTQGNTCVDCGSDSGRITDIENNNSPGSPSGMRQLQFGVRFTF |
| Ga0306920_1010517602 | 3300032261 | Soil | HPVLGFNSSQGNTCIDCGGNAGQITDIEADSSPASPSGMRALQFGVRLTF |
| Ga0335085_121209002 | 3300032770 | Soil | LGFNANQGNTCVDCGGNAGQITDIEGDASPGSPSGMRAIQFGLRFIF |
| Ga0335082_106031492 | 3300032782 | Soil | STQGNTCIDCSGGGQITNIEADASPNAPNGMRQLQFGVRFTF |
| Ga0335081_123357322 | 3300032892 | Soil | TCVDCGGNAGQITDIEGDASPGSPSGMRAIQFGLRFIF |
| Ga0335071_102179331 | 3300032897 | Soil | NQGNTCIDCGGNAGQITDIEADASPGSTTGMRQLEFALKLTF |
| Ga0335077_109417022 | 3300033158 | Soil | GGSGTCIDCANNGQVNNIENDASPGSPQGMRQLQFGLRLDF |
| ⦗Top⦘ |