| Basic Information | |
|---|---|
| Family ID | F032065 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 181 |
| Average Sequence Length | 48 residues |
| Representative Sequence | MARRAGVRAIGVLGPFPTERRLRAARPEFLIGSIEELPDVLKRLLR |
| Number of Associated Samples | 143 |
| Number of Associated Scaffolds | 181 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.13 % |
| % of genes near scaffold ends (potentially truncated) | 93.92 % |
| % of genes from short scaffolds (< 2000 bps) | 83.98 % |
| Associated GOLD sequencing projects | 136 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.33 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (95.580 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (30.387 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.492 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.934 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 32.43% β-sheet: 0.00% Coil/Unstructured: 67.57% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.33 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 181 Family Scaffolds |
|---|---|---|
| PF00708 | Acylphosphatase | 12.15 |
| PF03825 | Nuc_H_symport | 7.73 |
| PF00156 | Pribosyltran | 3.31 |
| PF05988 | DUF899 | 1.66 |
| PF00588 | SpoU_methylase | 1.10 |
| PF01128 | IspD | 1.10 |
| PF02894 | GFO_IDH_MocA_C | 1.10 |
| PF00144 | Beta-lactamase | 1.10 |
| PF08032 | SpoU_sub_bind | 0.55 |
| PF00072 | Response_reg | 0.55 |
| PF00933 | Glyco_hydro_3 | 0.55 |
| PF13620 | CarboxypepD_reg | 0.55 |
| PF00498 | FHA | 0.55 |
| PF07589 | PEP-CTERM | 0.55 |
| PF08327 | AHSA1 | 0.55 |
| PF14534 | DUF4440 | 0.55 |
| COG ID | Name | Functional Category | % Frequency in 181 Family Scaffolds |
|---|---|---|---|
| COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 7.73 |
| COG0566 | tRNA G18 (ribose-2'-O)-methylase SpoU | Translation, ribosomal structure and biogenesis [J] | 1.66 |
| COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 1.66 |
| COG0219 | tRNA(Leu) C34 or U34 (ribose-2'-O)-methylase TrmL, contains SPOUT domain | Translation, ribosomal structure and biogenesis [J] | 1.10 |
| COG0565 | tRNA C32,U32 (ribose-2'-O)-methylase TrmJ or a related methyltransferase | Translation, ribosomal structure and biogenesis [J] | 1.10 |
| COG0673 | Predicted dehydrogenase | General function prediction only [R] | 1.10 |
| COG0746 | Molybdopterin-guanine dinucleotide biosynthesis protein A | Coenzyme transport and metabolism [H] | 1.10 |
| COG1207 | Bifunctional protein GlmU, N-acetylglucosamine-1-phosphate-uridyltransferase/glucosamine-1-phosphate-acetyltransferase | Cell wall/membrane/envelope biogenesis [M] | 1.10 |
| COG1211 | 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase | Lipid transport and metabolism [I] | 1.10 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 1.10 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 1.10 |
| COG2068 | CTP:molybdopterin cytidylyltransferase MocA | Coenzyme transport and metabolism [H] | 1.10 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 1.10 |
| COG1472 | Periplasmic beta-glucosidase and related glycosidases | Carbohydrate transport and metabolism [G] | 0.55 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 95.58 % |
| Unclassified | root | N/A | 4.42 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000891|JGI10214J12806_11330928 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 792 | Open in IMG/M |
| 3300001593|JGI12635J15846_10106172 | All Organisms → cellular organisms → Bacteria | 2006 | Open in IMG/M |
| 3300002907|JGI25613J43889_10012571 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2353 | Open in IMG/M |
| 3300004479|Ga0062595_102233821 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300005165|Ga0066869_10146761 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300005174|Ga0066680_10512508 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300005175|Ga0066673_10716763 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300005176|Ga0066679_10194823 | All Organisms → cellular organisms → Bacteria | 1289 | Open in IMG/M |
| 3300005181|Ga0066678_10182907 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1330 | Open in IMG/M |
| 3300005181|Ga0066678_10288965 | All Organisms → cellular organisms → Bacteria | 1070 | Open in IMG/M |
| 3300005181|Ga0066678_11085657 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300005332|Ga0066388_101999290 | All Organisms → cellular organisms → Bacteria | 1039 | Open in IMG/M |
| 3300005332|Ga0066388_108775590 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300005367|Ga0070667_101468370 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 640 | Open in IMG/M |
| 3300005450|Ga0066682_10312474 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1014 | Open in IMG/M |
| 3300005450|Ga0066682_10760793 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300005451|Ga0066681_10222781 | All Organisms → cellular organisms → Bacteria | 1135 | Open in IMG/M |
| 3300005454|Ga0066687_10136635 | All Organisms → cellular organisms → Bacteria | 1282 | Open in IMG/M |
| 3300005526|Ga0073909_10006076 | All Organisms → cellular organisms → Bacteria | 3568 | Open in IMG/M |
| 3300005529|Ga0070741_10559934 | All Organisms → cellular organisms → Bacteria | 1026 | Open in IMG/M |
| 3300005541|Ga0070733_10765660 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300005586|Ga0066691_10136491 | All Organisms → cellular organisms → Bacteria | 1403 | Open in IMG/M |
| 3300005598|Ga0066706_11096854 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300005610|Ga0070763_10927056 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300005712|Ga0070764_10880250 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300005764|Ga0066903_107951794 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300005994|Ga0066789_10475062 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 522 | Open in IMG/M |
| 3300006059|Ga0075017_101654330 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
| 3300006163|Ga0070715_10155741 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1124 | Open in IMG/M |
| 3300006163|Ga0070715_11075144 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300006800|Ga0066660_10094673 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2097 | Open in IMG/M |
| 3300006871|Ga0075434_101659337 | Not Available | 647 | Open in IMG/M |
| 3300006903|Ga0075426_11168116 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300007258|Ga0099793_10000338 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 12298 | Open in IMG/M |
| 3300007265|Ga0099794_10334321 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
| 3300007265|Ga0099794_10446283 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 678 | Open in IMG/M |
| 3300007265|Ga0099794_10493357 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300007788|Ga0099795_10461181 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 587 | Open in IMG/M |
| 3300009038|Ga0099829_10692956 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300009088|Ga0099830_10270531 | All Organisms → cellular organisms → Bacteria | 1349 | Open in IMG/M |
| 3300009088|Ga0099830_10526826 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 965 | Open in IMG/M |
| 3300009088|Ga0099830_10610350 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
| 3300009089|Ga0099828_11898428 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 522 | Open in IMG/M |
| 3300009090|Ga0099827_10627553 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 927 | Open in IMG/M |
| 3300009090|Ga0099827_11040765 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300009143|Ga0099792_10942861 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 573 | Open in IMG/M |
| 3300009792|Ga0126374_10291075 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1089 | Open in IMG/M |
| 3300010159|Ga0099796_10478687 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 556 | Open in IMG/M |
| 3300010320|Ga0134109_10038908 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1541 | Open in IMG/M |
| 3300010335|Ga0134063_10058752 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1693 | Open in IMG/M |
| 3300010335|Ga0134063_10248189 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 846 | Open in IMG/M |
| 3300010337|Ga0134062_10390591 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300010358|Ga0126370_10042066 | All Organisms → cellular organisms → Bacteria | 2846 | Open in IMG/M |
| 3300010358|Ga0126370_10057023 | All Organisms → cellular organisms → Bacteria | 2515 | Open in IMG/M |
| 3300010358|Ga0126370_11468469 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300010359|Ga0126376_11197028 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300010361|Ga0126378_11373011 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300010362|Ga0126377_11308672 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
| 3300010362|Ga0126377_11790113 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 689 | Open in IMG/M |
| 3300010366|Ga0126379_10695876 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1110 | Open in IMG/M |
| 3300010376|Ga0126381_102468472 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300010398|Ga0126383_11336787 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
| 3300011269|Ga0137392_10229595 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1524 | Open in IMG/M |
| 3300011270|Ga0137391_10918874 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300012096|Ga0137389_11818436 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
| 3300012189|Ga0137388_11546664 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300012199|Ga0137383_10045113 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 3138 | Open in IMG/M |
| 3300012201|Ga0137365_10066786 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2713 | Open in IMG/M |
| 3300012202|Ga0137363_10095536 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2247 | Open in IMG/M |
| 3300012202|Ga0137363_10986428 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 715 | Open in IMG/M |
| 3300012202|Ga0137363_11624838 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300012205|Ga0137362_10384337 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1216 | Open in IMG/M |
| 3300012205|Ga0137362_11563847 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300012207|Ga0137381_11012514 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300012211|Ga0137377_11183469 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300012285|Ga0137370_10799102 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 585 | Open in IMG/M |
| 3300012349|Ga0137387_10167808 | All Organisms → cellular organisms → Bacteria | 1569 | Open in IMG/M |
| 3300012351|Ga0137386_10526643 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
| 3300012361|Ga0137360_10013392 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 5290 | Open in IMG/M |
| 3300012361|Ga0137360_10210869 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1578 | Open in IMG/M |
| 3300012361|Ga0137360_10452554 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1088 | Open in IMG/M |
| 3300012363|Ga0137390_11892275 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
| 3300012582|Ga0137358_10167953 | All Organisms → cellular organisms → Bacteria | 1496 | Open in IMG/M |
| 3300012582|Ga0137358_10981401 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 548 | Open in IMG/M |
| 3300012683|Ga0137398_10002331 | All Organisms → cellular organisms → Bacteria | 8116 | Open in IMG/M |
| 3300012683|Ga0137398_10441713 | All Organisms → cellular organisms → Bacteria | 889 | Open in IMG/M |
| 3300012917|Ga0137395_10471929 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
| 3300012918|Ga0137396_10012210 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5296 | Open in IMG/M |
| 3300012918|Ga0137396_10537701 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 866 | Open in IMG/M |
| 3300012922|Ga0137394_10214390 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1646 | Open in IMG/M |
| 3300012922|Ga0137394_10351178 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1259 | Open in IMG/M |
| 3300012923|Ga0137359_11406391 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300012925|Ga0137419_10613187 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
| 3300012931|Ga0153915_11784275 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 720 | Open in IMG/M |
| 3300012931|Ga0153915_13430031 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 513 | Open in IMG/M |
| 3300012948|Ga0126375_11992500 | Not Available | 513 | Open in IMG/M |
| 3300012971|Ga0126369_10692706 | Not Available | 1096 | Open in IMG/M |
| 3300012971|Ga0126369_10906712 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
| 3300012971|Ga0126369_12840914 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 567 | Open in IMG/M |
| 3300012975|Ga0134110_10014969 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 2966 | Open in IMG/M |
| 3300012976|Ga0134076_10166250 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
| 3300012976|Ga0134076_10600175 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300012976|Ga0134076_10606565 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300015053|Ga0137405_1010101 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 721 | Open in IMG/M |
| 3300015241|Ga0137418_10212439 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1665 | Open in IMG/M |
| 3300015264|Ga0137403_10853106 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 763 | Open in IMG/M |
| 3300017659|Ga0134083_10302515 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300017822|Ga0187802_10002636 | All Organisms → cellular organisms → Bacteria | 5121 | Open in IMG/M |
| 3300017973|Ga0187780_10412443 | All Organisms → cellular organisms → Bacteria | 959 | Open in IMG/M |
| 3300017994|Ga0187822_10011570 | All Organisms → cellular organisms → Bacteria | 2122 | Open in IMG/M |
| 3300018433|Ga0066667_10026362 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 3192 | Open in IMG/M |
| 3300018433|Ga0066667_10835784 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 787 | Open in IMG/M |
| 3300018468|Ga0066662_10170310 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1677 | Open in IMG/M |
| 3300020022|Ga0193733_1016860 | All Organisms → cellular organisms → Bacteria | 2063 | Open in IMG/M |
| 3300020580|Ga0210403_10028422 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4461 | Open in IMG/M |
| 3300020580|Ga0210403_10145739 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1935 | Open in IMG/M |
| 3300020583|Ga0210401_10055614 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3733 | Open in IMG/M |
| 3300020583|Ga0210401_11006036 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300021171|Ga0210405_10432065 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1036 | Open in IMG/M |
| 3300021401|Ga0210393_10079214 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2600 | Open in IMG/M |
| 3300021401|Ga0210393_11531710 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 530 | Open in IMG/M |
| 3300021403|Ga0210397_11129588 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300021405|Ga0210387_11680707 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 538 | Open in IMG/M |
| 3300021406|Ga0210386_10255770 | All Organisms → cellular organisms → Bacteria | 1495 | Open in IMG/M |
| 3300021407|Ga0210383_11088952 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 675 | Open in IMG/M |
| 3300021560|Ga0126371_10270516 | All Organisms → cellular organisms → Bacteria | 1819 | Open in IMG/M |
| 3300024330|Ga0137417_1179604 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300024330|Ga0137417_1246934 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
| 3300024330|Ga0137417_1471240 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300024331|Ga0247668_1071719 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 700 | Open in IMG/M |
| 3300025899|Ga0207642_10712195 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300025910|Ga0207684_10150875 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2000 | Open in IMG/M |
| 3300026297|Ga0209237_1106127 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1219 | Open in IMG/M |
| 3300026314|Ga0209268_1125643 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 640 | Open in IMG/M |
| 3300026318|Ga0209471_1100605 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1250 | Open in IMG/M |
| 3300026319|Ga0209647_1149454 | All Organisms → cellular organisms → Bacteria | 991 | Open in IMG/M |
| 3300026351|Ga0257170_1059350 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300026359|Ga0257163_1020904 | All Organisms → cellular organisms → Bacteria | 1017 | Open in IMG/M |
| 3300026377|Ga0257171_1020945 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1102 | Open in IMG/M |
| 3300026482|Ga0257172_1047264 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
| 3300026497|Ga0257164_1018870 | All Organisms → cellular organisms → Bacteria | 963 | Open in IMG/M |
| 3300026551|Ga0209648_10157590 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1784 | Open in IMG/M |
| 3300026551|Ga0209648_10313309 | All Organisms → cellular organisms → Bacteria | 1112 | Open in IMG/M |
| 3300026555|Ga0179593_1183296 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3626 | Open in IMG/M |
| 3300027288|Ga0208525_1010842 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 998 | Open in IMG/M |
| 3300027635|Ga0209625_1122431 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 583 | Open in IMG/M |
| 3300027645|Ga0209117_1176416 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300027651|Ga0209217_1103504 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
| 3300027655|Ga0209388_1074177 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 980 | Open in IMG/M |
| 3300027663|Ga0208990_1100247 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 805 | Open in IMG/M |
| 3300027842|Ga0209580_10265457 | Not Available | 854 | Open in IMG/M |
| 3300027862|Ga0209701_10001757 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 14053 | Open in IMG/M |
| 3300027874|Ga0209465_10224921 | All Organisms → cellular organisms → Bacteria | 937 | Open in IMG/M |
| 3300027905|Ga0209415_11091466 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 520 | Open in IMG/M |
| 3300028016|Ga0265354_1004412 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1482 | Open in IMG/M |
| (restricted) 3300028043|Ga0233417_10452341 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 598 | Open in IMG/M |
| 3300028906|Ga0308309_10383127 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1203 | Open in IMG/M |
| 3300029636|Ga0222749_10764929 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
| 3300030813|Ga0265750_1008261 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1155 | Open in IMG/M |
| 3300031057|Ga0170834_103639778 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 870 | Open in IMG/M |
| 3300031057|Ga0170834_113788682 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
| 3300031231|Ga0170824_107525374 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300031720|Ga0307469_10175699 | All Organisms → cellular organisms → Bacteria | 1640 | Open in IMG/M |
| 3300031720|Ga0307469_12293821 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300031753|Ga0307477_11017756 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 543 | Open in IMG/M |
| 3300031779|Ga0318566_10549119 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300031846|Ga0318512_10407049 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300031910|Ga0306923_11636542 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300031954|Ga0306926_12062489 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300031962|Ga0307479_11707140 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 583 | Open in IMG/M |
| 3300032068|Ga0318553_10767835 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300032180|Ga0307471_100016753 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 5200 | Open in IMG/M |
| 3300032180|Ga0307471_101515453 | All Organisms → cellular organisms → Bacteria | 828 | Open in IMG/M |
| 3300032261|Ga0306920_101410940 | All Organisms → cellular organisms → Bacteria | 998 | Open in IMG/M |
| 3300032782|Ga0335082_10600068 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 962 | Open in IMG/M |
| 3300033290|Ga0318519_10848400 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300033486|Ga0316624_10206122 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1525 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 30.39% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.15% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 9.39% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.29% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.97% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.42% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.87% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.76% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.21% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.21% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.21% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.66% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.66% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.66% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 1.10% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.10% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.10% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.10% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.10% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.10% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.55% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.55% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.55% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.55% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.55% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.55% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.55% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.55% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.55% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002907 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005165 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMC | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300024331 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09 | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026351 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-05-B | Environmental | Open in IMG/M |
| 3300026359 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-A | Environmental | Open in IMG/M |
| 3300026377 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-B | Environmental | Open in IMG/M |
| 3300026482 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-B | Environmental | Open in IMG/M |
| 3300026497 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-B | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300027288 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMC (SPAdes) | Environmental | Open in IMG/M |
| 3300027635 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027663 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Host-Associated | Open in IMG/M |
| 3300028043 (restricted) | Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_0.5_MG | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030813 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10214J12806_113309281 | 3300000891 | Soil | DLEMARRAGVRAAIAVLGPFPTEIRLRAARPDLLLESIEELPAALGRFQG* |
| JGI12635J15846_101061721 | 3300001593 | Forest Soil | MAQRAGVRAIGVLGPFPTEKRLRAARPEFLIGSIEELPDVLKRLPR* |
| JGI25613J43889_100125711 | 3300002907 | Grasslands Soil | VEMARRAGVRAIGVLGPFPTERRLRAARPEFLIGSIEELPDVLKRLLR* |
| Ga0062595_1022338212 | 3300004479 | Soil | DAPEDLQMARSAGVRAAIAVLGSFPTEKRLRAAKPDALLECIEELPAALKFFL* |
| Ga0066869_101467612 | 3300005165 | Soil | PEDLEMARSAGVRAALAVLGPFPTEKRLRAAKPDALLESIEDLPRALEEFL* |
| Ga0066680_105125081 | 3300005174 | Soil | SAGVRAIGVLGPFPTEQRLRAARPEFLIASLKELPNVLNWLRNGRE* |
| Ga0066673_107167632 | 3300005175 | Soil | EMAKRAGVRAIGVLGPFPTEKRLRAAHPEFLIGSIEELPDVLKRLLR* |
| Ga0066679_101948232 | 3300005176 | Soil | QDMQMARRAGVRAIGVLGPFPTEKRLRASCPEFLIGSIEELPDVLKRLRR* |
| Ga0066678_101829072 | 3300005181 | Soil | RSAGVRAAIAILGPFPTEKRLRAAKPDILLESIEELPAALNRFRC* |
| Ga0066678_102889651 | 3300005181 | Soil | GDSPEDLEMSRRAGVRAVAVLGPFPTEKRLRAARPELLLESLDELPEALREIQS* |
| Ga0066678_110856572 | 3300005181 | Soil | VRAIGVLGPFPTEKSLRAAQPEFLLESIDELPGVLKQLRG* |
| Ga0066388_1019992901 | 3300005332 | Tropical Forest Soil | RRAGVRAIGVLGPFPTEKRLRAARPEFLIGSLEELPDLLNRLRNGRK* |
| Ga0066388_1087755902 | 3300005332 | Tropical Forest Soil | EDLEMARRAGVRAIAVLGRFPTEKSLRSAQPDLLLSSIIELPEALRLLPG* |
| Ga0070667_1014683702 | 3300005367 | Switchgrass Rhizosphere | PEDLEMARRAGARAAIAVLGPFPTERRLRAAKPDLLLDSIEELPGALAGFQD* |
| Ga0070709_105512922 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | AHVLVIGVLGPFPTEKRLRAAKPDLLLNSIADLPAALKRLAS* |
| Ga0066682_103124742 | 3300005450 | Soil | ARSAGVRAAIAVLGPFPTEKRLRAAKPDALLESIEELPSALKLFV* |
| Ga0066682_107607932 | 3300005450 | Soil | KRAGVRAIGVLGPFPTEKRLRAARPEFLIGSIEELPDVLKKLLR* |
| Ga0066681_102227812 | 3300005451 | Soil | DAPQDVEMAKRAGVRAIGVLGPFPTERRLRAARPEFLIGSIEELPDVLKKIAPLIVRVS* |
| Ga0066687_101366353 | 3300005454 | Soil | RSAGVLAIGVLGPYPTEKRLRAIRPEFLLGSLEELPEVLDRLRNGSK* |
| Ga0073909_100060761 | 3300005526 | Surface Soil | LQMARSAGVRAAIAILGPFPTEKRLRAAKPDALLESILQLPAALLQFST* |
| Ga0070741_105599341 | 3300005529 | Surface Soil | GVRAVAVLGPFPTEKRLRDAKPEFLLESITELPALLAQL* |
| Ga0070733_107656601 | 3300005541 | Surface Soil | SAGVRAAIAVLGPFPTEKRLRAGKPDLLLESIEELPEALLTI* |
| Ga0066691_101364913 | 3300005586 | Soil | PEDLQMARSAGVRAAIAVLGPFPTEKRLRAAKPDALLESIEELPHALREFY* |
| Ga0066706_110968542 | 3300005598 | Soil | APQDVEMAKRAGVRAIGVLGPFPTEKRLRAAHPEFLIGSIEELPDVLKRLLR* |
| Ga0070763_109270561 | 3300005610 | Soil | EDVEMANRAGVRAIAVLGPFPTEKRLRAAHPDFLLASIRELPETLKRLRG* |
| Ga0070764_108802502 | 3300005712 | Soil | MARRAGVRAIAVLGRFPTEKGLRAARPEFLLDSITEIPALLDHLRE* |
| Ga0066903_1079517941 | 3300005764 | Tropical Forest Soil | ARNAGVRAAIAVLGPFPTEKRLRAANPDLLLESIAELPSALFRLR* |
| Ga0066789_104750622 | 3300005994 | Soil | VRVIGVIGPFPTEQRLRAAKPDLLLNSIAELPAALKQLAAQR* |
| Ga0075017_1016543301 | 3300006059 | Watersheds | GVRAIAVLGPFPTEKRLRAARPDFLLESIRELPQVLRNLTGQ* |
| Ga0070715_101557411 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | AGVRGAIAILGPFPTEKRLRAAKPDILLESIEELPAALNRFQR* |
| Ga0070715_110751441 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | RSAGVLAIGVLGPYPTEKRLRAAQPEFLLGSLEELPDVLDRLRNGSK* |
| Ga0066660_100946731 | 3300006800 | Soil | GVRAIGVLGPFPTERRLRAARPEFLIGSIEELPDVVKKLLR* |
| Ga0075434_1016593371 | 3300006871 | Populus Rhizosphere | AGVRAAIAVLGPFPTEKRLRAARPDLLLGSIEELPAALARFQD* |
| Ga0075426_111681161 | 3300006903 | Populus Rhizosphere | DSPEDMEMARRAGVRSAIAVLGPFPTEKRLRAAKPDLLLESIEDLPSALQKFRD* |
| Ga0099793_100003381 | 3300007258 | Vadose Zone Soil | LEMARRAGVRPIAVLGPFPTEARLRAAKPDLLLASITDLPEALRRLT* |
| Ga0099794_103343212 | 3300007265 | Vadose Zone Soil | APQDVEMAKRAGVRAIGVLGPFPTEKRLRAARPEFLIGSIEELPDVLKRLLH* |
| Ga0099794_104462832 | 3300007265 | Vadose Zone Soil | MACRAGVRAIAVLGPFPTEARLRAAKPDVLLDSINELPDALGQL* |
| Ga0099794_104933571 | 3300007265 | Vadose Zone Soil | RRAGVRAIGVLGPFPTEKRLRAARPEFLIGSIEELPDVLKKLLQ* |
| Ga0099795_104611811 | 3300007788 | Vadose Zone Soil | EMARRAGVRAVAVLGPFPTEARLRAAKPDLLLNSITDLPKALLQF* |
| Ga0099829_106929562 | 3300009038 | Vadose Zone Soil | PQDVEMAKRAGVRAIGVLGPFPTEKRLRAARPEFLIGSIEELPDVLKRLLH* |
| Ga0099830_102705311 | 3300009088 | Vadose Zone Soil | EMAQSAGVRAIGVLGPFPTEKRLRAAQPEFLIGSIEELPDILKKLLR* |
| Ga0099830_105268261 | 3300009088 | Vadose Zone Soil | GVAAIAVLGAFPIEPRLRAAKPEFLLSSIEHLPKLLRSF* |
| Ga0099830_106103502 | 3300009088 | Vadose Zone Soil | GVRAIGVLGPFPTEKRLRASRPECILASIEELPDALKRLRA* |
| Ga0099828_118984282 | 3300009089 | Vadose Zone Soil | RRAGVRAIAVLGRFPTHGGLRAARPEALLTSIDLLPDALKNFQ* |
| Ga0099827_106275532 | 3300009090 | Vadose Zone Soil | AIAVLGPFPTHDGLRAVRPDALLSSIDQLPRLLKNY* |
| Ga0099827_110407651 | 3300009090 | Vadose Zone Soil | ARRAGVRAIGVLGPFPTEKRLRAARPEFLIGSLEELPDVLKRLLR* |
| Ga0099792_109428612 | 3300009143 | Vadose Zone Soil | PEDLEMARRAGVRPIAVLGPFPTEARLRAAKPELLLDSITELPEALGQL* |
| Ga0126374_102910752 | 3300009792 | Tropical Forest Soil | PEDLQMARSAGVRAAIAVLGPFPTEKRLRAAKPDALLESILELPEALKRFL* |
| Ga0126373_130159771 | 3300010048 | Tropical Forest Soil | AGVRAIAVLGPFPTEKRLRAVRPEVLLNGLKELPGALREMFGPW* |
| Ga0099796_104786872 | 3300010159 | Vadose Zone Soil | APEDLEMARRAGVRPIAVLGPFPTEARLRAAKPELLLDSITELPEALGQL* |
| Ga0134109_100389081 | 3300010320 | Grasslands Soil | AGVRAIGVLGPFPTEKRLRAAGPEYLIGSIEELPDVLKRLLC* |
| Ga0134063_100587521 | 3300010335 | Grasslands Soil | DVEMARRAGVRAIGVLGPFPTEKRLRASRPEFLIGSIEELPDVLKRLLC* |
| Ga0134063_102481891 | 3300010335 | Grasslands Soil | AGVRAAIAILGPFPTEKRLRAAKPDILLESIEELPAALNRFRC* |
| Ga0134062_103905911 | 3300010337 | Grasslands Soil | VRAIGVLGPFPTEQRLRAARPEFLIGSLKELPDVLNWLRNGRE* |
| Ga0126370_100420665 | 3300010358 | Tropical Forest Soil | VYVGDAPEDLQMARSAGVRAAIAVLGPFPTENRLRAAKPDALLESIEELPLALQSFL* |
| Ga0126370_100570231 | 3300010358 | Tropical Forest Soil | GDIPEDLEMARRAGVRAAIAVLGPFPTERRLRAPKPDVLLHSIEDLPAALARF* |
| Ga0126370_114684692 | 3300010358 | Tropical Forest Soil | DAPQDVEMARRAGVLAIGVLGPFPTEKRLRAARPEFLIRSLEELPDVLKRLCDRAK* |
| Ga0126376_111970282 | 3300010359 | Tropical Forest Soil | MAQRAGVRAIGVLGPFPTERRLRAAQPEFLLGSIEELPDVLKELRH* |
| Ga0126378_113730112 | 3300010361 | Tropical Forest Soil | EMARSAGVLAIGVLGPYPTEERLRAAKPEFLLGSLEELPEVLNRLRNGSQ* |
| Ga0126377_113086722 | 3300010362 | Tropical Forest Soil | IGDAPQDVEMARRAGVLAIGVLGRFPTEKRLRAARPDFLIGSLDELPGVLKRLCD* |
| Ga0126377_117901132 | 3300010362 | Tropical Forest Soil | DSAQDLQMARSAGAMAAIAVLGPYPIEKALRAAKPDLLLESIRELPAALKKLGL* |
| Ga0126379_106958761 | 3300010366 | Tropical Forest Soil | TVYVGDAPEDLQMARSAGVRAAIAVLGPFPTENRLRAAKPDALLESIEELPQALQSFL* |
| Ga0126381_1024684722 | 3300010376 | Tropical Forest Soil | MARSAWVRAIAVLGPFPTEKALRAAEPEVLLASIAELPAALGRLAT* |
| Ga0126383_113367872 | 3300010398 | Tropical Forest Soil | GDAPQDVEMARSAGVLAIGVLGPYPTGKRLRAARPEFLLGSLEELPDILDRLRNGRK* |
| Ga0137392_102295953 | 3300011269 | Vadose Zone Soil | EMARRAGVRAIGVLGPFPTEKRLRAARPEFLIASIQELPDVLKKLLR* |
| Ga0137391_109188741 | 3300011270 | Vadose Zone Soil | EMARRAGVRAIAVLGPFPTEARLRAAKPDVLLDSINELPDALGQL* |
| Ga0137389_118184362 | 3300012096 | Vadose Zone Soil | SPEDLEMARRAGVRPIAVLGPFPTEARLRAANPELLLDSITELPNALRQL* |
| Ga0137388_115466641 | 3300012189 | Vadose Zone Soil | MARRAGVRAIGVLGPLPTEKRLRAARPEFLIGSIEELPDVLKRLLR* |
| Ga0137383_100451131 | 3300012199 | Vadose Zone Soil | DAPQDVEMAKRAGVRAIGVLGPFPTEKRLRAAHPEFLIGSIQELPDVLKRLLR* |
| Ga0137365_100667861 | 3300012201 | Vadose Zone Soil | DVEMARRAGVRAIGVLGPFPTEKRLRAARPEFLIGSIDELPDLMKRLFR* |
| Ga0137363_100955364 | 3300012202 | Vadose Zone Soil | MARRAGVRAIAVLGPFPTEARLRAAKPDLLLNSIRDLPDALRQLP* |
| Ga0137363_109864283 | 3300012202 | Vadose Zone Soil | GVRAAIAILGPFPTEKRLRAAKPDILLDSITQLPAALLHFND* |
| Ga0137363_116248382 | 3300012202 | Vadose Zone Soil | RRAGVRAIGVLGPFPTERRLRAARPEFLIGSIEELPNVLKKLLR* |
| Ga0137362_103843372 | 3300012205 | Vadose Zone Soil | VYVGDAPEDLEMARSACVRAAIAVLGPFPTEKRLRAAKPDALLESIEELPHALREFY* |
| Ga0137362_115638472 | 3300012205 | Vadose Zone Soil | AAQDVEMAQGASVRAIGVLGPFPTEKSLRAAQPEFLLESIDELPGVLKQLRG* |
| Ga0137381_110125141 | 3300012207 | Vadose Zone Soil | AGVLAIGVLGPYPTEKRLRAARPEFLLDSIGDLPGLLNDLRA* |
| Ga0137377_111834692 | 3300012211 | Vadose Zone Soil | DVEMAKRAGVRAIGVLGPFPTEKRLRAAHPEFLIGSIEELPDVLKRLLR* |
| Ga0137370_107991021 | 3300012285 | Vadose Zone Soil | KRAGVRAIGVLVPFPTEKRLRAAHPEFLIGSIQELPDILKRLLR* |
| Ga0137387_101678081 | 3300012349 | Vadose Zone Soil | EMAQRAGVRAIGVLGPFPTERRLRATRPEFLIGSIEELPDVLKKLLR* |
| Ga0137386_105266432 | 3300012351 | Vadose Zone Soil | VEMARRAGVRAIGVLGPFPTEKRLRAAHPEFLIDSIQELPDILKKLLR* |
| Ga0137360_100133921 | 3300012361 | Vadose Zone Soil | EDLEMARRAGVRPIAVLGPFPTEARLRAAKPDLLLSSITDLPAALRRLS* |
| Ga0137360_102108691 | 3300012361 | Vadose Zone Soil | PEDLQMARSANVRAAIAILGPFPTEKRLRAAKPDLLLESITELPTALLHFND* |
| Ga0137360_104525542 | 3300012361 | Vadose Zone Soil | RAGVRAIGVLGPFPTEKSLRAAQPEFLLESIDELPGVLRKMRG* |
| Ga0137390_118922752 | 3300012363 | Vadose Zone Soil | VRAIAVLGPFPTEARLRAAKPDVLLDSINELPDALRQL* |
| Ga0137358_101679533 | 3300012582 | Vadose Zone Soil | RRAGVRAIGVLGPFPTERRLRAARPEFLIGSIEELPDVLKKLLR* |
| Ga0137358_109814012 | 3300012582 | Vadose Zone Soil | MARRAGVRAIAVLGPFPTEARLRAAKPDLLLNSISELPDALRQL* |
| Ga0137398_1000233112 | 3300012683 | Vadose Zone Soil | RAGVRPIAVLGPFPTEARLRAAKPELLLDSITELPEALGQL* |
| Ga0137398_104417131 | 3300012683 | Vadose Zone Soil | EMARRAGVRAIGVLGPFPTERRLRAARPEFLIGSIEELPDVLKRLLR* |
| Ga0137395_104719291 | 3300012917 | Vadose Zone Soil | RAGVRAIGVLGLFSTKKRLRAAHPEFLIESIQELPDVLKKLLR* |
| Ga0137396_100122108 | 3300012918 | Vadose Zone Soil | ARRAGVRAIGVLGPFPTERRLRAARPEFLIGSIEELPDILKRLLR* |
| Ga0137396_105377011 | 3300012918 | Vadose Zone Soil | AGVAAIAVLGAFPIGPRLRAAKPEFLLPSIEHLPKLLQSF* |
| Ga0137394_102143904 | 3300012922 | Vadose Zone Soil | MAQRAGVRAIGVLGPFPTEKSLRAAQPEFLLESIDELPGVLKQLRG* |
| Ga0137394_103511781 | 3300012922 | Vadose Zone Soil | MAQRAGVRAIGVLGPFPTEKRLRAARPDFLLDSIEELPGVLKRLRG* |
| Ga0137359_114063911 | 3300012923 | Vadose Zone Soil | AGVRAIGVLGPFPTERRLRAARPEFLIGSIEELPNVLKKLLR* |
| Ga0137419_106131872 | 3300012925 | Vadose Zone Soil | EMARRAGVRAIGVLGPFPTERRLRAARPEFLIGSIEELPDILKRLLR* |
| Ga0137404_109623621 | 3300012929 | Vadose Zone Soil | RAIGVLGPFPTEKSLRAAQPEFLLESIDELPGVLKQMRG* |
| Ga0153915_117842751 | 3300012931 | Freshwater Wetlands | SPEDLQMAKSAGVRAIAVLGSFPTEKRLRAARPDFLLESIRELPEVLKSLGG* |
| Ga0153915_134300312 | 3300012931 | Freshwater Wetlands | QMARRAGVRAIGVLGPFPTEKRLRAARPDLLLGSIAELPGALHELLR* |
| Ga0126375_119925001 | 3300012948 | Tropical Forest Soil | MARRAGVQAAIAVLGPFPTEKRLRAAKPDLLLDSIEELPAALASFQD* |
| Ga0126369_106927062 | 3300012971 | Tropical Forest Soil | DSPEDLEMARRAGVRAAIAVLGPFPTEKRLREAKPDLLLDSSGELPTALARLQD* |
| Ga0126369_109067121 | 3300012971 | Tropical Forest Soil | QRTGVMAIGVLGPFPTEKRLRAARPEFLIYSLKELPSLLKHLCDGAS* |
| Ga0126369_128409141 | 3300012971 | Tropical Forest Soil | RRARVRAIAVLGPFPTEKRLRAAKPDLLLESISDLPAALRRLT* |
| Ga0134110_100149696 | 3300012975 | Grasslands Soil | VEMARSAGVLAIGVLGPYPTEKRLRAIRPEFLLGSLEELPEVLDRLRNGSK* |
| Ga0134076_101662502 | 3300012976 | Grasslands Soil | GDAPQDVEMARSAGVRAIGVLGPFPTEQRLRAARPEFLIGSLKELPNVLNWLRNGRE* |
| Ga0134076_106001752 | 3300012976 | Grasslands Soil | RRAGVRAIGVLGPFPTEKRLRAARPEFLIRSIEELPDVLKRFHR* |
| Ga0134076_106065651 | 3300012976 | Grasslands Soil | VEMARRAGVSAIGVLGPFPTEKRLRAAGPEFLIGSIEELPDTLKKLHC* |
| Ga0137405_10101012 | 3300015053 | Vadose Zone Soil | HDLEMARRAGVRGVAVLGRFPTEKGLRAAQPEFLLESITELPGILDDLGRES* |
| Ga0137418_102124392 | 3300015241 | Vadose Zone Soil | LRPSETVYVSDSPEALQMARSAGVRAAIAVLGPFPTESRLRAAKPDLLLDSISQLPAALLNFLD* |
| Ga0137403_108531062 | 3300015264 | Vadose Zone Soil | MARRAGVRAIGVLGLFPTEKGLRAEKPEILLSSLDELPEVLKNF* |
| Ga0134083_103025151 | 3300017659 | Grasslands Soil | ARRAGVRAIGVLGPFPTEKRLRAARPEFLIRSIEELPDVLKRFHR |
| Ga0187802_100026361 | 3300017822 | Freshwater Sediment | MRAVAVLGPFPTEKRLRAAKPAFLLDRLQDLPKLLESLDRNSSERH |
| Ga0187780_104124432 | 3300017973 | Tropical Peatland | VTAIAVLGPFPTEKRLRAAKPEYLLDRLEKLPALLKRIAGKHRK |
| Ga0187822_100115701 | 3300017994 | Freshwater Sediment | RSAGVRAAIAILGPFPTEKRLRAAKPDLLLESIEELPEALLTI |
| Ga0066667_100263625 | 3300018433 | Grasslands Soil | EMARSAGVLAIGVLGPYPTEKRLRAAQPEFLLGSLEELPEVLGRLRNGSR |
| Ga0066667_108357842 | 3300018433 | Grasslands Soil | MARSAGVRAAIAVLGPFPTEKRLRAAKPDALLESIEELPSALKLFV |
| Ga0066662_101703104 | 3300018468 | Grasslands Soil | YVGDAPEDVEMARRAGVAAIAVLGTFPIGPRLRAARPEFLLPSSEYLPKLLQSF |
| Ga0193733_10168601 | 3300020022 | Soil | VGDAPQDVEMAKRAGVRAIGVLGPFPTEKRLRAAHPEFLIGSIEELPDVLKRLLR |
| Ga0210403_100284229 | 3300020580 | Soil | AGVRAIGVLGPFPTEKRLRAAKPEFLMDSLEELPDLLKKLPRG |
| Ga0210403_101457394 | 3300020580 | Soil | GVRAIAVLGPFPTEKRLRAARPDFLLDSIRELPEALETLCS |
| Ga0210401_100556147 | 3300020583 | Soil | PEDLEMAKRAGVRAIAVLGPFPTEKRLRAARPDFLLKSIRELPETLKRLCG |
| Ga0210401_110060361 | 3300020583 | Soil | SPHDLEMARRAGVRAIAVLGRFPTEKGLRAARPEYLLDSITKIPAILDHLRSQP |
| Ga0210405_104320651 | 3300021171 | Soil | EMAESAGVRAIAVLGPFPTEKRLRAARPDFLLESIRELPEVLKRLGG |
| Ga0210393_100792141 | 3300021401 | Soil | DLEMARRAGVRAIAVLGRFPTEKGLRAARPEFLLDSITEIPALLDHLRE |
| Ga0210393_115317101 | 3300021401 | Soil | AGVRAIAVLGPFPTEKRLRAARPDFLLESIRELPDVLARLGG |
| Ga0210397_111295882 | 3300021403 | Soil | LEMARRAGVRAIAVLGRFPTEKGLRAARPEFLLDSITEIPALLDHLRE |
| Ga0210387_116807071 | 3300021405 | Soil | MEMAQRAGVRAIGVLGPFPTEKRLRAAKPFLLLDSIGELTKALEALLW |
| Ga0210386_102557702 | 3300021406 | Soil | MARRAGVRPIAVLGPFPTEARLRAAKPDLLLASIAELPEALRRLT |
| Ga0210383_110889521 | 3300021407 | Soil | AKSAGVRAIAVLGPFPTEKRLRAARPDFLLESIRELPETLKRLCG |
| Ga0126371_102705161 | 3300021560 | Tropical Forest Soil | PEDLQMARSAGVRAAIAVLGPFPTENRLRAAKPDALLESIEELPLALQSFL |
| Ga0137417_11796042 | 3300024330 | Vadose Zone Soil | VRAIGVLGPFPTEKRLRAARPEFLIASIQELPDILKKLLR |
| Ga0137417_12469342 | 3300024330 | Vadose Zone Soil | RAGVRAIGVLGPFPTEKRLRAARPEFLIASIQELPDILKKLLR |
| Ga0137417_14712401 | 3300024330 | Vadose Zone Soil | GVRAIGVLGPFPTEKRLRAARPEFLIASIQELPDILKKLLR |
| Ga0247668_10717192 | 3300024331 | Soil | ARSAGVRAAIAVLGPFPTEKRLRAAKPDALLESIEELPAALKFFL |
| Ga0207642_107121952 | 3300025899 | Miscanthus Rhizosphere | ARRAGVRAAIAVLGPFPTEKRLRAAKPDLLLESIEELPAALARFQN |
| Ga0207684_101508754 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | AAQDVEMAQRAGVRAIGVLGPFPTEKSLRAAQPEFLLKSIEELPGILKQLRG |
| Ga0209237_11061272 | 3300026297 | Grasslands Soil | AGVRAIAVLGPFPTHDGLRAVRPDALLSSIDQLPRLLKNY |
| Ga0209268_11256432 | 3300026314 | Soil | DVEMAKRAGVRAIGVLGPFPTEKRLRAAHPEFLIGSIEELPDVLKRLLR |
| Ga0209471_11006051 | 3300026318 | Soil | EMARRARVRAIAVLGPFPTHDGLRAVRPDALLSSIDQLPRLLKNY |
| Ga0209647_11494542 | 3300026319 | Grasslands Soil | AGVRAIGVLGPFPTEKRLRAAHPEFLIASIQELPDILKKLLR |
| Ga0257170_10593501 | 3300026351 | Soil | ARSAGVRAAIAILGPFPTERGLRAAKPDLLLESITKLPAALVQFRD |
| Ga0257163_10209042 | 3300026359 | Soil | MARRAGVRAIGVLGPFPTERRLRAARPEFLIGSIEELPDVLKRLLR |
| Ga0257171_10209452 | 3300026377 | Soil | APEDLQMARRTGVRAAIAVLGAFPTEKRLRAAKPDALLESIQELPKALEQFL |
| Ga0257172_10472642 | 3300026482 | Soil | VEMARRAGVRAIGVLGPFPTEKRLRAARPEFLIGSLEELPDVLKSLLR |
| Ga0257164_10188702 | 3300026497 | Soil | GVRAIGVLGPFPTERRLRAARPEFLIGSIEELPDVLKRLLR |
| Ga0209648_101575901 | 3300026551 | Grasslands Soil | RRAGVRPIAVLGPFPTEARLRAANPDLLLNSITELPAALRRL |
| Ga0209648_103133092 | 3300026551 | Grasslands Soil | EMARRAGVRAIGVLGPFPTEKRLREARPEFLIGSIEELPDVLKRLLR |
| Ga0179593_11832964 | 3300026555 | Vadose Zone Soil | MRLDPQDTVYVGDSPEDLQWPAAPACAPLSPSSAPFPPKKRLRAAKPDALLESIEELPHALREFY |
| Ga0208525_10108422 | 3300027288 | Soil | DAPEDLQMARSAGVRAAIAVLGPFPTEKRLRAAKPDALLESIEELPRALKEFL |
| Ga0209625_11224311 | 3300027635 | Forest Soil | SPEDVQMAKSAHVRVIGVLGPFPTEKRLRAAKPDLLLTSIADLPAALKQLAS |
| Ga0209117_11764161 | 3300027645 | Forest Soil | DVEMARRAGVRAIGVLGPFPTEKRLRAARPEFLISSIEELPDVLKLLHR |
| Ga0209217_11035042 | 3300027651 | Forest Soil | QMAKSAKVRVIGVLGPFPTEKRLRAAKPDLLLNSIAELPAALWQLAS |
| Ga0209388_10741771 | 3300027655 | Vadose Zone Soil | MARRAGVRPIAVLGPFPTEARLRAANPDLLLNSITELPAALRRL |
| Ga0208990_11002471 | 3300027663 | Forest Soil | MAQRAGVHAIGVLGPFPTEKRLRAAKPEFLLESIEELPGVLQRWRG |
| Ga0209580_102654571 | 3300027842 | Surface Soil | EDLQMARSAGVRAAIAILGPFPTEKRLRAAKPDLLLESIEELPEALLTI |
| Ga0209701_1000175720 | 3300027862 | Vadose Zone Soil | DLQMARSAGVRAAIAILGPFPTEKRLRAAKPDLLLESITELPAALLQFRD |
| Ga0209465_102249212 | 3300027874 | Tropical Forest Soil | QDVEMARSAGVLAIGVLGPYPTEKRLRAAKPEFLLSSLEELPDVLDRLEQRIKISPAFC |
| Ga0209415_110914661 | 3300027905 | Peatlands Soil | RRAGVRAIAVLGGFPTEKSLRAARPDLLLDSVRELPDALEQLRG |
| Ga0265354_10044123 | 3300028016 | Rhizosphere | EMAKRAGVRAIAVLGPFPTEKRLRAARPDFLLESIRELPELLKRLHG |
| (restricted) Ga0233417_104523411 | 3300028043 | Sediment | MARRAGVRAVAVLGPFPTHHRLRAARPIAVLESIRELPRMLLSLEQ |
| Ga0308309_103831272 | 3300028906 | Soil | AKSAGVRAIAVLGPFPTEKRLRAARPDFLLESIRELPDVLKRLGG |
| Ga0222749_107649291 | 3300029636 | Soil | LEMARRAGVRAIAVLGPFPTEKRVRAAKPELLLKSIEELPDALERLSG |
| Ga0265750_10082611 | 3300030813 | Soil | EDLEMAKRAGVRAIAVLGPFPTEKRLRAARPDFLLESIRELPELLKRLHG |
| Ga0170834_1036397781 | 3300031057 | Forest Soil | LEDLQMARSAGVRAAVAILGPFPTEKRLRAAKPDLLLESISELPAALLQFRD |
| Ga0170834_1137886821 | 3300031057 | Forest Soil | SPEDLQMARSAGVRAAIAILGPFPTEKRLRAAKPDLLLDSIDELPAALLRFRD |
| Ga0170824_1075253741 | 3300031231 | Forest Soil | EDLQMARSAGVRAAIAILGPFPTEKRLRAAKPDLLLDSIDELPAALLRFRD |
| Ga0307469_101756993 | 3300031720 | Hardwood Forest Soil | QMARSAGVRAAIAVLGPFPTEKRLRAAKPDALLESIEELPRVLKAFL |
| Ga0307469_122938212 | 3300031720 | Hardwood Forest Soil | MARRAGVRPIAVLGPFPTEARLRAAKPDLLLASITELPAALRRLT |
| Ga0307477_110177562 | 3300031753 | Hardwood Forest Soil | ARRARVRAIAVLGPFPTEARLRAAKPDLLLDSITDLPDALRQL |
| Ga0318566_105491192 | 3300031779 | Soil | DVEMAQRAGVRAIGVLGPFPTEKRLRAARPEFLIGSLKELPDVLNSLCNGRE |
| Ga0307473_112059341 | 3300031820 | Hardwood Forest Soil | VRAIGVLGPYPTEKRLRAAQPEFLLESLDELPGILKQLRG |
| Ga0318512_104070492 | 3300031846 | Soil | DAPQDVEMAQRAGVRAIGVLGPFPTEKRLRAARPEFLIGSLKELPDVLNSLCNGRE |
| Ga0306923_116365422 | 3300031910 | Soil | AGVRAVAVIGPFPTEKRLRAAEPEFLLDAVDELPALLKRLG |
| Ga0306926_120624892 | 3300031954 | Soil | SPEDLQMARSAGVRAIAVLGPFPTGKALRAAKPEVLLTSIAELPAALRELAV |
| Ga0307479_117071402 | 3300031962 | Hardwood Forest Soil | DLEMARRAGVRAIAVLGPFPTEARLRAANPDLLLHSITQLPAAVRNLTT |
| Ga0318553_107678351 | 3300032068 | Soil | AGVRAAIAVLGPFPTEKRLRAAKPDLLLDSIEELPAALARLQS |
| Ga0307471_1000167531 | 3300032180 | Hardwood Forest Soil | APQDVEMAQRAGVRAIGVLGPFPTEKRLRAARPEFLLESIEELPDVLKRLQY |
| Ga0307471_1015154532 | 3300032180 | Hardwood Forest Soil | RAGVRAIGVLGPFPTEKRLRAARPEFLLESLDELPGLLKRLRG |
| Ga0306920_1014109402 | 3300032261 | Soil | DSPEDLEMARSAGVRAIAVLGPFPTAKRLRTAKPEVLLRSIEELPAALLQIAD |
| Ga0335082_106000681 | 3300032782 | Soil | VYVGDAPEDLQMARSAGVRAAIAVLGPFPTEKRLRAAKPDALLESIEELPRALKEFL |
| Ga0318519_108484001 | 3300033290 | Soil | DLEMARNAGVRAIAVLGPFPTERRLRAAKPEVLLKSIEELPAALVNLAN |
| Ga0316624_102061221 | 3300033486 | Soil | MAKSAGVRAIAVLGRFPTEKRLRAARPDFLLESIRELPEALKEICG |
| ⦗Top⦘ |