| Basic Information | |
|---|---|
| Family ID | F032024 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 181 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MLTSTKSGVPEKDRNASVSAAEVMGRVVPHDQTWARSEPTTK |
| Number of Associated Samples | 110 |
| Number of Associated Scaffolds | 181 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 98.34 % |
| % of genes near scaffold ends (potentially truncated) | 98.34 % |
| % of genes from short scaffolds (< 2000 bps) | 90.06 % |
| Associated GOLD sequencing projects | 100 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.19 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (55.801 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (39.779 % of family members) |
| Environment Ontology (ENVO) | Unclassified (67.403 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.066 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 14.29% β-sheet: 0.00% Coil/Unstructured: 85.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.19 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 181 Family Scaffolds |
|---|---|---|
| PF04519 | Bactofilin | 24.31 |
| PF01527 | HTH_Tnp_1 | 1.66 |
| PF13408 | Zn_ribbon_recom | 1.10 |
| PF01408 | GFO_IDH_MocA | 1.10 |
| PF12161 | HsdM_N | 0.55 |
| PF02653 | BPD_transp_2 | 0.55 |
| PF13365 | Trypsin_2 | 0.55 |
| PF04828 | GFA | 0.55 |
| PF03551 | PadR | 0.55 |
| PF01292 | Ni_hydr_CYTB | 0.55 |
| PF02371 | Transposase_20 | 0.55 |
| PF04392 | ABC_sub_bind | 0.55 |
| PF12697 | Abhydrolase_6 | 0.55 |
| PF12974 | Phosphonate-bd | 0.55 |
| PF00589 | Phage_integrase | 0.55 |
| PF00072 | Response_reg | 0.55 |
| PF00550 | PP-binding | 0.55 |
| COG ID | Name | Functional Category | % Frequency in 181 Family Scaffolds |
|---|---|---|---|
| COG1664 | Cytoskeletal protein CcmA, bactofilin family | Cytoskeleton [Z] | 24.31 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.55 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.55 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.55 |
| COG1969 | Ni,Fe-hydrogenase I cytochrome b subunit | Energy production and conversion [C] | 0.55 |
| COG2864 | Cytochrome b subunit of formate dehydrogenase | Energy production and conversion [C] | 0.55 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.55 |
| COG3038 | Cytochrome b561 | Energy production and conversion [C] | 0.55 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.55 |
| COG3658 | Cytochrome b subunit of Ni2+-dependent hydrogenase | Energy production and conversion [C] | 0.55 |
| COG3791 | Uncharacterized conserved protein | Function unknown [S] | 0.55 |
| COG4117 | Thiosulfate reductase cytochrome b subunit | Inorganic ion transport and metabolism [P] | 0.55 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 55.80 % |
| Unclassified | root | N/A | 44.20 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000793|AF_2010_repII_A001DRAFT_10133760 | Not Available | 516 | Open in IMG/M |
| 3300000955|JGI1027J12803_100560585 | Not Available | 604 | Open in IMG/M |
| 3300005167|Ga0066672_10628664 | Not Available | 695 | Open in IMG/M |
| 3300005172|Ga0066683_10459204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 780 | Open in IMG/M |
| 3300005332|Ga0066388_100891215 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1469 | Open in IMG/M |
| 3300005332|Ga0066388_104070953 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 745 | Open in IMG/M |
| 3300005332|Ga0066388_105947878 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300005436|Ga0070713_100565736 | Not Available | 1077 | Open in IMG/M |
| 3300005467|Ga0070706_100270635 | All Organisms → cellular organisms → Bacteria | 1585 | Open in IMG/M |
| 3300005467|Ga0070706_100611524 | Not Available | 1012 | Open in IMG/M |
| 3300005467|Ga0070706_101308652 | Not Available | 664 | Open in IMG/M |
| 3300005536|Ga0070697_101020626 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300005555|Ga0066692_10872558 | Not Available | 552 | Open in IMG/M |
| 3300005713|Ga0066905_101219386 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 673 | Open in IMG/M |
| 3300005713|Ga0066905_101522871 | Not Available | 610 | Open in IMG/M |
| 3300005764|Ga0066903_104942381 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 708 | Open in IMG/M |
| 3300005764|Ga0066903_105580920 | Not Available | 662 | Open in IMG/M |
| 3300005764|Ga0066903_106305064 | Not Available | 619 | Open in IMG/M |
| 3300005764|Ga0066903_106320799 | Not Available | 618 | Open in IMG/M |
| 3300005764|Ga0066903_106360268 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300005764|Ga0066903_106379410 | Not Available | 615 | Open in IMG/M |
| 3300005764|Ga0066903_108633914 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 518 | Open in IMG/M |
| 3300006028|Ga0070717_10127442 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2186 | Open in IMG/M |
| 3300006172|Ga0075018_10070282 | All Organisms → cellular organisms → Bacteria | 1500 | Open in IMG/M |
| 3300006175|Ga0070712_101815738 | Not Available | 534 | Open in IMG/M |
| 3300006177|Ga0075362_10031583 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2293 | Open in IMG/M |
| 3300006871|Ga0075434_101924254 | Not Available | 597 | Open in IMG/M |
| 3300006953|Ga0074063_10122320 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 764 | Open in IMG/M |
| 3300009012|Ga0066710_102868233 | Not Available | 678 | Open in IMG/M |
| 3300010046|Ga0126384_11225445 | Not Available | 693 | Open in IMG/M |
| 3300010047|Ga0126382_11073655 | Not Available | 711 | Open in IMG/M |
| 3300010360|Ga0126372_12809201 | Not Available | 539 | Open in IMG/M |
| 3300010366|Ga0126379_11838052 | Not Available | 709 | Open in IMG/M |
| 3300010366|Ga0126379_11863079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 705 | Open in IMG/M |
| 3300010366|Ga0126379_12854323 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 578 | Open in IMG/M |
| 3300012350|Ga0137372_11188031 | Not Available | 516 | Open in IMG/M |
| 3300012355|Ga0137369_11011037 | Not Available | 550 | Open in IMG/M |
| 3300012360|Ga0137375_10347253 | Not Available | 1319 | Open in IMG/M |
| 3300012360|Ga0137375_10742546 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 796 | Open in IMG/M |
| 3300012923|Ga0137359_11286708 | Not Available | 619 | Open in IMG/M |
| 3300012960|Ga0164301_10941607 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 674 | Open in IMG/M |
| 3300016270|Ga0182036_11937317 | Not Available | 500 | Open in IMG/M |
| 3300016294|Ga0182041_10162168 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1739 | Open in IMG/M |
| 3300016294|Ga0182041_10288917 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1353 | Open in IMG/M |
| 3300016319|Ga0182033_10285703 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1355 | Open in IMG/M |
| 3300016357|Ga0182032_11440371 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 597 | Open in IMG/M |
| 3300016357|Ga0182032_11818476 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 532 | Open in IMG/M |
| 3300016371|Ga0182034_10751894 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300016371|Ga0182034_11166378 | Not Available | 669 | Open in IMG/M |
| 3300016371|Ga0182034_11576040 | Not Available | 576 | Open in IMG/M |
| 3300016371|Ga0182034_11634089 | Not Available | 566 | Open in IMG/M |
| 3300016387|Ga0182040_11431357 | Not Available | 586 | Open in IMG/M |
| 3300016404|Ga0182037_10342196 | Not Available | 1216 | Open in IMG/M |
| 3300016404|Ga0182037_10618616 | Not Available | 920 | Open in IMG/M |
| 3300016404|Ga0182037_11083799 | Not Available | 700 | Open in IMG/M |
| 3300016404|Ga0182037_12117635 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 506 | Open in IMG/M |
| 3300016422|Ga0182039_10509281 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1040 | Open in IMG/M |
| 3300016422|Ga0182039_10664175 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 916 | Open in IMG/M |
| 3300016422|Ga0182039_11177783 | Not Available | 692 | Open in IMG/M |
| 3300016445|Ga0182038_10637374 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 923 | Open in IMG/M |
| 3300016445|Ga0182038_11467177 | Not Available | 612 | Open in IMG/M |
| 3300018071|Ga0184618_10190822 | Not Available | 853 | Open in IMG/M |
| 3300018082|Ga0184639_10125375 | All Organisms → cellular organisms → Bacteria | 1362 | Open in IMG/M |
| 3300019867|Ga0193704_1040204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 932 | Open in IMG/M |
| 3300021432|Ga0210384_10215123 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1729 | Open in IMG/M |
| 3300021560|Ga0126371_10736192 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1133 | Open in IMG/M |
| 3300021560|Ga0126371_12888935 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300025898|Ga0207692_10120328 | Not Available | 1469 | Open in IMG/M |
| 3300025910|Ga0207684_11386418 | Not Available | 576 | Open in IMG/M |
| 3300025922|Ga0207646_10633681 | Not Available | 958 | Open in IMG/M |
| 3300025934|Ga0207686_10350124 | Not Available | 1112 | Open in IMG/M |
| 3300026547|Ga0209156_10251801 | Not Available | 819 | Open in IMG/M |
| 3300027548|Ga0209523_1087057 | Not Available | 645 | Open in IMG/M |
| 3300027874|Ga0209465_10092926 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1476 | Open in IMG/M |
| 3300027907|Ga0207428_11282908 | Not Available | 508 | Open in IMG/M |
| 3300028047|Ga0209526_10067625 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2513 | Open in IMG/M |
| 3300028878|Ga0307278_10023061 | All Organisms → cellular organisms → Bacteria | 2868 | Open in IMG/M |
| 3300029636|Ga0222749_10239375 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 920 | Open in IMG/M |
| 3300031446|Ga0170820_13087846 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 568 | Open in IMG/M |
| 3300031543|Ga0318516_10440915 | Not Available | 749 | Open in IMG/M |
| 3300031546|Ga0318538_10204274 | Not Available | 1055 | Open in IMG/M |
| 3300031561|Ga0318528_10500590 | Not Available | 652 | Open in IMG/M |
| 3300031572|Ga0318515_10353740 | Not Available | 787 | Open in IMG/M |
| 3300031573|Ga0310915_10301030 | Not Available | 1133 | Open in IMG/M |
| 3300031573|Ga0310915_10547229 | Not Available | 821 | Open in IMG/M |
| 3300031668|Ga0318542_10109319 | Not Available | 1343 | Open in IMG/M |
| 3300031668|Ga0318542_10423394 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300031679|Ga0318561_10046605 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium GAS191 | 2155 | Open in IMG/M |
| 3300031719|Ga0306917_10914062 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 686 | Open in IMG/M |
| 3300031723|Ga0318493_10284095 | Not Available | 890 | Open in IMG/M |
| 3300031736|Ga0318501_10047789 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium GAS191 | 1985 | Open in IMG/M |
| 3300031744|Ga0306918_10032182 | All Organisms → cellular organisms → Bacteria | 3328 | Open in IMG/M |
| 3300031744|Ga0306918_10149091 | Not Available | 1725 | Open in IMG/M |
| 3300031744|Ga0306918_10989672 | Not Available | 653 | Open in IMG/M |
| 3300031747|Ga0318502_10141774 | Not Available | 1365 | Open in IMG/M |
| 3300031747|Ga0318502_10971078 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 517 | Open in IMG/M |
| 3300031768|Ga0318509_10046631 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2192 | Open in IMG/M |
| 3300031768|Ga0318509_10304643 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 891 | Open in IMG/M |
| 3300031768|Ga0318509_10425447 | Not Available | 742 | Open in IMG/M |
| 3300031770|Ga0318521_10811052 | Not Available | 570 | Open in IMG/M |
| 3300031770|Ga0318521_10825695 | Not Available | 565 | Open in IMG/M |
| 3300031771|Ga0318546_10015035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4262 | Open in IMG/M |
| 3300031771|Ga0318546_10291475 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1128 | Open in IMG/M |
| 3300031777|Ga0318543_10352228 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 659 | Open in IMG/M |
| 3300031778|Ga0318498_10251625 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 796 | Open in IMG/M |
| 3300031780|Ga0318508_1001742 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3939 | Open in IMG/M |
| 3300031792|Ga0318529_10109335 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1253 | Open in IMG/M |
| 3300031793|Ga0318548_10435580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 642 | Open in IMG/M |
| 3300031794|Ga0318503_10024787 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium GAS191 | 1720 | Open in IMG/M |
| 3300031794|Ga0318503_10239537 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 588 | Open in IMG/M |
| 3300031796|Ga0318576_10313793 | Not Available | 741 | Open in IMG/M |
| 3300031797|Ga0318550_10535016 | Not Available | 564 | Open in IMG/M |
| 3300031798|Ga0318523_10539980 | Not Available | 576 | Open in IMG/M |
| 3300031805|Ga0318497_10156969 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1247 | Open in IMG/M |
| 3300031819|Ga0318568_10063046 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2162 | Open in IMG/M |
| 3300031819|Ga0318568_10142704 | Not Available | 1460 | Open in IMG/M |
| 3300031821|Ga0318567_10458284 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 723 | Open in IMG/M |
| 3300031833|Ga0310917_10044148 | All Organisms → cellular organisms → Bacteria | 2707 | Open in IMG/M |
| 3300031833|Ga0310917_10360857 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 986 | Open in IMG/M |
| 3300031833|Ga0310917_10644439 | Not Available | 718 | Open in IMG/M |
| 3300031833|Ga0310917_10982412 | Not Available | 566 | Open in IMG/M |
| 3300031833|Ga0310917_11010336 | Not Available | 557 | Open in IMG/M |
| 3300031835|Ga0318517_10008840 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium GAS191 | 3524 | Open in IMG/M |
| 3300031845|Ga0318511_10567631 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 528 | Open in IMG/M |
| 3300031846|Ga0318512_10053687 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1805 | Open in IMG/M |
| 3300031879|Ga0306919_11406588 | Not Available | 526 | Open in IMG/M |
| 3300031890|Ga0306925_10108184 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Gluconacetobacter → Gluconacetobacter diazotrophicus → Gluconacetobacter diazotrophicus PA1 5 | 2964 | Open in IMG/M |
| 3300031890|Ga0306925_10260776 | All Organisms → cellular organisms → Bacteria | 1867 | Open in IMG/M |
| 3300031896|Ga0318551_10782415 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300031897|Ga0318520_10033043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2602 | Open in IMG/M |
| 3300031897|Ga0318520_10178146 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1245 | Open in IMG/M |
| 3300031897|Ga0318520_10690144 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300031910|Ga0306923_10055283 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4393 | Open in IMG/M |
| 3300031910|Ga0306923_10315372 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 200 | 1785 | Open in IMG/M |
| 3300031910|Ga0306923_10702526 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1125 | Open in IMG/M |
| 3300031910|Ga0306923_12326696 | Not Available | 533 | Open in IMG/M |
| 3300031910|Ga0306923_12446037 | Not Available | 516 | Open in IMG/M |
| 3300031912|Ga0306921_10223582 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2206 | Open in IMG/M |
| 3300031912|Ga0306921_11169296 | Not Available | 858 | Open in IMG/M |
| 3300031912|Ga0306921_12067363 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 604 | Open in IMG/M |
| 3300031912|Ga0306921_12118211 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 595 | Open in IMG/M |
| 3300031912|Ga0306921_12272581 | Not Available | 569 | Open in IMG/M |
| 3300031942|Ga0310916_10210955 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1628 | Open in IMG/M |
| 3300031946|Ga0310910_10007250 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6727 | Open in IMG/M |
| 3300031946|Ga0310910_11508553 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 515 | Open in IMG/M |
| 3300031947|Ga0310909_11324228 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 578 | Open in IMG/M |
| 3300031947|Ga0310909_11479697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 541 | Open in IMG/M |
| 3300031954|Ga0306926_10664737 | All Organisms → cellular organisms → Bacteria | 1266 | Open in IMG/M |
| 3300031954|Ga0306926_11575272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 755 | Open in IMG/M |
| 3300031954|Ga0306926_11596921 | Not Available | 748 | Open in IMG/M |
| 3300031959|Ga0318530_10501751 | Not Available | 504 | Open in IMG/M |
| 3300031981|Ga0318531_10236485 | Not Available | 824 | Open in IMG/M |
| 3300031981|Ga0318531_10535900 | Not Available | 530 | Open in IMG/M |
| 3300032001|Ga0306922_10383689 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1506 | Open in IMG/M |
| 3300032001|Ga0306922_11323909 | Not Available | 727 | Open in IMG/M |
| 3300032001|Ga0306922_11345234 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 720 | Open in IMG/M |
| 3300032001|Ga0306922_11994667 | Not Available | 565 | Open in IMG/M |
| 3300032025|Ga0318507_10146852 | Not Available | 1006 | Open in IMG/M |
| 3300032025|Ga0318507_10248693 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 771 | Open in IMG/M |
| 3300032025|Ga0318507_10325953 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 668 | Open in IMG/M |
| 3300032035|Ga0310911_10919368 | Not Available | 504 | Open in IMG/M |
| 3300032039|Ga0318559_10110408 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1225 | Open in IMG/M |
| 3300032043|Ga0318556_10669614 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 540 | Open in IMG/M |
| 3300032055|Ga0318575_10069006 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium GAS191 | 1664 | Open in IMG/M |
| 3300032060|Ga0318505_10396909 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 652 | Open in IMG/M |
| 3300032060|Ga0318505_10526134 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 557 | Open in IMG/M |
| 3300032063|Ga0318504_10200005 | Not Available | 932 | Open in IMG/M |
| 3300032063|Ga0318504_10471763 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 600 | Open in IMG/M |
| 3300032066|Ga0318514_10093529 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1516 | Open in IMG/M |
| 3300032068|Ga0318553_10200433 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1040 | Open in IMG/M |
| 3300032076|Ga0306924_10611638 | Not Available | 1232 | Open in IMG/M |
| 3300032076|Ga0306924_11879462 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 621 | Open in IMG/M |
| 3300032090|Ga0318518_10184135 | Not Available | 1067 | Open in IMG/M |
| 3300032094|Ga0318540_10325928 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 741 | Open in IMG/M |
| 3300032094|Ga0318540_10353154 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 710 | Open in IMG/M |
| 3300032261|Ga0306920_100204179 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Gluconacetobacter → Gluconacetobacter diazotrophicus → Gluconacetobacter diazotrophicus PA1 5 | 2949 | Open in IMG/M |
| 3300032261|Ga0306920_101350461 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1023 | Open in IMG/M |
| 3300032261|Ga0306920_101795933 | Not Available | 865 | Open in IMG/M |
| 3300032261|Ga0306920_101853078 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 849 | Open in IMG/M |
| 3300032261|Ga0306920_102295911 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 747 | Open in IMG/M |
| 3300032261|Ga0306920_102841947 | Not Available | 658 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 39.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 28.73% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 7.18% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.52% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.42% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.66% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.10% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.10% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.10% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.10% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.55% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.55% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.55% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.55% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006177 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300019867 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m1 | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300027548 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AF_2010_repII_A001DRAFT_101337601 | 3300000793 | Forest Soil | MLTSTKNGAPEKDRSASVGAADVIGRVVQHDQTWAKSEPTKAGMAS |
| JGI1027J12803_1005605851 | 3300000955 | Soil | MLTTKNGAPEKDRNASVGAAEVIGRVVQHDQWARS |
| Ga0066672_106286641 | 3300005167 | Soil | MLNSMKSSATEKDRNAAANAPEIMGRMVQPHDQAWARSEPTTKAGTASC |
| Ga0066683_104592042 | 3300005172 | Soil | MLSSIKSSAPEKDRTAAANAAEVLAGTVQPHDQAWARSEPTTK |
| Ga0066388_1008912153 | 3300005332 | Tropical Forest Soil | MLNSMKSGAPETSKNAAASVAEVIGRTVQPHDHAWAGSEPT |
| Ga0066388_1040709531 | 3300005332 | Tropical Forest Soil | MLTSTKSGVPEKDKNTSVSAAEVMGRVMHHDQTWARSEPTTKAGMASCIGS |
| Ga0066388_1059478781 | 3300005332 | Tropical Forest Soil | MLISTKSGAPEKDRNASVSAAESRVVPHDQTWARSEPTTKA |
| Ga0070713_1005657362 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MLTSTRSGVPEKDKNASVSAAEVMGRVAPHDQTWARSEPTTK |
| Ga0070706_1002706351 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MLISTKSGALPEKDRNASVSAAEVMGRVVPHDQTWARSEPTTKAGTASC |
| Ga0070706_1006115242 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MLTSTKSGVPEKDRNASVSAAEVMGRVVPHDQTWARSEPTTKAGTASC |
| Ga0070706_1013086521 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MLISTKSGAPEKDRNASVSAAEVMGRVVPHDQAWAGSEPTTRAG |
| Ga0070697_1010206262 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MLTSTKSGVPEKDRNASVSAAEVMGRVVPHDQTWARSEPTTK |
| Ga0066692_108725582 | 3300005555 | Soil | MLTSTKNGAPEKDRNASVNAADVIGRVVQHDQTWAKSEPTTK |
| Ga0066905_1012193861 | 3300005713 | Tropical Forest Soil | MLISTKSGAPEKDRNGPVSAAEVMGRVVPHDQTWARSEPTTKAGTASC |
| Ga0066905_1015228711 | 3300005713 | Tropical Forest Soil | MLTSPKNGAPEKDRTASVGATEVMGRVVQHDQWARSEPTTKAGMASCIGS |
| Ga0066903_1049423812 | 3300005764 | Tropical Forest Soil | MLNSMKSSAPEKDKNAAANAAEVVGRTVQPHDQAWARSEPTTK |
| Ga0066903_1055809203 | 3300005764 | Tropical Forest Soil | MLTNTKSGVPEKDRNASVSAAEVIGRVVQHDQTWAKSEPTTKA |
| Ga0066903_1063050641 | 3300005764 | Tropical Forest Soil | MLNSMKNSATEKDKNAAANAVEIMERTVQPHDQAWARSDPTTKAGT |
| Ga0066903_1063207992 | 3300005764 | Tropical Forest Soil | MLTSTKSGVPEKDRNASVGAAEVIGRVVQHDQTWAKSEPTTKAGMASCI |
| Ga0066903_1063602681 | 3300005764 | Tropical Forest Soil | MWSTKSGAPEKERNASVGAAEVMGRAVPHDQSWARSEPTTK |
| Ga0066903_1063794101 | 3300005764 | Tropical Forest Soil | MLNSMKSGAPEKDKSAAANAPEVMGRMVQPHDQTWARSE |
| Ga0066903_1086339142 | 3300005764 | Tropical Forest Soil | MLNSTKSGVPEKDKNAAANAAEVMGRTVQPHDQAWARSEPT |
| Ga0070717_101274421 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MLTSTKSGVPEKDRNASVSAAEVMGRVVPHDQTWARSEPTTKAGT |
| Ga0075018_100702821 | 3300006172 | Watersheds | MLTSMRSGVPEKDKNSSVSAAEVMGRVAPHDQAWARSEPTTKAGTASC |
| Ga0070712_1018157381 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MLTSTKSGVPETDRNASVSAAEVIGRVVQHDQTWARSEPTTKA |
| Ga0075362_100315831 | 3300006177 | Populus Endosphere | MLTSTKNGAPEKDRNASVGAAEVIGRVVQHDQWARSEPTTKAGMASCIGSD |
| Ga0075434_1019242541 | 3300006871 | Populus Rhizosphere | MLTGTKNGAPEKDRAASVGAAEVISRVVQHDQWARSESTTKGGMSSCI |
| Ga0074063_101223203 | 3300006953 | Soil | MLISTKSGVPEKDRNASVSAAEVVGRVVQHDQTWARSEPTTK |
| Ga0066710_1028682331 | 3300009012 | Grasslands Soil | MLTSTKSGVPETDRNASVSAAEVIGRVVQHDQTWAKSEPTTKAGMAS |
| Ga0126384_112254451 | 3300010046 | Tropical Forest Soil | MLTSTKSGAPEKDRNASVSAAEVMGRVVPHDQAWAGSEPTTR |
| Ga0126382_110736551 | 3300010047 | Tropical Forest Soil | MDIFICTKRAAPEKDRNASVGAAEVMGRVVPHDQTW |
| Ga0126372_128092011 | 3300010360 | Tropical Forest Soil | MLISTKSGVPEKDKNAAANAAEVMGRTVQPHDQAWAKSEPTTQA |
| Ga0126379_118380522 | 3300010366 | Tropical Forest Soil | MLISTKSGAPEKDRNASLGAAEIMGRVVPHDQWARSE |
| Ga0126379_118630792 | 3300010366 | Tropical Forest Soil | MLNSMKNDVTEKDKNVAEDAAEVMRGTVQPHDQGLTRSE |
| Ga0126379_128543231 | 3300010366 | Tropical Forest Soil | MLNSTKSGVPEKDKNAAANAAEVMGRTVQHDQTWARSEPTKAGTASCI |
| Ga0137372_111880312 | 3300012350 | Vadose Zone Soil | MLNSTKSGGPEKDKNAAANAAEVIGTRVQPHDQACARSEPATKGG |
| Ga0137369_110110371 | 3300012355 | Vadose Zone Soil | MLTSTKNGVPEKDRNASVSAAEVVIGRVVQHDQT* |
| Ga0137375_103472534 | 3300012360 | Vadose Zone Soil | MKSGVPEKDKNATANAPEVLGRTVQPHDQAWARSEP |
| Ga0137375_107425462 | 3300012360 | Vadose Zone Soil | MLNSMKSGVPEKDKNATANALEVLGRTVQPHDQAWARSEPTTKAGTASC |
| Ga0137359_112867081 | 3300012923 | Vadose Zone Soil | LNSMKSSAPEKDRNAAANATEVMGRTVQPHDQAWARSE |
| Ga0164301_109416071 | 3300012960 | Soil | MKEVEMLNSMKSSAPEKDKNAAANAAEIMERTVQPHDQAWARSDPTTKAGTSS |
| Ga0182036_119373171 | 3300016270 | Soil | MLISTKSGAPEKDKNGPVSAAEVMGKVVPHDQTWARSEPTTKAGTASC |
| Ga0182041_101621681 | 3300016294 | Soil | MLTSTKSGVPEKDRNASVSAAEVIGRVVQHDQTWAK |
| Ga0182041_102889173 | 3300016294 | Soil | MLNSTKSGTPEKDRSVAANAPEVLGRTVQPHDQAWARS |
| Ga0182033_102857031 | 3300016319 | Soil | MLTSTKSGVPETDRNASVSAAEVIGRVVQHDQTWAKSEPTTKAGMASCI |
| Ga0182032_114403712 | 3300016357 | Soil | MLNSTKSGVPEKDKNATANAAEVMGRTVQPHDQTWARSE |
| Ga0182032_118184761 | 3300016357 | Soil | MLNSMKSGVTEKDKNAAANAPEVMGRMVQPHDQAWAGSEPT |
| Ga0182034_107518941 | 3300016371 | Soil | MLSTKSGAPEKERNASVGAAEVMGRAVPHDQSWARSEPTTKA |
| Ga0182034_111663781 | 3300016371 | Soil | MLISTKSGAPEKDRNASVSAADVMGRVVPHDQTWARSEL |
| Ga0182034_115760401 | 3300016371 | Soil | MLTSTKSGTPEKDRNASVSAAEVMGRVVQHDQTWAKSEP |
| Ga0182034_116340891 | 3300016371 | Soil | MLNSMKNSATEKDRNAAANAPEIMGRMVQPHDQAWARSEPTTKAGTASC |
| Ga0182040_114313571 | 3300016387 | Soil | MLNSMKSGASEKDRSVAANAPEVMGRTVQPHDQAWARSE |
| Ga0182037_103421962 | 3300016404 | Soil | MLTSTKSGVPEKDKNTSVSAAEVMGRVMHHDQTWARSE |
| Ga0182037_106186161 | 3300016404 | Soil | MLTSTKSGTPEKDRNASVSAAEVMGRVMQHDQTWAKSEPTTKAGM |
| Ga0182037_110837992 | 3300016404 | Soil | MLNSMKTGASEKDKNAAANAAEVMGGTVQPHDQAWARSEPTTKAGTA |
| Ga0182037_121176351 | 3300016404 | Soil | MFNSMKSGAPEKSKNAAASVAEVIGRTVQPHDHAWAGS |
| Ga0182039_105092811 | 3300016422 | Soil | MLNSMKSGVPEKDKNATASAPEVLGRTVQPHDQAWARSEPTTKAGTA |
| Ga0182039_106641751 | 3300016422 | Soil | MLTSTKSGVPEKDRNASVGAAEVMGRVAPHDQWPRSEPTTKAG |
| Ga0182039_111777831 | 3300016422 | Soil | MLTSTKSGVPEKDRNASVSAADVIGRVVPHDQTWA |
| Ga0182038_106373741 | 3300016445 | Soil | MLTSTKSGVPETDRNASVSAAEVIGRVVQHDQTWAKSEPTTKAGMASCIGSD |
| Ga0182038_114671771 | 3300016445 | Soil | MLTSTKSGVPEKDRNASVSAAEVIGRVVQHDQTWAKSEPTTKAGMASCIGSD |
| Ga0184618_101908221 | 3300018071 | Groundwater Sediment | VLTSTNNGVPEKDGNPSIGAAEVIGRVVRHDQWARSEPTTKA |
| Ga0184639_101253753 | 3300018082 | Groundwater Sediment | MLTSTKNGAPERDRNPSVGAAEVIGRVVHHDQWTRSEPTTKAGMASCIGS |
| Ga0193704_10402042 | 3300019867 | Soil | MLTSTKNGAPEKDRNASVGAAEVIGRVVHHDQWARSEPATKAGMASC |
| Ga0210384_102151233 | 3300021432 | Soil | MLTSTRSGVPEKDKNASVSAAEVMGRVAPHDQTWA |
| Ga0126371_107361922 | 3300021560 | Tropical Forest Soil | MLTSTKSGVPEKDKNASVSAAEVMGRVAPHDQTWARS |
| Ga0126371_128889352 | 3300021560 | Tropical Forest Soil | MWSTKSGAPEKERNASVGAAEVMGRAVPHDQSWARS |
| Ga0207692_101203281 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MLISTKSGAPEKDRNASLSAAEVMGRVVPHGQWARSEPTTKAGM |
| Ga0207684_113864182 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MLISTKSGAPEKDRNVAANAPEIMERMVQPHDQAWARSEPTTKAG |
| Ga0207646_106336811 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MLNSMKSGVPEKDKYAAANAPEVLGRTVQPHDQAWARSEPMTKAG |
| Ga0207686_103501241 | 3300025934 | Miscanthus Rhizosphere | MLISTKSGAPEKDRNASLSAAEVMGRVVPHDQWARSEPTTKAGMASC |
| Ga0209156_102518012 | 3300026547 | Soil | MLINTKSGAPEKDRNASLSAAEVMGRVVPHDQWARSEPT |
| Ga0209523_10870571 | 3300027548 | Forest Soil | MLTSTKSGVPETDRNASVSAAEVMGRVVPHDQTWARSEP |
| Ga0209465_100929261 | 3300027874 | Tropical Forest Soil | MLTSTKSGVPEKDRNASVSAAEVIGRVVQHDQSWARSEPTTTTG |
| Ga0207428_112829081 | 3300027907 | Populus Rhizosphere | MLTSTKSGAPDKDRNASVSAAEVMGRVVQHDQTWARSEPMTKTGT |
| Ga0209526_100676255 | 3300028047 | Forest Soil | MLNSMKSGAPEKNKNAAASVAEVIGKTVQPHDQAWAG |
| Ga0307278_100230611 | 3300028878 | Soil | MLTSTKNGAPEKDRNASVGAAEVIGRVVHHDQWARSEPATKAGMASCIGSE |
| Ga0222749_102393751 | 3300029636 | Soil | MLNSMKSGAPEKNKNAAASVAEVIGKTVQPHDQAWAGSEPTTKA |
| Ga0170820_130878462 | 3300031446 | Forest Soil | EMLNSTKSGVPEKDKNVVADTAEVTGRSMPPHDQV |
| Ga0318516_104409151 | 3300031543 | Soil | MLISTKSGAPEKDRNASLSAAEVMGRVVPHEQTWARSEPSTKAGTASC |
| Ga0318538_102042743 | 3300031546 | Soil | MLTSMRSGVPEKDKNASVSAAEVMGRVAPHDQAWARSEPTTK |
| Ga0318528_105005901 | 3300031561 | Soil | MLTSTKNGAPEKDGNASVGAAEVMGRVVQHDQWPRSEPTTKAGMASC |
| Ga0318515_103537402 | 3300031572 | Soil | MLTSTKSGVPEKDRNASVGAAEVMGRVVQHDQTWAKSEPTTKAGMASCIG |
| Ga0310915_103010301 | 3300031573 | Soil | MLTSTKSGVPEKDKNTSVSAAEVMGRVMHHDQTWARSESTTKAGMASCIGS |
| Ga0310915_105472291 | 3300031573 | Soil | MLTSTKSSVPEKDRNASVSAADVIGRVVPHDQTWAKSEPTTKAEMASCIG |
| Ga0318542_101093191 | 3300031668 | Soil | MLNSMKSGAPEKDKSVAANAPDVMGRMVQPHDQAWARSEP |
| Ga0318542_104233942 | 3300031668 | Soil | MLSTKSGAPEKERNASVGAAEVMGRAVPHDQSWARSEP |
| Ga0318561_100466051 | 3300031679 | Soil | MLTSTKSGAPEKDRNASVGAAEVMGRVVQHDQTWAKLGPTTRAGMASCIGSDM |
| Ga0306917_109140622 | 3300031719 | Soil | MLNSMKSSAPEKDKNAAANAAEIMGRTVQPHDQAGSDPTTKAG |
| Ga0318493_102840951 | 3300031723 | Soil | MLTSTKSGVPEKDRNASVSAAEVIGRVQHDQTWAKSEPTTNAGMASCIGS |
| Ga0318501_100477891 | 3300031736 | Soil | MLTSTKSGAPEKDRNASVGAAEVMGRVVQHDQTWAKLGPTTRAGMASC |
| Ga0306918_100321828 | 3300031744 | Soil | MLISTKSGAPEKDRNASVGAAEVMGRVVPHDQTWARSEPTTKAGTASCIGSD |
| Ga0306918_101490912 | 3300031744 | Soil | MLTSTKSGVPEKDKNTSVSAAEVMGRVMHHDQTWARSES |
| Ga0306918_109896722 | 3300031744 | Soil | MLTSTKSGVPEKDRNASVSAAEVIGRIVQHDQTWAKSEPTTKAGM |
| Ga0318502_101417741 | 3300031747 | Soil | MLTSTKSGAPEKDRNASVGAAEVMGRVVQHDQTWAKLGPTTRAGMASCIG |
| Ga0318502_109710782 | 3300031747 | Soil | MLNSMKSSATEKDRNAAATAPEVLGRTVQPHDQAWARSEPTTKA |
| Ga0318509_100466311 | 3300031768 | Soil | MLISTKSGAPEKDRNASLSAAEVMGRVVPHEQTWARSEPSTKAGTASCIGSD |
| Ga0318509_103046432 | 3300031768 | Soil | MLKSGVPEKDKNATATAPEVLGRTMQSHDQAWARSEPTT |
| Ga0318509_104254471 | 3300031768 | Soil | MLTSTKSGVPEKDRNASVGAAEVMGRVVQHDQTWAKSEP |
| Ga0318521_108110521 | 3300031770 | Soil | MLTSTKNGAPEKDRNASVGAAEVMGRVVQHDQWARSEPTTKAGMASCI |
| Ga0318521_108256952 | 3300031770 | Soil | MLTSMRSGVPEKDKNASVSAAEVMGRVAPHDQAWA |
| Ga0318546_100150356 | 3300031771 | Soil | MLNSTKSGVPEKDKNATANAAEVMGRTVQPHDQTWARSEPTKAG |
| Ga0318546_102914752 | 3300031771 | Soil | LTSTKSGVPEKDRNASVSAAEVIGRIVQHDQTWAKSE |
| Ga0318543_103522281 | 3300031777 | Soil | MLNSMKSSAPEKDKNAAANAAEIMGRTVQPHDQAGSDPTTKAGTASC |
| Ga0318498_102516251 | 3300031778 | Soil | MLNSTKSGVPEKDKNATANAAEVMGRTVQPHDQTWARSEPTKAGTAS |
| Ga0318508_10017426 | 3300031780 | Soil | MLNSTKSGVPEKDKNATANAAEVMGRTVQPHDQTW |
| Ga0318529_101093352 | 3300031792 | Soil | MLNSMKSGVPEKDKNATVNAPEVLGRTVQPHDQAWAR |
| Ga0318548_104355801 | 3300031793 | Soil | MLNSMKTDVLEKDKNSAANAAEVMGRTAQPHDQAWARSEPTKAGTASC |
| Ga0318503_100247874 | 3300031794 | Soil | MLTSTKSGAPEKDRNASVGAAEVMGRVVQHDQTWAKLGPTTRAGMAS |
| Ga0318503_102395372 | 3300031794 | Soil | MLNSTKSGVPEKDKNATANAAEVMGRTVQPHDQTWARSEPTKAGTASCIGS |
| Ga0318576_103137932 | 3300031796 | Soil | MLISTKSGAPEKDRNASLSAAEVMGRVVPHEQTWARS |
| Ga0318550_105350161 | 3300031797 | Soil | MLTSTKNGAPEKDGNASVGAAEVMGRVVQHDQWPRSE |
| Ga0318523_105399801 | 3300031798 | Soil | MLNSMKSGAPEKDKSVAANAPDVMGRMVQPHDQAWARSEPTTKAGTASCI |
| Ga0318497_101569691 | 3300031805 | Soil | MLNSTKSGTPEKDRSVAANAPEVLGRTVQPHDQAWARSEPTTKAG |
| Ga0318568_100630464 | 3300031819 | Soil | MLISTKSGAPEKDRNASLSAAEVMGRVVPHEQTWARSEPSTKAGTAS |
| Ga0318568_101427041 | 3300031819 | Soil | MLNSMKSGAPEKDKSAAANAPEVMGRMVQPHDQTWARSEPTT |
| Ga0318567_104582842 | 3300031821 | Soil | MLKSGVPEKDKNATATAPEVLGRTMQSHDQAWARSEPTTKA |
| Ga0310917_100441481 | 3300031833 | Soil | MLTSTKSGVPEKDRNASVSAAEVIGRVQHDQTWAKSEPTTNAGMASCIGSDM |
| Ga0310917_103608573 | 3300031833 | Soil | MLISTKSGAPEKDRNASVSAAEVTGRVVPHDQTWARSEPTT |
| Ga0310917_106444391 | 3300031833 | Soil | LISTKSGAPENDRNASASPAEVMGRVVPHDQTWARSEPMTK |
| Ga0310917_109824121 | 3300031833 | Soil | LISPKSGAPEKDRNASVSAAESRVVPHDQTWARSEPTTKAGMA |
| Ga0310917_110103362 | 3300031833 | Soil | MLTSTKSGTPEKDRNASVSAAEVMGRVMQHDQTWAKSEPTTKAGMASCIG |
| Ga0318517_100088409 | 3300031835 | Soil | MLTSTKSGAPEKDRNASVGAAEVMGRVVQHDQTWA |
| Ga0318511_105676312 | 3300031845 | Soil | MLNSMKSSATEKDRNAAATAPEVLGRTVQPHDQAWARSEPTTKAGTASCIG |
| Ga0318512_100536871 | 3300031846 | Soil | MFTKSGAPEKDRNASVSAAEVMGRVVPHDQSSVRSESTTK |
| Ga0306919_114065882 | 3300031879 | Soil | MLTSTKSGTPEKDRNASVSAAEVMGRVMQHDPTWAKLEPTTK |
| Ga0306925_101081844 | 3300031890 | Soil | MLTSTKSGVPETDRNASVSAAEVIGRVVQHDQTWA |
| Ga0306925_102607763 | 3300031890 | Soil | MLISTKSGAPEKDKNGPVSAADVMGRVVPHDQTWARS |
| Ga0318551_107824151 | 3300031896 | Soil | MLISTKSGAPEKDRNASVSAAEVMGRVVPHDQSWA |
| Ga0318520_100330431 | 3300031897 | Soil | MLISTKSGAPEKDKNGPVSAADVMGRVVPHDQTWARSE |
| Ga0318520_101781461 | 3300031897 | Soil | MLNSMKSGVPEKDKNATASAPEVLGRTVQPHDQAWARSEPTTKAGTASCI |
| Ga0318520_106901442 | 3300031897 | Soil | MLISTKSGAPEKDRNGPVSAADVMGRVVPHDQTWARSEPTTKAGTASCIGSD |
| Ga0306923_100552836 | 3300031910 | Soil | MLNSMKTDVPEKDKNSAANTAEVMGRTVQPHDPAWARL |
| Ga0306923_103153723 | 3300031910 | Soil | MLIGTKSGASEKDRKASVSAAEVMGRVMPHDQALTRSEPTTKAGTASCIGSD |
| Ga0306923_107025263 | 3300031910 | Soil | MLTSTKSGVLEKDRNASVGAAEVMGRVAPHDQWPRSEPTTKA |
| Ga0306923_123266961 | 3300031910 | Soil | MLISTKSGAPEKDRNASVSAADVMGRVVPHDQTWARSEPTTRAGTAS |
| Ga0306923_124460372 | 3300031910 | Soil | MLTSTKSGTPEKDRNASVSAAEVMGRVMQHDQTWAKSEPTTK |
| Ga0306921_102235821 | 3300031912 | Soil | MLISTKSGAPEKDRNASVGAAEVMGRVVPHDQTWA |
| Ga0306921_111692961 | 3300031912 | Soil | MLTSTKSGTPEKDRNASVSAAEVMGRVMQHDQTWAKSEPTTKAGMASCI |
| Ga0306921_120673632 | 3300031912 | Soil | MLISTKSGVPEKDRNGPVSAAEVMGRVVPHDQTWARS |
| Ga0306921_121182112 | 3300031912 | Soil | MLNSMKSGVPEKDKNATATAPEVLGRTVQPHDQAWARSEPTKAGT |
| Ga0306921_122725812 | 3300031912 | Soil | MLTSTKSGVPETDRNASVSAAEVIGRVVQHDQTWAKSEPTTKAEMASCI |
| Ga0310916_102109551 | 3300031942 | Soil | MLNSMKSGAPEKSKNAATSVAEVIGRTVQPHDHAWAGSEP |
| Ga0310910_1000725010 | 3300031946 | Soil | MLTSTRSGVPEKDRNASVSAAEVMGKVTPHDQAWTRSEPTTKAGTAS |
| Ga0310910_115085532 | 3300031946 | Soil | MLNSMKTDVPEKDKNSAANAAEVMGRTAQPHDQAWARSEPTKAG |
| Ga0310909_113242281 | 3300031947 | Soil | MLNSTKSGVPEKDKNAAANAAEVMGRTVQHDQAWVRSEPTKA |
| Ga0310909_114796971 | 3300031947 | Soil | MLISPKSGAPEKDRNASVSAAESRVVPHDQTWARSEP |
| Ga0306926_106647371 | 3300031954 | Soil | MVLISTKSGAPEKDRNASVGAAEVMGRVVPHDQTWARSEPTT |
| Ga0306926_115752721 | 3300031954 | Soil | MLNSMKSGAPEKSKNAAASVAEVIGRTVQPHDHAWA |
| Ga0306926_115969211 | 3300031954 | Soil | MLTSTKSGVPEKDRNASVSAAEVIGRIVQHDQTWAKSEPTTKA |
| Ga0318530_105017511 | 3300031959 | Soil | MLISTKSGAPEKDKNGPVSAAEVMGKVVPHDQTWA |
| Ga0318531_102364852 | 3300031981 | Soil | MLISTKSGAPEKDRNASLSAAEVMGRVVPHEQTWARSE |
| Ga0318531_105359001 | 3300031981 | Soil | MLTSTRSGVPEKDRNASVSAAEVMGKVTPHDQAWARSEPTTKAG |
| Ga0306922_103836893 | 3300032001 | Soil | MLTSTKSGTPEKDRNASVSAAEVMGRVVQHDQTWAKSEPTTK |
| Ga0306922_113239091 | 3300032001 | Soil | MLNSMKSGAPEKDKSVAANAPDVMGRMVQPHDQAWA |
| Ga0306922_113452341 | 3300032001 | Soil | MWSGVPEKDKNASVSAAEVMGRVAPHDQTWARSEPTTKA |
| Ga0306922_119946671 | 3300032001 | Soil | MLTSTKNGAPEKDRNASVGAAEVMGRVVQHDQWPRSE |
| Ga0318507_101468524 | 3300032025 | Soil | MLTSTKSGAPEKDRNASVGAAEVMGRVVQHDQTWAKLGPTTRAGMA |
| Ga0318507_102486931 | 3300032025 | Soil | MLNSMKSSAPEKDKNAAANAAEIMGRTVQPHDQAGSDPTTKAGT |
| Ga0318507_103259532 | 3300032025 | Soil | MLNSTKSGVPEKDKNAAANAAEVMGRTVQHDQAWVRSE |
| Ga0310911_109193681 | 3300032035 | Soil | MLISTKSGAPEKDRNASVSAADVMGRVVPHDQTWARSELTT |
| Ga0318559_101104082 | 3300032039 | Soil | MLNSTKSDTPEKDRSVAANAPEVLGRTVQPHDQAWARSEPTMKAGTASC |
| Ga0318556_106696141 | 3300032043 | Soil | MLNSMKTDVLEKDKNSAANAAEVMGKTAQPHDQAW |
| Ga0318575_100690061 | 3300032055 | Soil | MLTSTKSGAPEKDRNASVGAAEVMGRVVQHDQTWAK |
| Ga0318505_103969091 | 3300032060 | Soil | LISTKSGAPENDRNASASSAEVMGRVVPHDQNWARSEPMTKAGMAS |
| Ga0318505_105261342 | 3300032060 | Soil | MLNSMKTDVLEKDKNSAANAAEVMGKTAQPHDQAWA |
| Ga0318504_102000052 | 3300032063 | Soil | MLTSTKSGTPEKDRNASVSAAEVMGRVMQHDQTWAKSEPTTKAGMASCIGSD |
| Ga0318504_104717631 | 3300032063 | Soil | MLNSTKSGVPEKDKNAAANAAEVMGRTVQPHDQAWARSEPTKAGTASCIG |
| Ga0318514_100935291 | 3300032066 | Soil | MLNSTKSGVPEKDKNATANAAEVMGRTVQPHDQTWARSEPTKA |
| Ga0318553_102004331 | 3300032068 | Soil | MLNSTKSGVPEKDKNATANAAEVMGRTVQPHDQTWARSEPTKAGTASC |
| Ga0306924_106116381 | 3300032076 | Soil | MLTSTKSGVPEKDKNTSVSAAEVMGRVMHHDQTWARSEPTTKAGMASCI |
| Ga0306924_118794622 | 3300032076 | Soil | MLISTKSGVPEKDGNGPVSAAEVMGRVVPHDQTWARS |
| Ga0318518_101841351 | 3300032090 | Soil | MLTSTKSSVPEKDRNASVSAADVIGRVVPHDQTWAKSEPTT |
| Ga0318540_103259283 | 3300032094 | Soil | MLISTKSGAPEKDRNASVSAADVMGRVVPHDQTWARSE |
| Ga0318540_103531542 | 3300032094 | Soil | MLNSMKSSAPEKDKNAAANAAEIMGRTVQPHDQAGSD |
| Ga0306920_1002041791 | 3300032261 | Soil | MLTSTKSGVPETDRNASVSAAEVIGRVVQHDQTWAK |
| Ga0306920_1013504611 | 3300032261 | Soil | MLNSMKTDVLEKDKNSAANAAEVMGRTAQPHDQAWA |
| Ga0306920_1017959331 | 3300032261 | Soil | MLTSTKSGTPEKDRNASVSAAEVMGRVMQHDQTWAKSEPTTKAGMASCIGS |
| Ga0306920_1018530781 | 3300032261 | Soil | MLTSTKSGVPEKDRNASVGAAEVMGRVAPQWPRSEPTTKAG |
| Ga0306920_1022959112 | 3300032261 | Soil | MLNSMKSGLPEKDKNATASAPEVLGRTVQPHDQAWARSEPTTKA |
| Ga0306920_1028419471 | 3300032261 | Soil | MLISTKSGAPENDRNASVSAAEVVGRVVPHDQSWA |
| ⦗Top⦘ |