NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F031981

Metagenome / Metatranscriptome Family F031981

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F031981
Family Type Metagenome / Metatranscriptome
Number of Sequences 181
Average Sequence Length 38 residues
Representative Sequence MGNLYPLLMLPAFDPRPWGTLDLSPIYPNHKFEEKIGEA
Number of Associated Samples 165
Number of Associated Scaffolds 181

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 14.36 %
% of genes near scaffold ends (potentially truncated) 98.34 %
% of genes from short scaffolds (< 2000 bps) 91.16 %
Associated GOLD sequencing projects 154
AlphaFold2 3D model prediction Yes
3D model pTM-score0.28

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(8.287 % of family members)
Environment Ontology (ENVO) Unclassified
(18.785 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(46.961 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 0.00%    Coil/Unstructured: 100.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.28
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 181 Family Scaffolds
PF00155Aminotran_1_2 82.87
PF01261AP_endonuc_2 3.31
PF13924Lipocalin_5 2.76
PF01467CTP_transf_like 2.21
PF05137PilN 0.55
PF04030ALO 0.55
PF00154RecA 0.55
PF13561adh_short_C2 0.55
PF00483NTP_transferase 0.55
PF02371Transposase_20 0.55
PF01238PMI_typeI_C 0.55
PF00266Aminotran_5 0.55
PF09286Pro-kuma_activ 0.55
PF01936NYN 0.55

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 181 Family Scaffolds
COG3166Type IV pilus assembly protein PilNCell motility [N] 1.10
COG0277FAD/FMN-containing lactate dehydrogenase/glycolate oxidaseEnergy production and conversion [C] 0.55
COG0468RecA/RadA recombinaseReplication, recombination and repair [L] 0.55
COG1432NYN domain, predicted PIN-related RNAse, tRNA/rRNA maturationGeneral function prediction only [R] 0.55
COG1482Mannose-6-phosphate isomerase, class ICarbohydrate transport and metabolism [G] 0.55
COG3547TransposaseMobilome: prophages, transposons [X] 0.55
COG4934Serine protease, subtilase familyPosttranslational modification, protein turnover, chaperones [O] 0.55


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000567|JGI12270J11330_10234507All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis601Open in IMG/M
3300001356|JGI12269J14319_10148885All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1008Open in IMG/M
3300001867|JGI12627J18819_10320327All Organisms → cellular organisms → Bacteria625Open in IMG/M
3300004082|Ga0062384_100291147All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1009Open in IMG/M
3300004091|Ga0062387_100477641All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter863Open in IMG/M
3300004091|Ga0062387_100653630All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter762Open in IMG/M
3300004092|Ga0062389_100399066All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1493Open in IMG/M
3300004092|Ga0062389_101605661All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter833Open in IMG/M
3300004633|Ga0066395_10092443All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1441Open in IMG/M
3300005175|Ga0066673_10470464All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter740Open in IMG/M
3300005437|Ga0070710_10479759All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae848Open in IMG/M
3300005437|Ga0070710_10520458All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae817Open in IMG/M
3300005437|Ga0070710_11015029All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter605Open in IMG/M
3300005534|Ga0070735_10047134All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2874Open in IMG/M
3300005538|Ga0070731_10029945All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter3691Open in IMG/M
3300005538|Ga0070731_10651491All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter700Open in IMG/M
3300005541|Ga0070733_10052319All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2559Open in IMG/M
3300005542|Ga0070732_10157580All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1352Open in IMG/M
3300005553|Ga0066695_10643330All Organisms → cellular organisms → Bacteria629Open in IMG/M
3300005555|Ga0066692_10132941All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1513Open in IMG/M
3300005557|Ga0066704_10276536All Organisms → cellular organisms → Bacteria → Acidobacteria1138Open in IMG/M
3300005559|Ga0066700_10005155All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter6299Open in IMG/M
3300005569|Ga0066705_10164942All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1369Open in IMG/M
3300005575|Ga0066702_10670538All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter619Open in IMG/M
3300005602|Ga0070762_10464520All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter825Open in IMG/M
3300005616|Ga0068852_101394545All Organisms → cellular organisms → Bacteria → Acidobacteria723Open in IMG/M
3300005764|Ga0066903_104684620All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae728Open in IMG/M
3300005764|Ga0066903_104749442All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter723Open in IMG/M
3300005895|Ga0075277_1092462All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae508Open in IMG/M
3300005944|Ga0066788_10122732All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae652Open in IMG/M
3300005952|Ga0080026_10247404All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae537Open in IMG/M
3300006050|Ga0075028_100216209All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1040Open in IMG/M
3300006052|Ga0075029_100672169All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae697Open in IMG/M
3300006173|Ga0070716_101329799All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae582Open in IMG/M
3300006174|Ga0075014_100284503All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae866Open in IMG/M
3300006175|Ga0070712_101046230All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae707Open in IMG/M
3300006176|Ga0070765_100329444All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1416Open in IMG/M
3300006358|Ga0068871_101481690All Organisms → cellular organisms → Bacteria → Acidobacteria641Open in IMG/M
3300006358|Ga0068871_101734103All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae592Open in IMG/M
3300006755|Ga0079222_11679408All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae607Open in IMG/M
3300006871|Ga0075434_100759875All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae986Open in IMG/M
3300006904|Ga0075424_100969289All Organisms → cellular organisms → Bacteria → Acidobacteria907Open in IMG/M
3300006954|Ga0079219_10167931All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1198Open in IMG/M
3300009012|Ga0066710_100210268All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2779Open in IMG/M
3300009029|Ga0066793_10871941All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium510Open in IMG/M
3300009036|Ga0105244_10507873All Organisms → cellular organisms → Bacteria → Acidobacteria555Open in IMG/M
3300009088|Ga0099830_11814285All Organisms → cellular organisms → Bacteria → Acidobacteria509Open in IMG/M
3300009092|Ga0105250_10056849All Organisms → cellular organisms → Bacteria → Acidobacteria1570Open in IMG/M
3300009143|Ga0099792_10828954All Organisms → cellular organisms → Bacteria → Acidobacteria608Open in IMG/M
3300009174|Ga0105241_11642352All Organisms → cellular organisms → Bacteria → Acidobacteria623Open in IMG/M
3300009551|Ga0105238_11146328All Organisms → cellular organisms → Bacteria → Acidobacteria801Open in IMG/M
3300009618|Ga0116127_1066319All Organisms → cellular organisms → Bacteria → Acidobacteria1001Open in IMG/M
3300009624|Ga0116105_1014982All Organisms → cellular organisms → Bacteria1596Open in IMG/M
3300009628|Ga0116125_1009730All Organisms → cellular organisms → Bacteria → Acidobacteria2487Open in IMG/M
3300009762|Ga0116130_1204005All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium626Open in IMG/M
3300009764|Ga0116134_1194140All Organisms → cellular organisms → Bacteria → Acidobacteria707Open in IMG/M
3300009839|Ga0116223_10009254All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae7670Open in IMG/M
3300010048|Ga0126373_11308015All Organisms → cellular organisms → Bacteria → Acidobacteria791Open in IMG/M
3300010325|Ga0134064_10284780All Organisms → cellular organisms → Bacteria → Acidobacteria624Open in IMG/M
3300010341|Ga0074045_10405595All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium883Open in IMG/M
3300010359|Ga0126376_11667309All Organisms → cellular organisms → Bacteria → Acidobacteria672Open in IMG/M
3300010379|Ga0136449_101296849All Organisms → cellular organisms → Bacteria → Acidobacteria1136Open in IMG/M
3300011120|Ga0150983_11822230All Organisms → cellular organisms → Bacteria → Acidobacteria1948Open in IMG/M
3300011269|Ga0137392_10275177All Organisms → cellular organisms → Bacteria → Acidobacteria1389Open in IMG/M
3300012199|Ga0137383_10072996All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2474Open in IMG/M
3300012203|Ga0137399_10873779All Organisms → cellular organisms → Bacteria → Acidobacteria757Open in IMG/M
3300012209|Ga0137379_11731812All Organisms → cellular organisms → Bacteria → Acidobacteria521Open in IMG/M
3300012362|Ga0137361_11600874All Organisms → cellular organisms → Bacteria → Acidobacteria572Open in IMG/M
3300012362|Ga0137361_11718698All Organisms → cellular organisms → Bacteria → Acidobacteria547Open in IMG/M
3300012923|Ga0137359_11665039All Organisms → cellular organisms → Bacteria → Acidobacteria525Open in IMG/M
3300012961|Ga0164302_10670556All Organisms → cellular organisms → Bacteria → Acidobacteria763Open in IMG/M
3300014156|Ga0181518_10380569All Organisms → cellular organisms → Bacteria → Acidobacteria686Open in IMG/M
3300014160|Ga0181517_10387959All Organisms → cellular organisms → Bacteria → Acidobacteria719Open in IMG/M
3300014166|Ga0134079_10013654All Organisms → cellular organisms → Bacteria2517Open in IMG/M
3300014490|Ga0182010_10685704All Organisms → cellular organisms → Bacteria → Acidobacteria576Open in IMG/M
3300014657|Ga0181522_10983627All Organisms → cellular organisms → Bacteria → Acidobacteria522Open in IMG/M
3300014968|Ga0157379_10481018All Organisms → cellular organisms → Bacteria → Acidobacteria1149Open in IMG/M
3300014968|Ga0157379_11075422All Organisms → cellular organisms → Bacteria → Acidobacteria770Open in IMG/M
3300015052|Ga0137411_1237549All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium532Open in IMG/M
3300015167|Ga0167661_1022248All Organisms → cellular organisms → Bacteria → Acidobacteria1168Open in IMG/M
3300015241|Ga0137418_11199084All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola534Open in IMG/M
3300016702|Ga0181511_1207323All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium737Open in IMG/M
3300017822|Ga0187802_10243654All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium695Open in IMG/M
3300017823|Ga0187818_10468430All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium563Open in IMG/M
3300017925|Ga0187856_1025092All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2942Open in IMG/M
3300017943|Ga0187819_10226612All Organisms → cellular organisms → Bacteria → Acidobacteria1098Open in IMG/M
3300017975|Ga0187782_10998991All Organisms → cellular organisms → Bacteria → Acidobacteria651Open in IMG/M
3300018012|Ga0187810_10511989All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium513Open in IMG/M
3300018017|Ga0187872_10318889All Organisms → cellular organisms → Bacteria → Acidobacteria675Open in IMG/M
3300018030|Ga0187869_10106358All Organisms → cellular organisms → Bacteria → Acidobacteria1414Open in IMG/M
3300018037|Ga0187883_10435725All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium673Open in IMG/M
3300018040|Ga0187862_10004760All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis12710Open in IMG/M
3300018043|Ga0187887_10978931All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium500Open in IMG/M
3300018047|Ga0187859_10198462All Organisms → cellular organisms → Bacteria → Acidobacteria1070Open in IMG/M
3300018057|Ga0187858_10524134All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium722Open in IMG/M
3300018086|Ga0187769_10730906All Organisms → cellular organisms → Bacteria → Acidobacteria748Open in IMG/M
3300018468|Ga0066662_10110756All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1974Open in IMG/M
3300019256|Ga0181508_1167124All Organisms → cellular organisms → Bacteria → Acidobacteria713Open in IMG/M
3300020062|Ga0193724_1116869All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium530Open in IMG/M
3300020579|Ga0210407_10505347All Organisms → cellular organisms → Bacteria → Acidobacteria944Open in IMG/M
3300020583|Ga0210401_10209719All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1806Open in IMG/M
3300021078|Ga0210381_10374287All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium523Open in IMG/M
3300021088|Ga0210404_10303335All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Acidobacteriales bacterium 13_1_40CM_3_55_5879Open in IMG/M
3300021170|Ga0210400_11229721All Organisms → cellular organisms → Bacteria → Acidobacteria602Open in IMG/M
3300021171|Ga0210405_10881520All Organisms → cellular organisms → Bacteria → Acidobacteria681Open in IMG/M
3300021180|Ga0210396_11148229All Organisms → cellular organisms → Bacteria → Acidobacteria652Open in IMG/M
3300021362|Ga0213882_10039660All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1843Open in IMG/M
3300021401|Ga0210393_11416180All Organisms → cellular organisms → Bacteria → Acidobacteria555Open in IMG/M
3300021402|Ga0210385_11509792All Organisms → cellular organisms → Bacteria → Acidobacteria513Open in IMG/M
3300021420|Ga0210394_10322914All Organisms → cellular organisms → Bacteria → Acidobacteria1355Open in IMG/M
3300021432|Ga0210384_11752952All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium526Open in IMG/M
3300021474|Ga0210390_10967571All Organisms → cellular organisms → Bacteria → Acidobacteria697Open in IMG/M
3300021475|Ga0210392_10810403All Organisms → cellular organisms → Bacteria → Acidobacteria699Open in IMG/M
3300021861|Ga0213853_10681963All Organisms → cellular organisms → Bacteria → Acidobacteria605Open in IMG/M
3300022873|Ga0224550_1054304All Organisms → cellular organisms → Bacteria → Acidobacteria574Open in IMG/M
3300024227|Ga0228598_1125294All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium522Open in IMG/M
3300025434|Ga0208690_1045029All Organisms → cellular organisms → Bacteria → Acidobacteria696Open in IMG/M
3300025444|Ga0208189_1025262All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1237Open in IMG/M
3300025460|Ga0208562_1019973All Organisms → cellular organisms → Bacteria → Acidobacteria1612Open in IMG/M
3300025496|Ga0208191_1026223All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1367Open in IMG/M
3300025912|Ga0207707_10262815All Organisms → cellular organisms → Bacteria → Acidobacteria1497Open in IMG/M
3300025928|Ga0207700_10384226All Organisms → cellular organisms → Bacteria → Acidobacteria1228Open in IMG/M
3300025928|Ga0207700_11662645All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium564Open in IMG/M
3300025938|Ga0207704_10075945All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2151Open in IMG/M
3300026313|Ga0209761_1208716All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium843Open in IMG/M
3300026317|Ga0209154_1057679All Organisms → cellular organisms → Bacteria1715Open in IMG/M
3300026527|Ga0209059_1285237All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium557Open in IMG/M
3300027024|Ga0207819_1013836All Organisms → cellular organisms → Bacteria1141Open in IMG/M
3300027061|Ga0209729_1017799All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium845Open in IMG/M
3300027562|Ga0209735_1055031All Organisms → cellular organisms → Bacteria → Acidobacteria855Open in IMG/M
3300027696|Ga0208696_1237374All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium569Open in IMG/M
3300027698|Ga0209446_1177862All Organisms → cellular organisms → Bacteria → Acidobacteria548Open in IMG/M
3300027745|Ga0209908_10006679All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1784Open in IMG/M
3300027783|Ga0209448_10134302All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium827Open in IMG/M
3300027795|Ga0209139_10013175All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis3045Open in IMG/M
3300027829|Ga0209773_10455692All Organisms → cellular organisms → Bacteria → Acidobacteria528Open in IMG/M
3300027842|Ga0209580_10104283All Organisms → cellular organisms → Bacteria → Acidobacteria1373Open in IMG/M
3300027846|Ga0209180_10788255All Organisms → cellular organisms → Bacteria → Acidobacteria510Open in IMG/M
3300027862|Ga0209701_10223542All Organisms → cellular organisms → Bacteria → Acidobacteria1112Open in IMG/M
3300027862|Ga0209701_10682813All Organisms → cellular organisms → Bacteria → Acidobacteria532Open in IMG/M
3300027869|Ga0209579_10031821All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2875Open in IMG/M
3300027882|Ga0209590_10554964All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium740Open in IMG/M
3300027884|Ga0209275_10477075All Organisms → cellular organisms → Bacteria → Acidobacteria709Open in IMG/M
3300027910|Ga0209583_10527965All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300027986|Ga0209168_10071809All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1815Open in IMG/M
3300027986|Ga0209168_10282089All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium818Open in IMG/M
3300028795|Ga0302227_10292756All Organisms → cellular organisms → Bacteria → Acidobacteria620Open in IMG/M
3300028798|Ga0302222_10189791All Organisms → cellular organisms → Bacteria → Acidobacteria805Open in IMG/M
3300028882|Ga0302154_10623395All Organisms → cellular organisms → Bacteria → Acidobacteria506Open in IMG/M
3300029943|Ga0311340_11024665All Organisms → cellular organisms → Bacteria → Acidobacteria676Open in IMG/M
3300029984|Ga0311332_11047627All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium655Open in IMG/M
3300029990|Ga0311336_11095174All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium AB60694Open in IMG/M
3300030054|Ga0302182_10119956All Organisms → cellular organisms → Bacteria → Acidobacteria1148Open in IMG/M
3300030054|Ga0302182_10135208All Organisms → cellular organisms → Bacteria → Acidobacteria1071Open in IMG/M
3300030054|Ga0302182_10223959All Organisms → cellular organisms → Bacteria → Acidobacteria801Open in IMG/M
3300030057|Ga0302176_10237861All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium728Open in IMG/M
3300030706|Ga0310039_10185821All Organisms → cellular organisms → Bacteria → Acidobacteria825Open in IMG/M
3300030743|Ga0265461_13383259All Organisms → cellular organisms → Bacteria → Acidobacteria539Open in IMG/M
3300031231|Ga0170824_119397328All Organisms → cellular organisms → Bacteria819Open in IMG/M
3300031233|Ga0302307_10166654All Organisms → cellular organisms → Bacteria → Acidobacteria1141Open in IMG/M
3300031233|Ga0302307_10658563All Organisms → cellular organisms → Bacteria → Acidobacteria526Open in IMG/M
3300031446|Ga0170820_12711501All Organisms → cellular organisms → Bacteria → Acidobacteria1181Open in IMG/M
3300031525|Ga0302326_11529874All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Acidobacteriales bacterium 13_1_40CM_3_55_5892Open in IMG/M
3300031708|Ga0310686_113773881All Organisms → cellular organisms → Bacteria → Acidobacteria778Open in IMG/M
3300031715|Ga0307476_10206925All Organisms → cellular organisms → Bacteria → Acidobacteria1425Open in IMG/M
3300031718|Ga0307474_11469940All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium536Open in IMG/M
3300031754|Ga0307475_11268966All Organisms → cellular organisms → Bacteria → Acidobacteria571Open in IMG/M
3300031912|Ga0306921_11746665All Organisms → cellular organisms → Bacteria → Acidobacteria671Open in IMG/M
3300031941|Ga0310912_10943135All Organisms → cellular organisms → Bacteria → Acidobacteria663Open in IMG/M
3300032261|Ga0306920_102896575All Organisms → cellular organisms → Bacteria → Acidobacteria651Open in IMG/M
3300032515|Ga0348332_10391374All Organisms → cellular organisms → Bacteria → Acidobacteria2676Open in IMG/M
3300032770|Ga0335085_11022502All Organisms → cellular organisms → Bacteria → Acidobacteria891Open in IMG/M
3300032782|Ga0335082_11328352All Organisms → cellular organisms → Bacteria → Acidobacteria588Open in IMG/M
3300032805|Ga0335078_10111938All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3922Open in IMG/M
3300032805|Ga0335078_12426233All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium544Open in IMG/M
3300032954|Ga0335083_10448062All Organisms → cellular organisms → Bacteria → Acidobacteria1091Open in IMG/M
3300033158|Ga0335077_12141902All Organisms → cellular organisms → Bacteria → Acidobacteria515Open in IMG/M
3300033412|Ga0310810_10544263All Organisms → cellular organisms → Bacteria → Acidobacteria1137Open in IMG/M
3300033977|Ga0314861_0364728All Organisms → cellular organisms → Bacteria → Proteobacteria639Open in IMG/M
3300034124|Ga0370483_0095729All Organisms → cellular organisms → Bacteria → Acidobacteria974Open in IMG/M
3300034163|Ga0370515_0436625All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium552Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil8.29%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil7.73%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland5.52%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa5.52%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil4.97%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland4.97%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil4.97%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.42%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.87%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil3.31%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.31%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.21%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.21%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.21%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.21%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.21%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog1.66%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.66%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.66%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.66%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.10%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.10%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.10%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.10%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.10%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil1.10%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.10%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen1.10%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere1.10%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.10%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.10%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.10%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.55%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds0.55%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.55%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.55%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.55%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.55%
Thawing PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost0.55%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil0.55%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen0.55%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.55%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil0.55%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.55%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.55%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.55%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.55%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.55%
Exposed RockEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock0.55%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.55%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.55%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.55%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.55%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.55%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000567Peat soil microbial communities from Weissenstadt, Germany - SII-2010EnvironmentalOpen in IMG/M
3300001356Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007EnvironmentalOpen in IMG/M
3300001867Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)EnvironmentalOpen in IMG/M
3300004082Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3EnvironmentalOpen in IMG/M
3300004091Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005534Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1EnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005895Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_101EnvironmentalOpen in IMG/M
3300005944Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048EnvironmentalOpen in IMG/M
3300005952Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045EnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009029Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189EnvironmentalOpen in IMG/M
3300009036Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaGHost-AssociatedOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009092Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaGHost-AssociatedOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009618Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_100EnvironmentalOpen in IMG/M
3300009624Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10EnvironmentalOpen in IMG/M
3300009628Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10EnvironmentalOpen in IMG/M
3300009762Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40EnvironmentalOpen in IMG/M
3300009764Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40EnvironmentalOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaGEnvironmentalOpen in IMG/M
3300010341Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300014156Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaGEnvironmentalOpen in IMG/M
3300014160Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaGEnvironmentalOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300014490Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaGEnvironmentalOpen in IMG/M
3300014657Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaGEnvironmentalOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015052Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015167Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-11b, vegetated hydrological feature)EnvironmentalOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300016702Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017822Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2EnvironmentalOpen in IMG/M
3300017823Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3EnvironmentalOpen in IMG/M
3300017925Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018012Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5EnvironmentalOpen in IMG/M
3300018017Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40EnvironmentalOpen in IMG/M
3300018030Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100EnvironmentalOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300018040Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300018057Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150EnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300019256Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020062Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a1EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redoEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021362Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09EnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021861Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022873Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 10-14EnvironmentalOpen in IMG/M
3300024227Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4Host-AssociatedOpen in IMG/M
3300025434Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025444Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025460Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025496Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026313Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026317Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes)EnvironmentalOpen in IMG/M
3300026527Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes)EnvironmentalOpen in IMG/M
3300027024Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 42 (SPAdes)EnvironmentalOpen in IMG/M
3300027061Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027562Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027696Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027698Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027745Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2MEnvironmentalOpen in IMG/M
3300027783Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027795Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027829Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027842Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027862Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027869Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300027910Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes)EnvironmentalOpen in IMG/M
3300027986Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028795Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_1EnvironmentalOpen in IMG/M
3300028798Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2EnvironmentalOpen in IMG/M
3300028882Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_3EnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300029984I_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300029990I_Fen_N2 coassemblyEnvironmentalOpen in IMG/M
3300030054Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1EnvironmentalOpen in IMG/M
3300030057Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1EnvironmentalOpen in IMG/M
3300030706Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2)EnvironmentalOpen in IMG/M
3300030743Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assemblyEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031233Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2EnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032515FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300033977Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75EnvironmentalOpen in IMG/M
3300034124Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14EnvironmentalOpen in IMG/M
3300034163Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12270J11330_1023450723300000567Peatlands SoilMGNLYPLLMLPGFDPRPWGTVDLSPIYPNHRFEEKIGEA
JGI12269J14319_1014888523300001356Peatlands SoilMTDLYPLLMSPVFDPRPWGTTDLSPIYPSHRFDEKIGES
JGI12627J18819_1032032723300001867Forest SoilMTQLYPLRMQPAFDPRPWGTTDLSPIYPDHKFDEKI
Ga0062384_10029114723300004082Bog Forest SoilMGNLYPLLMLPGFDPRPWGTLDLSPIYPNHKFEEKIGEAW
Ga0062387_10047764123300004091Bog Forest SoilMNELYPLLMSPVFDPRPWGTLDLSPIYPNHRFDEKIGESWLTGDNGK
Ga0062387_10065363013300004091Bog Forest SoilMTSLYPLLMTPMFDARPWGTLDLGPIYPNHKFNEKIGEAWLTG
Ga0062389_10039906613300004092Bog Forest SoilMTQLYPLLMQPLFDPRPWGTLDLSAIYPNHKFNERIGEAW
Ga0062389_10160566113300004092Bog Forest SoilMTQLYPLLMSPVFDARPWGTLDLSTIYPNAKFNERIGEAWLTGDNG
Ga0066395_1009244313300004633Tropical Forest SoilMANLYPLLMQPGFDPRPWGTHDLSPIYPNHKFAEKIGEAW
Ga0066673_1047046413300005175SoilMQPRFDPRPWGTLDLAPIYPNHRFTEKIGESWLSGDESRV
Ga0070710_1047975923300005437Corn, Switchgrass And Miscanthus RhizosphereMGNLYPLLMQPGFDPRPWGTQDLSPIYPNHRFEEKIGESWLT
Ga0070710_1052045823300005437Corn, Switchgrass And Miscanthus RhizosphereMQPVFDPRPWGTLDLSPIYPNHKFEQKIGEAWLTGDAGKVAN
Ga0070710_1101502913300005437Corn, Switchgrass And Miscanthus RhizosphereMGDLYPLLMTPAFDPRPWGTQDLSPVYPNHKFADKIGEAWL
Ga0070735_1004713453300005534Surface SoilMELYPLLLLPEFSPRPWGATDLSPIYAGRKFAEKIG
Ga0070731_1002994543300005538Surface SoilMGNLYPLLMLPAFDPRPWGTLDLSPIYPNHKFEEKIGEA*
Ga0070731_1065149123300005538Surface SoilMIDLYPLLMSPVFDPRPWGTTDLSPIYPNHRFEEK
Ga0070733_1005231953300005541Surface SoilMELYPLLLLPEFSPRPWGATDLSPIYAGRKFAEKIGEA
Ga0070732_1015758013300005542Surface SoilMLPRFDPRPWGTEDLSPIYPNHKFEEKIGESWLSG
Ga0066695_1064333013300005553SoilMSELYPFRMLPAFDPRPWGTLDLSPVYPNHRFSDKIGE
Ga0066692_1013294133300005555SoilMSELYPLLMTPAFDARPWGTLDLSPIYTNQRFEEK
Ga0066704_1027653613300005557SoilMSGLYALLMLPAFDPRPWGTVDLSPIYPNHKCEEKIGE
Ga0066700_1000515573300005559SoilMSELYPLLMTPAFDARPWGTLDLSPIYTNQRFEEKI
Ga0066705_1016494223300005569SoilMSDLYPLLMQPLFDPRPWGTPDLSPIYSQRFAEKIG
Ga0066702_1067053823300005575SoilMSDLYPLLMSAVFDPRPWGTTDLSPIYPNHRVEEKIG
Ga0070762_1046452023300005602SoilMADLYPLLMSPIFDPRPWGTLDLSPIYPGHRFEEKIGESW
Ga0068852_10139454513300005616Corn RhizosphereMEKLYPLLMKPLFDPRPWGRLDLSPIYSRKFNEKIGE
Ga0066903_10468462013300005764Tropical Forest SoilMSELYPLLMTPIFDPRPWGRFDLWPIYPKQFQQKIGESWLT
Ga0066903_10474944213300005764Tropical Forest SoilMGNLYPLLMQPGFDPRPWGTQDLSPIYPNHRFEQKIGESWL
Ga0075277_109246213300005895Rice Paddy SoilMETLYPLLVQPGFDPRPWGTLDLSPIYPNHRFEQKIGEAWL
Ga0066788_1012273213300005944SoilMQPAFDPRPWGTLDLSPIYPNHKFEEKIGEAWLTG
Ga0080026_1024740413300005952Permafrost SoilMTDLYPLLMTPLFYPRPWGTNDLSPIYPQQFKEKIGE
Ga0075028_10021620913300006050WatershedsMTQLYPLLMQPGFDPRPWGTLDLSPIYPNHKFGEKIGE
Ga0075029_10067216913300006052WatershedsMGNLYPLLMQPGFDPRPWGTHDLSPIYPNHKFEGKIGEA
Ga0070716_10132979923300006173Corn, Switchgrass And Miscanthus RhizosphereMDTLYPLLMQPGFDPRPWGTQDLSPIYPNHRFEQKI
Ga0075014_10028450333300006174WatershedsMTQLYPLLMSPAFDPRPWGTLDLSPIYPNHKFNEKIGEAWL
Ga0070712_10104623023300006175Corn, Switchgrass And Miscanthus RhizosphereMPDLYPLLMKPLFDPRPWGASELGPIYPNHKFAERIGEAWLTGNN
Ga0070765_10032944423300006176SoilMSDLYPLLMSPVFDPRPWGTLDLSPVYPGHRFDEKIGES
Ga0068871_10148169033300006358Miscanthus RhizosphereMSDLYPLLMVPAFDPRPWGTLDLTQIYSNYRFQEKIGESWLTGDKCK
Ga0068871_10173410313300006358Miscanthus RhizosphereMSALYPFSMQAMFDPRPWGTLDLSPIYPNHKFEEKIGEAWLTG
Ga0079222_1167940823300006755Agricultural SoilMLPAFDPRPWGTVNLAPIYPDRKFEEKIGEAWLTGDHCKV
Ga0075434_10075987513300006871Populus RhizosphereMIDLYPLLMVPKFDPRPWGTNDLSPIYPNHRYEEKIG
Ga0075424_10096928923300006904Populus RhizosphereMPDLYPLLMKPLFDPRPWGASELGPIYPNHKFAERIGEA
Ga0079219_1016793133300006954Agricultural SoilMGALYPLLMTPLFDPRPWGTTDLGPIYPNNKFAERIGEAWL
Ga0066710_10021026813300009012Grasslands SoilMTELYPLLMSPAFDPRPWGTLDLSPIYPNHKFNEKIGEA
Ga0066793_1087194113300009029Prmafrost SoilMAQLYPLLMSPAFDPRPWGTLDLSAIYPNNKFNERI
Ga0105244_1050787323300009036Miscanthus RhizosphereMPDLYPLLMKPLFDPRPWGASELGPIYPNHKFAERIGEAWLT
Ga0099830_1181428523300009088Vadose Zone SoilMNELYPLLMTPLFDPRTWGTYDLSPIYPQRFKEKIGES
Ga0105250_1005684933300009092Switchgrass RhizosphereMPDLYPLLMKPLFDPRPWGASELGPIYPNHKFAERIGEAWLTGDN
Ga0099792_1082895413300009143Vadose Zone SoilMYVIFMGSLYPLLMLPAFDPRPWGTHDLSPIYPNRK
Ga0105241_1164235223300009174Corn RhizosphereMSTLYPFSMQAMFDPRPWGTLDLSPIYPNHKFEEKIGEA
Ga0105238_1114632813300009551Corn RhizosphereMTDLYPFLMTPLFDPRPWGRLDLSPIYSQHFHFNQKI
Ga0116127_106631913300009618PeatlandMGNLYPLLMLPGFDPRPWGTHDLSPIYPNRQFSEKIGETW
Ga0116105_101498233300009624PeatlandMSPTFDPRPWGTLDLSPIYPNHRFEEKIGESWLTG
Ga0116125_100973043300009628PeatlandMADLYPLLMSPIFDPRPWGTLNLSPIYPNHRFEEKIGESWLT
Ga0116130_120400523300009762PeatlandLPLLAMTQLYPFLMSPAFDPRPWGTLDLSAIYPNHKFNE
Ga0116134_119414013300009764PeatlandMSPAFDPRPWGTLDLSAIYPNHKFNERIGEAWLTGDNCVVAN
Ga0116223_1000925483300009839Peatlands SoilMENLYPLLMLPAFDPRPWGTNDLSPIYPNHKFEEKI
Ga0126373_1130801513300010048Tropical Forest SoilMSDLYPFRMQPVFDPRPWGTTDLSPIYPEHKFDEKIGE
Ga0134064_1028478013300010325Grasslands SoilMETLYPLLMQPGFDPRPWGTQDLSPIYPNHRFEEKIGEA
Ga0074045_1040559523300010341Bog Forest SoilMSPAFDPRPWGTLDLSAIYPNHKFSERIGEAWLTG
Ga0126376_1166730923300010359Tropical Forest SoilMSGLYPLLMQPLFDPRPWGTLDLEPIYSQKFEEKIG
Ga0136449_10129684923300010379Peatlands SoilMSPAFDPRPWGTLDLSAIYPNHKFNERIGEAWLTG
Ga0150983_1182223013300011120Forest SoilMGNLYPLLMLPGFDPRPWGTLDLSPIYPNHKFDEKIGE
Ga0137392_1027517723300011269Vadose Zone SoilMAELYPLLMLPAFDPRPWGTMDLSPIYPNYKCQEKIGE
Ga0137383_1007299623300012199Vadose Zone SoilMSELYPLLMTPVFDPRPWGQLDLSPMYPQLFTEKIGES*
Ga0137399_1087377923300012203Vadose Zone SoilMSPAFDPRPWGTLDLSAIYPNAKFNERIGEAWLTGD
Ga0137379_1173181223300012209Vadose Zone SoilMTELYPLLMSPAFDPRPWGTLDLSPIYPNHKFNEKIG
Ga0137361_1160087413300012362Vadose Zone SoilMNELYPLLMTPLFDPRPWGTYDLSPIYPQRFKEKI
Ga0137361_1171869823300012362Vadose Zone SoilMSPAFDPRPWGTLDLSPIYPNHKFNERIGEAWLTGDNCFVT
Ga0137359_1166503933300012923Vadose Zone SoilMTELYPLLMSTAFDARPWGTLVLSLVYPDHNFNEKIGEAW
Ga0164302_1067055613300012961SoilMTELYPFLMTPLFDPRPWGRFDLSPIYSKHFHFDDKIVESWLT*
Ga0181518_1038056913300014156BogMGNLYPLLMLPAFDPRPWGTQDLSPIYPNHKFEEMIG
Ga0181517_1038795913300014160BogMQNLYPLLMQPGFDPRPWGTQDLSPIYPNHKFETKIGEAWLS
Ga0134079_1001365413300014166Grasslands SoilMIELYPFRMLPAFDPRPWGTLDLSPIYPNHRFSDKIGE
Ga0182010_1068570423300014490FenMTQLYPLLMQPAFDPRPWGTLDLSAIYPNHKFNERIG
Ga0181522_1098362713300014657BogMADLYPLLMSPIFDPRPWGTLNLSPIYPNHRFEEKIGESWLTGDNSKVANG
Ga0157379_1048101813300014968Switchgrass RhizosphereMKPLFDPRPWGGTELAPIYPNHKFAEKIGEAWLTG
Ga0157379_1107542223300014968Switchgrass RhizosphereMEKLYPLLMKPLFDPRPWGRVDLSPIYPRKFDEKIG
Ga0137411_123754923300015052Vadose Zone SoilMQPAFDPRPWGTLDLSPIYPNHKFEEKIGEAWLTGDA
Ga0167661_102224813300015167Glacier Forefield SoilMKPLYPLLMTPEFDPRPWGTLDLSPIYPNHHCSEKIGE
Ga0137418_1119908413300015241Vadose Zone SoilMSPAFDPRPWGTLDLSAIYPNIKFNERIGEAWLTGDNSI
Ga0181511_120732323300016702PeatlandLLGGYNSLAMTQLYPFLMSPAFDPRPWGTLDLSAIYPNHKFNERIG
Ga0187802_1024365413300017822Freshwater SedimentMTELYPLLMSPMFDPRPWGTLDLSPIYPNHRFEEKIGEAW
Ga0187818_1046843013300017823Freshwater SedimentMTELYPLLMSPMFDPRPWGTTDLSPIYPDHKFDEKIGEAW
Ga0187856_102509213300017925PeatlandMTQLYPFLMSPAFDPRPWGTLDLSAIYPNHKFNERIGEA
Ga0187819_1022661213300017943Freshwater SedimentMGNLYPLLMLPAFDPRPWGTLDLSPIYPNHKFEEK
Ga0187782_1099899123300017975Tropical PeatlandMTQLYPLLMSPLFDPRPWGTLDLSPIYPNQKLSERIGEAWLT
Ga0187810_1051198913300018012Freshwater SedimentMTELYPLLMSPAFDPRPWGTLDLSAIYPNHKFSERIGEAW
Ga0187872_1031888913300018017PeatlandMTQLYPFLMSPAFDPRPWGTLDLSAIYPNHKFNERI
Ga0187869_1010635813300018030PeatlandMTQLYPLLMTPVFDPRPWGTHDLAPIYPNHKFNEKI
Ga0187883_1043572513300018037PeatlandMSQLYPFLMSPAFDPRPWGTLDLSAIYPNHKFNERIGEA
Ga0187862_1000476013300018040PeatlandMGNLYPLLMLPGFDPRPWGTHDLSPIYPNRKFAEKIGEAW
Ga0187887_1097893123300018043PeatlandMAQLYPLLMQPLFDPRPWGTLDLSAIYPNHKFNERIG
Ga0187859_1019846213300018047PeatlandMTQLYPLLMSPLFDPRPWGTLDLAPIYPNRKFTEK
Ga0187858_1052413423300018057PeatlandMSQLYPFLMSPAFDPRPWGTLDLSAIYPNHKFNEKIG
Ga0187769_1073090613300018086Tropical PeatlandMSNLYPLLMLPAFDPRPWGTLDLSPIYPNHKFEEKIGEA
Ga0066662_1011075633300018468Grasslands SoilVCSPMSDLYPFLMTPVFDPRPWGTLDLSPIYPNQRPSE
Ga0181508_116712413300019256PeatlandMSNLYPLLMLPAFDARPWGTHDLSQIYPNRRFEEKIGEAW
Ga0193724_111686923300020062SoilMQSLYPFLMVPEFDPRPWGTTDLSPIYPSHRCTEKIGE
Ga0210407_1050534733300020579SoilMSPAFDPRPWGTLDLSAIYPNHKFNERIGEAWLTGDNCVV
Ga0210401_1020971933300020583SoilMNDLYPLLMSPVFDPRPWGTLDLSPIYPNHRFEEKIG
Ga0210381_1037428723300021078Groundwater SedimentMQPAFDPRPWGTLDLSPIYPNHRFEEKIGEAWLTGD
Ga0210404_1030333513300021088SoilMSKLYPLLMQPAFDPRPWGTLDLSPIYPNHKFQEKIG
Ga0210400_1122972123300021170SoilMGNLYPLLMLPAFDPRPWGTRDLSPIYPNHKFEENIGEAW
Ga0210405_1088152023300021171SoilMGELYPLLMLPGFDPRPWGTHDLSPIYPNRPFEEKIGEA
Ga0210396_1114822923300021180SoilMGNLYPLLMLPAFDARPWGTRDLSPIYPNHKFEEKI
Ga0213882_1003966033300021362Exposed RockMGKLYPLLMKPVFDPRPWGRLDLEPIYPQRFAEKIGESWLTATIPRSP
Ga0210393_1141618023300021401SoilMGNLYPLLMLPGFDPRPWGTLDLSPIYPNHKFDEKIGERPP
Ga0210385_1150979223300021402SoilMGNLYPLLMLPAFDPRPWGTHDLSPIYPNRPFEEKI
Ga0210394_1032291413300021420SoilMSPTFDPRPWGSEDLSPIYPNHRFQEKIGEAWLTGD
Ga0210384_1175295213300021432SoilMTDLYPLLMSPAFDPRPWGALDLSPIYPNHRFEEK
Ga0210390_1096757113300021474SoilMSDLYPLLMLPRFDPRPWGTHDLSPIYPNRQFEEKIGEA
Ga0210392_1081040323300021475SoilMGELYPLLMLPGFDPRPWGTHDLSPIYPNRPFEEKIGE
Ga0213853_1068196313300021861WatershedsMKDLYPFLMLPGFDPRPWGTLDLSPIYPNHKFAEKI
Ga0224550_105430423300022873SoilMLPKFDPRPWGTHNLSPIYPNRQFGEKIGEAWLTGDDCK
Ga0228598_112529423300024227RhizosphereMNELYPLLMSPVFDPRPWGTTDLSPIYPNHRFEEKIGEAWLT
Ga0208690_104502923300025434PeatlandMSNLYPLLMLPRFDPRPWGTLDLSPIYPNRQFEEKIGEA
Ga0208189_102526223300025444PeatlandMTQLYPFLMSPAFDPRPWGTLDLSPIYPNHKFNERIGEAWL
Ga0208562_101997333300025460PeatlandMTQLYPFLMSPAFDPRPWGTLDLSAIYPNHKFNERIGEAWLTG
Ga0208191_102622313300025496PeatlandMTELYPLLMSPAFDPRPWGTLDLSAIYPNHKFNERI
Ga0207707_1026281513300025912Corn RhizosphereMEKLYPLLMKPLFDPRPWGRVDLSPIYPRKFDEKIGESWLTGD
Ga0207700_1038422613300025928Corn, Switchgrass And Miscanthus RhizosphereMGNLYPLLMQPGFDPRPWGAQDLSPIYPNHKFAEKIGEA
Ga0207700_1166264523300025928Corn, Switchgrass And Miscanthus RhizosphereMELYPLLLLPEFSPRPWGAIDLSPIYAGRKFAEKIGESW
Ga0207704_1007594533300025938Miscanthus RhizosphereMEKLYPLLMKPLFDPRPWGRLDLSPIYSRKFNEKIGESWL
Ga0209761_120871613300026313Grasslands SoilMSELYPLLMMPAFDPRPWGALDLSPIYPNHRFEEKI
Ga0209154_105767913300026317SoilMPQLYPLLMSPAFDPRPWGTLDLSAIYPNAKFNERI
Ga0209059_128523713300026527SoilVCSPMSDLYPFLMTPVFDPRPWGTLDLSPIYPNQRPS
Ga0207819_101383613300027024Tropical Forest SoilMQPGFDPRPWGTTDLSPIYPNHEFAEKIGEAWLSGDDCKV
Ga0209729_101779913300027061Forest SoilMADLYPLRMQPAFDPRPWGTTDLSPIYPGHKFDEKIGEAW
Ga0209735_105503113300027562Forest SoilMLPGFDPRPWGTQDLSPIYPNHKFEEKIGEAWLTGDDC
Ga0208696_123737413300027696Peatlands SoilMSDLYPLLMHPLFDPRPWGTRDLSPIYPNHRFEEKIGEA
Ga0209446_117786213300027698Bog Forest SoilMTQLYPFLMSPAFDPRPWGTLDLSAIYPNAKFNERIGE
Ga0209908_1000667933300027745Thawing PermafrostMVMRNLYPLLMLPKFDPRPWGTHDLSPIYPNRQFEEKIGEAW
Ga0209448_1013430223300027783Bog Forest SoilMTQLYPLLMSPAFDPRPWGTLDLSAIYPNHKFNERI
Ga0209139_1001317513300027795Bog Forest SoilMGNLYPLLMLPAFDPRPWGTHDLSPIYPNRRFEEKIGE
Ga0209773_1045569223300027829Bog Forest SoilMLPGFDPRPWGTLDLSPIYPNHKFEEKIGEAWLSG
Ga0209580_1010428323300027842Surface SoilMQPLYPLLMQPMFDPRPWGTHDLSPIYPNHKFEQTIGE
Ga0209180_1078825513300027846Vadose Zone SoilMTELYPLLMSPAFDPRPWGTLDLSPIYPNHKFNEKIGEAWLT
Ga0209701_1022354223300027862Vadose Zone SoilMSELYPLLMTPVFDPRPWGRLDLSPIYPQLFTEKIGE
Ga0209701_1068281313300027862Vadose Zone SoilMSELYPLLMLPAFDPRPWGALDLSPIYPNHRFAEKIG
Ga0209579_1003182113300027869Surface SoilMGNLYPLLMLPAFDPRPWGTLDLSPIYPNHKFEEKIG
Ga0209590_1055496423300027882Vadose Zone SoilMSGLYALLMLPAFDPRPWGTVDLSPIYPNHKCEEKIG
Ga0209275_1047707513300027884SoilMGILYPLLMQPGFDPRPWGTLDLSPIYPNHKFGEKIGE
Ga0209583_1052796513300027910WatershedsMMLQLYPLLMSPAFDPRPWGTLDLSAIYPNHKFSERIGEAWLT
Ga0209168_1007180933300027986Surface SoilMGNLYPLLMLPGFDPRPWGTQDLSPIYPNHKFEEKIGE
Ga0209168_1028208923300027986Surface SoilMNDLYPMLMSPAFDPRPWGTTDLSPIYPNHRFAEKIGESW
Ga0302227_1029275613300028795PalsaMGNLYPLLMLPEFSPRPWGTHDLSPIYPNRPFEEKIGE
Ga0302222_1018979123300028798PalsaMGNLYPLLMLPKFDPRPWGTHNLSPIYPNRQFGEKI
Ga0302154_1062339523300028882BogMSPAFDPRPWGTLDLSAIYPNAKFNERIGEAWLTGDDCVVTN
Ga0311340_1102466513300029943PalsaMANLYPLLMLPAFDPRPWGTLDLSPIYPNHRFEEKI
Ga0311332_1104762723300029984FenMSELYPLLMSPVFDPRPWGTLDLSPIYPNHKFAEKIG
Ga0311336_1109517413300029990FenMTDLYPLLMPPAFDPRPWGTLDLSPIYPNHKFNEKIG
Ga0302182_1011995623300030054PalsaMANLYPLLMQPGFDPRPWGTQDLSPIYPNHRFETKI
Ga0302182_1013520823300030054PalsaMLPGFDPRPWGTLDLSPIYPNHKLEEKIGEAWLSGDDCKV
Ga0302182_1022395923300030054PalsaMSDLYPLLMLPLFDPRPWGTRDLSPIYPNHKFDENIGEA
Ga0302176_1023786123300030057PalsaMNQLYPLLMQPAFDPRPWGTLDLSAIYPNHKFNEPIGE
Ga0310039_1018582123300030706Peatlands SoilMMETLYPLLMLPAFDPRPWGTTDLSPIYPNHQFAE
Ga0265461_1338325913300030743SoilMGDLYPLLMRPRFDPRPWGTHDLSPIYPNHRFQEKIGES
Ga0170824_11939732823300031231Forest SoilMTQLYPLLMSPAFDPRPWGALDLAPIYLNRKFSDKIGEVWL
Ga0302307_1016665413300031233PalsaMIQLYPLLMQPSFDPRPWGTMDLSAIYPNHKFNERIGEAW
Ga0302307_1065856323300031233PalsaMANLYPLLMQPGFDPRPWGTQDLSPIYPNHRFETKIGEAWL
Ga0170820_1271150113300031446Forest SoilMSDLYPLLMTPLFDPRPWGRLDLSPIYDRRFKEKIGESWL
Ga0302326_1152987413300031525PalsaMADLYPLLMSPIFDPRPWGTTDLSPIYPNHRFEEKI
Ga0310686_11377388113300031708SoilMTDLYPLLMSPVFDPRPWGTTDLSPIYPNHRFDEKIGESWLTGDA
Ga0307476_1020692513300031715Hardwood Forest SoilMPDLYPLLMSPIFDPRPWGTDDLSPIYPSHRFEEKIGEA
Ga0307474_1146994023300031718Hardwood Forest SoilMTDLYPLLMRPLFDPRPWGTLDLSPVYPGHRFEEKIGEA
Ga0307475_1126896613300031754Hardwood Forest SoilMTQLYPLRMQPAFDPRPWGTTDLSPIYPDHKFDEKIG
Ga0306921_1174666523300031912SoilMQPVFDPRPWGTTDLSPIYPDRKYGEKIGEAWLTGDH
Ga0310912_1094313513300031941SoilMGNLYPLLMQPGFDPRPWGTQDLSPIYPNHKFGEKIGE
Ga0306920_10289657513300032261SoilMTQLYPLRMQPAFDPRPWGTTDLSPIYPDHKFDEKIGEAWL
Ga0348332_1039137413300032515Plant LitterMTDLYPLLMSPAFDPRPWGTLDLSPIYPNHRFEEK
Ga0335085_1102250223300032770SoilMGNLYPLLMLPGFDPRPWGTQDLSPIYPNHKFEEKIG
Ga0335082_1132835213300032782SoilMGNLYPLLMQPGFDPRPWGTQDLSPIYPNHRFEQKIGES
Ga0335078_1011193863300032805SoilMGNLYPLLMLPGFDPRPWGTLDLSPMYPNHRFEEKIGEA
Ga0335078_1242623323300032805SoilMSDLYPLLMSPAFDPRPWGTLDLSPIYPNHRFEEKI
Ga0335083_1044806213300032954SoilMGSLYPLLMVPGFDPRPWGTYDLSPIYPNHKFQEKIGESWL
Ga0335077_1214190213300033158SoilMSELYPLLMPPVFDPRPWGTLDLSPIYPNQQFQEK
Ga0310810_1054426323300033412SoilMLPGFDPRPWGTLDLSAIYPNHKFAEKIGEAWLSG
Ga0314861_0364728_3_1103300033977PeatlandMTQLYPLLMSPLFDPRPWGTLDLAPIYPIHKFNEKI
Ga0370483_0095729_1_1203300034124Untreated Peat SoilMANLYPLLMRAKFDPRPWGTLDLSPIYPNHKFEEKIGEAW
Ga0370515_0436625_433_5523300034163Untreated Peat SoilMSNLYPLLMTPAFDPRPWGTQDLSPIYPNRQFGEKIGEAW


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.