| Basic Information | |
|---|---|
| Family ID | F031956 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 181 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MTMTAREAFERGTDTFNAHDIDGFAEVLADDVVFKAPGGIQG |
| Number of Associated Samples | 151 |
| Number of Associated Scaffolds | 181 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 98.90 % |
| % of genes near scaffold ends (potentially truncated) | 96.13 % |
| % of genes from short scaffolds (< 2000 bps) | 95.58 % |
| Associated GOLD sequencing projects | 138 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.54 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (91.160 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (24.862 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.149 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.409 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 31.43% β-sheet: 5.71% Coil/Unstructured: 62.86% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 181 Family Scaffolds |
|---|---|---|
| PF00196 | GerE | 69.06 |
| PF14534 | DUF4440 | 1.66 |
| PF13191 | AAA_16 | 1.10 |
| PF00440 | TetR_N | 1.10 |
| PF05147 | LANC_like | 1.10 |
| PF12704 | MacB_PCD | 1.10 |
| PF03466 | LysR_substrate | 0.55 |
| PF06772 | LtrA | 0.55 |
| PF07040 | DUF1326 | 0.55 |
| PF05025 | RbsD_FucU | 0.55 |
| PF04672 | Methyltransf_19 | 0.55 |
| PF05988 | DUF899 | 0.55 |
| PF09361 | Phasin_2 | 0.55 |
| PF12706 | Lactamase_B_2 | 0.55 |
| PF00378 | ECH_1 | 0.55 |
| PF07045 | DUF1330 | 0.55 |
| PF01156 | IU_nuc_hydro | 0.55 |
| PF03551 | PadR | 0.55 |
| PF14294 | DUF4372 | 0.55 |
| COG ID | Name | Functional Category | % Frequency in 181 Family Scaffolds |
|---|---|---|---|
| COG4403 | Lantibiotic modifying enzyme | Defense mechanisms [V] | 1.10 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.55 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.55 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.55 |
| COG1869 | D-ribose pyranose/furanose isomerase RbsD | Carbohydrate transport and metabolism [G] | 0.55 |
| COG1957 | Inosine-uridine nucleoside N-ribohydrolase | Nucleotide transport and metabolism [F] | 0.55 |
| COG4154 | L-fucose mutarotase/ribose pyranase, RbsD/FucU family | Carbohydrate transport and metabolism [G] | 0.55 |
| COG4292 | Low temperature requirement protein LtrA (function unknown) | Function unknown [S] | 0.55 |
| COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 0.55 |
| COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 0.55 |
| COG5588 | Uncharacterized conserved protein, DUF1326 domain | Function unknown [S] | 0.55 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 91.16 % |
| Unclassified | root | N/A | 8.84 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459023|GZGNO2B01CUPCF | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_100785487 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 2532 | Open in IMG/M |
| 3300003368|JGI26340J50214_10151423 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 580 | Open in IMG/M |
| 3300004114|Ga0062593_102113463 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300004643|Ga0062591_102066659 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300005093|Ga0062594_100262246 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas | 1276 | Open in IMG/M |
| 3300005343|Ga0070687_100940627 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300005455|Ga0070663_100946544 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 746 | Open in IMG/M |
| 3300005459|Ga0068867_101875621 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 565 | Open in IMG/M |
| 3300005468|Ga0070707_100373729 | All Organisms → cellular organisms → Bacteria | 1385 | Open in IMG/M |
| 3300005561|Ga0066699_11221294 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300005591|Ga0070761_10474832 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 769 | Open in IMG/M |
| 3300005610|Ga0070763_10608307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 634 | Open in IMG/M |
| 3300005615|Ga0070702_101268423 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 597 | Open in IMG/M |
| 3300005718|Ga0068866_10098093 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 1611 | Open in IMG/M |
| 3300005719|Ga0068861_100177231 | All Organisms → cellular organisms → Bacteria | 1771 | Open in IMG/M |
| 3300005764|Ga0066903_101285548 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 1365 | Open in IMG/M |
| 3300005764|Ga0066903_105468726 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300005764|Ga0066903_105475473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 669 | Open in IMG/M |
| 3300005764|Ga0066903_107578142 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300005841|Ga0068863_102289371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 550 | Open in IMG/M |
| 3300006175|Ga0070712_100978354 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
| 3300006175|Ga0070712_101108313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 687 | Open in IMG/M |
| 3300006581|Ga0074048_12389732 | Not Available | 502 | Open in IMG/M |
| 3300006755|Ga0079222_11637942 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300006914|Ga0075436_100284147 | All Organisms → cellular organisms → Bacteria | 1183 | Open in IMG/M |
| 3300006954|Ga0079219_11751073 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300007076|Ga0075435_101038335 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300009098|Ga0105245_10114176 | All Organisms → cellular organisms → Bacteria | 2515 | Open in IMG/M |
| 3300009101|Ga0105247_11564308 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 540 | Open in IMG/M |
| 3300009176|Ga0105242_12714550 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 545 | Open in IMG/M |
| 3300009545|Ga0105237_11049521 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 822 | Open in IMG/M |
| 3300009551|Ga0105238_10263101 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1705 | Open in IMG/M |
| 3300009700|Ga0116217_10553242 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 719 | Open in IMG/M |
| 3300009792|Ga0126374_10597913 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 814 | Open in IMG/M |
| 3300010043|Ga0126380_10676548 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 826 | Open in IMG/M |
| 3300010048|Ga0126373_12201205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 612 | Open in IMG/M |
| 3300010358|Ga0126370_12409724 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300010360|Ga0126372_11385855 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 735 | Open in IMG/M |
| 3300010360|Ga0126372_13164730 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 511 | Open in IMG/M |
| 3300010373|Ga0134128_11816786 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 671 | Open in IMG/M |
| 3300010373|Ga0134128_13236132 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 500 | Open in IMG/M |
| 3300010376|Ga0126381_105088045 | Not Available | 504 | Open in IMG/M |
| 3300010396|Ga0134126_10723908 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 1129 | Open in IMG/M |
| 3300012199|Ga0137383_10084657 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 2294 | Open in IMG/M |
| 3300012201|Ga0137365_11020222 | Not Available | 599 | Open in IMG/M |
| 3300012515|Ga0157338_1044851 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 615 | Open in IMG/M |
| 3300012897|Ga0157285_10365011 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 510 | Open in IMG/M |
| 3300012898|Ga0157293_10277106 | Not Available | 544 | Open in IMG/M |
| 3300012961|Ga0164302_10625637 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 785 | Open in IMG/M |
| 3300012971|Ga0126369_10499131 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 1274 | Open in IMG/M |
| 3300012971|Ga0126369_10803013 | Not Available | 1023 | Open in IMG/M |
| 3300012984|Ga0164309_11834669 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 520 | Open in IMG/M |
| 3300012987|Ga0164307_10509100 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 911 | Open in IMG/M |
| 3300012989|Ga0164305_11564072 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 587 | Open in IMG/M |
| 3300013306|Ga0163162_13191238 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 526 | Open in IMG/M |
| 3300013307|Ga0157372_13202763 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 522 | Open in IMG/M |
| 3300013772|Ga0120158_10163527 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 1212 | Open in IMG/M |
| 3300015371|Ga0132258_10683345 | All Organisms → cellular organisms → Bacteria | 2583 | Open in IMG/M |
| 3300015372|Ga0132256_102463348 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Nordella → unclassified Nordella → Nordella sp. HKS 07 | 622 | Open in IMG/M |
| 3300015374|Ga0132255_106263059 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 504 | Open in IMG/M |
| 3300016270|Ga0182036_11419251 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 581 | Open in IMG/M |
| 3300016270|Ga0182036_11705717 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 532 | Open in IMG/M |
| 3300016319|Ga0182033_11005686 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 742 | Open in IMG/M |
| 3300016341|Ga0182035_11743055 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300016357|Ga0182032_10939481 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 736 | Open in IMG/M |
| 3300016371|Ga0182034_11922116 | Not Available | 522 | Open in IMG/M |
| 3300016387|Ga0182040_10595181 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 895 | Open in IMG/M |
| 3300016387|Ga0182040_11462987 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300016404|Ga0182037_11085332 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 700 | Open in IMG/M |
| 3300016404|Ga0182037_11579927 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300016445|Ga0182038_10674962 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 898 | Open in IMG/M |
| 3300017821|Ga0187812_1102024 | All Organisms → cellular organisms → Bacteria | 937 | Open in IMG/M |
| 3300017966|Ga0187776_10389573 | Not Available | 929 | Open in IMG/M |
| 3300017973|Ga0187780_10221848 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 1320 | Open in IMG/M |
| 3300017973|Ga0187780_10280933 | All Organisms → cellular organisms → Bacteria | 1169 | Open in IMG/M |
| 3300018058|Ga0187766_10351702 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 965 | Open in IMG/M |
| 3300018060|Ga0187765_10851864 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 613 | Open in IMG/M |
| 3300020580|Ga0210403_11437054 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 521 | Open in IMG/M |
| 3300020581|Ga0210399_10094942 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 2434 | Open in IMG/M |
| 3300021088|Ga0210404_10277825 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 917 | Open in IMG/M |
| 3300021358|Ga0213873_10274025 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 539 | Open in IMG/M |
| 3300021358|Ga0213873_10311560 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 510 | Open in IMG/M |
| 3300021362|Ga0213882_10177842 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 875 | Open in IMG/M |
| 3300021362|Ga0213882_10405398 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300021374|Ga0213881_10167664 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 965 | Open in IMG/M |
| 3300021374|Ga0213881_10459834 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 575 | Open in IMG/M |
| 3300021377|Ga0213874_10060535 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 1185 | Open in IMG/M |
| 3300021384|Ga0213876_10575119 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 599 | Open in IMG/M |
| 3300021404|Ga0210389_11052031 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300021406|Ga0210386_11825280 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 500 | Open in IMG/M |
| 3300021407|Ga0210383_10254840 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 1506 | Open in IMG/M |
| 3300021407|Ga0210383_11740409 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 510 | Open in IMG/M |
| 3300021433|Ga0210391_10458167 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 1001 | Open in IMG/M |
| 3300021475|Ga0210392_10264103 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 1224 | Open in IMG/M |
| 3300021477|Ga0210398_10316349 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 1273 | Open in IMG/M |
| 3300021953|Ga0213880_10048420 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 1031 | Open in IMG/M |
| 3300025899|Ga0207642_10008639 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3505 | Open in IMG/M |
| 3300025900|Ga0207710_10709241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 528 | Open in IMG/M |
| 3300025912|Ga0207707_11250443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 599 | Open in IMG/M |
| 3300025914|Ga0207671_10700931 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 805 | Open in IMG/M |
| 3300025921|Ga0207652_11403330 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 602 | Open in IMG/M |
| 3300025925|Ga0207650_11668364 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300025926|Ga0207659_11920735 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300025928|Ga0207700_10957032 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 766 | Open in IMG/M |
| 3300025929|Ga0207664_10596623 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus | 992 | Open in IMG/M |
| 3300025929|Ga0207664_11397747 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300025934|Ga0207686_11720285 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300025935|Ga0207709_11295144 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 602 | Open in IMG/M |
| 3300025937|Ga0207669_10684065 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 842 | Open in IMG/M |
| 3300025937|Ga0207669_11565441 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 562 | Open in IMG/M |
| 3300025961|Ga0207712_10816810 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
| 3300026035|Ga0207703_10517569 | Not Available | 1122 | Open in IMG/M |
| 3300026041|Ga0207639_11451561 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 644 | Open in IMG/M |
| 3300027570|Ga0208043_1038131 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Catellatospora | 1452 | Open in IMG/M |
| 3300027909|Ga0209382_12260039 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 512 | Open in IMG/M |
| 3300028587|Ga0247828_11030524 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300028589|Ga0247818_10198547 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 1317 | Open in IMG/M |
| 3300028596|Ga0247821_10523410 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 757 | Open in IMG/M |
| 3300029636|Ga0222749_10538763 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 635 | Open in IMG/M |
| 3300030707|Ga0310038_10360442 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300031544|Ga0318534_10268604 | Not Available | 983 | Open in IMG/M |
| 3300031546|Ga0318538_10767592 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 523 | Open in IMG/M |
| 3300031679|Ga0318561_10601839 | Not Available | 605 | Open in IMG/M |
| 3300031679|Ga0318561_10642712 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300031681|Ga0318572_10545035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 691 | Open in IMG/M |
| 3300031681|Ga0318572_10898136 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300031682|Ga0318560_10645605 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 573 | Open in IMG/M |
| 3300031708|Ga0310686_113209023 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 986 | Open in IMG/M |
| 3300031716|Ga0310813_12290142 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300031744|Ga0306918_10268303 | Not Available | 1307 | Open in IMG/M |
| 3300031744|Ga0306918_11363429 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 544 | Open in IMG/M |
| 3300031751|Ga0318494_10332240 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 878 | Open in IMG/M |
| 3300031751|Ga0318494_10576316 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 657 | Open in IMG/M |
| 3300031768|Ga0318509_10092370 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 1621 | Open in IMG/M |
| 3300031770|Ga0318521_10967117 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 521 | Open in IMG/M |
| 3300031778|Ga0318498_10366245 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 642 | Open in IMG/M |
| 3300031778|Ga0318498_10379094 | Not Available | 630 | Open in IMG/M |
| 3300031779|Ga0318566_10330743 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 753 | Open in IMG/M |
| 3300031799|Ga0318565_10217710 | All Organisms → cellular organisms → Bacteria | 928 | Open in IMG/M |
| 3300031805|Ga0318497_10697770 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 569 | Open in IMG/M |
| 3300031820|Ga0307473_10244233 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 1097 | Open in IMG/M |
| 3300031854|Ga0310904_10587238 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
| 3300031879|Ga0306919_11423477 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 523 | Open in IMG/M |
| 3300031890|Ga0306925_11211578 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 756 | Open in IMG/M |
| 3300031893|Ga0318536_10259026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 884 | Open in IMG/M |
| 3300031894|Ga0318522_10078651 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 1202 | Open in IMG/M |
| 3300031910|Ga0306923_10745838 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 1086 | Open in IMG/M |
| 3300031912|Ga0306921_11775291 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 664 | Open in IMG/M |
| 3300031912|Ga0306921_12475999 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300031941|Ga0310912_10449054 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 1005 | Open in IMG/M |
| 3300031941|Ga0310912_11228953 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 570 | Open in IMG/M |
| 3300031942|Ga0310916_11219028 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300031946|Ga0310910_10152611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 1768 | Open in IMG/M |
| 3300031947|Ga0310909_10615363 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
| 3300031954|Ga0306926_11039248 | Not Available | 973 | Open in IMG/M |
| 3300032001|Ga0306922_10101052 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 3050 | Open in IMG/M |
| 3300032001|Ga0306922_10964089 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 882 | Open in IMG/M |
| 3300032001|Ga0306922_11393374 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 705 | Open in IMG/M |
| 3300032008|Ga0318562_10432252 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 765 | Open in IMG/M |
| 3300032009|Ga0318563_10269549 | Not Available | 920 | Open in IMG/M |
| 3300032009|Ga0318563_10568502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 612 | Open in IMG/M |
| 3300032010|Ga0318569_10376204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 662 | Open in IMG/M |
| 3300032025|Ga0318507_10304908 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 693 | Open in IMG/M |
| 3300032055|Ga0318575_10232996 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 928 | Open in IMG/M |
| 3300032068|Ga0318553_10113129 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 1390 | Open in IMG/M |
| 3300032068|Ga0318553_10602100 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 575 | Open in IMG/M |
| 3300032076|Ga0306924_10424234 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1521 | Open in IMG/M |
| 3300032076|Ga0306924_10821154 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 1035 | Open in IMG/M |
| 3300032089|Ga0318525_10542315 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 595 | Open in IMG/M |
| 3300032090|Ga0318518_10568520 | Not Available | 579 | Open in IMG/M |
| 3300032174|Ga0307470_10012911 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3533 | Open in IMG/M |
| 3300032180|Ga0307471_100984965 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 1010 | Open in IMG/M |
| 3300032261|Ga0306920_102723907 | Not Available | 675 | Open in IMG/M |
| 3300032261|Ga0306920_104177451 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 521 | Open in IMG/M |
| 3300032828|Ga0335080_10838542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 947 | Open in IMG/M |
| 3300032892|Ga0335081_11995842 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 619 | Open in IMG/M |
| 3300033158|Ga0335077_10296233 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 1772 | Open in IMG/M |
| 3300033290|Ga0318519_10320815 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 910 | Open in IMG/M |
| 3300033550|Ga0247829_11562344 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 544 | Open in IMG/M |
| 3300034819|Ga0373958_0203859 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197 | 519 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 24.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.36% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.76% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.76% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.76% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 2.76% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.21% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.21% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.66% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.66% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.66% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.66% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.66% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.66% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.66% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.66% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.66% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.66% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.66% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.10% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.10% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.10% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.10% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.10% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.10% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.10% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 1.10% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.10% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.55% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.55% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.55% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.55% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.55% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.55% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.55% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.55% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.55% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.55% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.55% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.55% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.55% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459023 | Grass soil microbial communities from Rothamsted Park, UK - FA3 (control condition) | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300003368 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006581 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Host-Associated | Open in IMG/M |
| 3300012897 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1 | Environmental | Open in IMG/M |
| 3300012898 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1 | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013772 | Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Host-Associated | Open in IMG/M |
| 3300021362 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09 | Environmental | Open in IMG/M |
| 3300021374 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08 | Environmental | Open in IMG/M |
| 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
| 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021953 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R07 | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027570 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
| 3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
| 3300028596 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glycerol_Day14 | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FA3_00361070 | 2170459023 | Grass Soil | MTMTTREAFERGTDTFNAHDIDGFAEVLADEVVFTAPG |
| INPhiseqgaiiFebDRAFT_1007854872 | 3300000364 | Soil | MTMTPRQAFEKGTATFNAHDLDGFAEVLDDDVVFRAPGGTHG |
| JGI26340J50214_101514231 | 3300003368 | Bog Forest Soil | MAMSAREAFEKGTQTFSAHNIEGFAEVLADDVTTPSSPASG |
| Ga0062593_1021134632 | 3300004114 | Soil | MTTREAFERGTDTFNAHDINAFAGVLADDVVFVAPGGMRG |
| Ga0062591_1020666591 | 3300004643 | Soil | MTTTTREAFERGTQTFNDHDIDGFAEVLADDVVFTAPGAHGGGKGPCVEFYGGWLNAFPD |
| Ga0062594_1002622461 | 3300005093 | Soil | MTTTREAFERGTQTFNDHDIEGFAEVLAEDVVFTAPGVSGEGKGPCIEFYGGWLDAFP |
| Ga0070687_1009406272 | 3300005343 | Switchgrass Rhizosphere | MAMTAREAFERGTATFNAHDIDGFAKVLADDVVFKAPGGMQGGGKAACAA |
| Ga0070663_1009465441 | 3300005455 | Corn Rhizosphere | MTTTMTTREAFQQGTDTFNAHDLRGFAEVLDDDVAVAAPGGMRSEGKDA |
| Ga0068867_1018756211 | 3300005459 | Miscanthus Rhizosphere | MTTREAFERGTDTFNAHDIAGFAEVLADDVVFVAPGPTRGEGKAA |
| Ga0070707_1003737291 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MTTREAFERGTDTFNAHDINAFTDVLADDVVFTAPGGMRGEGKA |
| Ga0066699_112212941 | 3300005561 | Soil | MAMTTREAFERGTDTFNNHDLDGFAEVVDDDVVFQAPGGIRG |
| Ga0070761_104748322 | 3300005591 | Soil | MTMTAREAFEKGTATFNAHDIDGFKEVLADNVVFTAPGGLKGEGKE |
| Ga0070763_106083071 | 3300005610 | Soil | MTMTVREAFAKGTETFNAHDIDGFSDVLADKAVFRAPGGMRGEGKTACAQFF |
| Ga0070702_1012684231 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MTMTAREAFERGTATFNAHDLDGFTEVLADDVVFTAPGGV |
| Ga0068866_100980932 | 3300005718 | Miscanthus Rhizosphere | MTTREAFERGTDTFNAHDIGGFTEVLADDVVVVAPGPVRGEGRAACA |
| Ga0068861_1001772312 | 3300005719 | Switchgrass Rhizosphere | MTTREAFERGTDTFNAHDINAFTDVLADDVVFTAPGGMRGEG |
| Ga0066903_1012855481 | 3300005764 | Tropical Forest Soil | MAMTLREAFEKGTQTFNDHDIDGFTRVLADDVTYH |
| Ga0066903_1054687261 | 3300005764 | Tropical Forest Soil | MAMTAREAFERGTNTFNAHDMKGFAEVLADDVAFAAPGGIRGVGKTGCIEFFGAWF |
| Ga0066903_1054754731 | 3300005764 | Tropical Forest Soil | MTMTARVAFEKGTATFNAHDLDGFTQVLADDVVFKAPGGM |
| Ga0066903_1075781421 | 3300005764 | Tropical Forest Soil | MTRTVQEAFERGTATFNAHDIDGFAEVLSDDVVFEAAGGIRGTGKA |
| Ga0068863_1022893712 | 3300005841 | Switchgrass Rhizosphere | MTISTHAAFERGTETFNAHDIDGFTSVLADDVTYRAPGGISGQG |
| Ga0070712_1009783542 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MTMTAHEAFERGTDTFNAHDVEGFAAVLADDVVFRAPGGMRGQGK |
| Ga0070712_1011083131 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MTMTAREAFEKGTATFNTHDLDGFTEVLADDVVFKAPGGVQGKGKTDCAAF |
| Ga0074048_123897322 | 3300006581 | Soil | MTTTLREAFEKGTEAFNAHDIDRFADVLADDVVFRAP |
| Ga0079222_116379421 | 3300006755 | Agricultural Soil | MSTTVREAFERGTETFNAHDLDGFAAVLADEVTFEAPGGLRGEGKAAC |
| Ga0075436_1002841471 | 3300006914 | Populus Rhizosphere | MNTREAFEKGTETFNFHDIKGFAGVLADDVVFEAPGG |
| Ga0079219_117510732 | 3300006954 | Agricultural Soil | MTMTARDAFERGTDTFNAHDIDGFAAVLSDDVVFQA |
| Ga0075435_1010383351 | 3300007076 | Populus Rhizosphere | MTMTVHEAFVKGTETFNAHDIDGFTSVLADDVVFQAPGGISGAGKA |
| Ga0105245_101141764 | 3300009098 | Miscanthus Rhizosphere | MSMSTREAFQRGTDTFNAHDIDGFAEVLADDVVFKA |
| Ga0105247_115643081 | 3300009101 | Switchgrass Rhizosphere | MTTREAFERGTDTFNAHDIDGFTEVLADDVVVVAPGPVRGEGRAACAA |
| Ga0105242_127145501 | 3300009176 | Miscanthus Rhizosphere | MAMTVREAFEKGTETFNAHDIDGFTSVLAGDVVYRAPGGISGQGKEACA |
| Ga0105237_110495211 | 3300009545 | Corn Rhizosphere | MTTREAFERGTDTFNAHDIAGFAEVLADDVVFVAPGPNRGE |
| Ga0105238_102631011 | 3300009551 | Corn Rhizosphere | MTTREAFERGTDTFNAHDIAGFAEVLADDVAFVAPGPMRGEGKAACA |
| Ga0116217_105532421 | 3300009700 | Peatlands Soil | MAMTIREAFAKGTETFNAHDIDGFTSVLADDVVVR |
| Ga0126374_105979131 | 3300009792 | Tropical Forest Soil | MAMTVREAFEKGTDTFNAHDIDGFTSVLADDAVFRAPGGM |
| Ga0126380_106765481 | 3300010043 | Tropical Forest Soil | MAMTVREAFQKGTDTFNDHDIDGFSSVLADDVTYSAPGISGRGK |
| Ga0126373_122012052 | 3300010048 | Tropical Forest Soil | MAMTVREAFEKGTDTFNAHDIDGFTSVLADDVTYSAPGGITGQG |
| Ga0126370_124097241 | 3300010358 | Tropical Forest Soil | MTAREAFERGTKTFNAHDIKGFAEVLADDVVFQAPGGLRGEGKTACSE |
| Ga0126372_113858551 | 3300010360 | Tropical Forest Soil | MTAREAFERGTATFNAHDLDGFAEVLADQVVFKAPGGIEGEGKAAC |
| Ga0126372_131647301 | 3300010360 | Tropical Forest Soil | MTAREAFEKGTAAFNAHDLDGFAEVLADNVVFEAPGG |
| Ga0134128_118167861 | 3300010373 | Terrestrial Soil | MAMTVREAFHKGTDTFNAHDIDGFTSVLADDVVFQAPGGV |
| Ga0134128_132361321 | 3300010373 | Terrestrial Soil | MTAREAFEKGTATFNAHDIDGFTKVLVDDVVFKAPGGIDGEGKGACAAFFGSWFTAF |
| Ga0126381_1050880452 | 3300010376 | Tropical Forest Soil | MARTVREAFERGTETFNAHDIDGFADALSDNVTFEAPGGLRGDGKTA |
| Ga0134126_107239082 | 3300010396 | Terrestrial Soil | MAMTVREAFEKGTDTFNAHDIDGFTSVLADDVVFRAPGGMSGQGKA |
| Ga0137383_100846571 | 3300012199 | Vadose Zone Soil | MAMTVHEAFVKGTETFNAHDIDGFSSVLADDVVFHAPGGISGE |
| Ga0137365_110202222 | 3300012201 | Vadose Zone Soil | MTDTAREAFQKGTETFNARNIDGFAEVLADDVVVEAPGGVRGEGKAA* |
| Ga0157338_10448512 | 3300012515 | Arabidopsis Rhizosphere | MAMTTRDAFEKGTDTFNAHDLAGFADVLADDVVFKAPGGMHGNG |
| Ga0157285_103650111 | 3300012897 | Soil | MGTVRHGSAMTVREAFERGTETFNAHDIDGFAAVLADDVVF |
| Ga0157293_102771062 | 3300012898 | Soil | MSVTTREAFERGTDTFNAHDIDGFAGVLADDVVFTAPGGMRG |
| Ga0164302_106256371 | 3300012961 | Soil | MTPREAFERGTETFNAHDITGFAAVLADDVVFEAPGG |
| Ga0126369_104991311 | 3300012971 | Tropical Forest Soil | MTAREAFERGTTTFNAHDLDGFAEVLADQVVFKAPGGMQGEGKVACAAF |
| Ga0126369_108030132 | 3300012971 | Tropical Forest Soil | MAMTVRKAFDKGTQTFNAHDIDGFTSVLADDVSYTAPGGMTGQG |
| Ga0164309_118346691 | 3300012984 | Soil | MTMAVRQAFEKGTATFNAHDLDGFTEVLADDVVFKAPGG |
| Ga0164307_105091001 | 3300012987 | Soil | MTVREAFEKGTETFNAHDIDGFTGVLADDVVYRAPGGISGQGKEA |
| Ga0164305_115640721 | 3300012989 | Soil | MTAREAFEKGTATFNAHDLDGFAKVLADDVVFKAPGGLHGEGK |
| Ga0163162_131912382 | 3300013306 | Switchgrass Rhizosphere | MTMTAREAFEKGTATFNAQDLDGFKEVLADDVVFKAPG |
| Ga0157372_132027631 | 3300013307 | Corn Rhizosphere | MTAREAFEKGTATFNAHDLDAFTEVLADDVAFKAPG |
| Ga0120158_101635272 | 3300013772 | Permafrost | MTMTVREAFEKGTEAYNAHDIDGFAEVLADDVAFRAPGGLGGQGRAACAE |
| Ga0132258_106833451 | 3300015371 | Arabidopsis Rhizosphere | MSRSPTPERHAMAMTVREAFERGTETFNAHDLDGFAEVLEDDVVFEASGGMRGAGKPACLAFYGS* |
| Ga0132256_1024633481 | 3300015372 | Arabidopsis Rhizosphere | VTITVREAFERGTETFNSHDIAGFMEVLADDVTFEAPGGLRGEGKEACT |
| Ga0132255_1062630592 | 3300015374 | Arabidopsis Rhizosphere | MPLTPREAFEIGTRTFNAHDLDGFADVLADDVVFDAPG |
| Ga0182036_114192512 | 3300016270 | Soil | MTMTARVAFEKGTATFNAHDLDGFTQVLADDVVFKAPGGMHG |
| Ga0182036_117057171 | 3300016270 | Soil | MPMTIREAFERGTETFNAHDIDSFAEVLADDVAFKAPGGVDGQGK |
| Ga0182033_110056861 | 3300016319 | Soil | MTMTAREAFERGTDTFNAHDIDGFAEVLADNVVFKAPGGIQ |
| Ga0182035_117430551 | 3300016341 | Soil | MAMTAREAFEKGTKTFNAHDIDGFAGVLADDVVFEAPGGVRGKGKA |
| Ga0182032_109394811 | 3300016357 | Soil | MGMSAREAFERGTNAFNAHDTKGFAEVLADDVAFAA |
| Ga0182034_119221162 | 3300016371 | Soil | MAMTAREAFEKGTETFNAHDIKGFADVLADDVAFEA |
| Ga0182040_105951811 | 3300016387 | Soil | MAMTARKAFERGTDTFNDHNIEGFRGVLADDVIFQAP |
| Ga0182040_114629871 | 3300016387 | Soil | MVMTAREAFEKGTNTFNAHDMEGFAEVLAEDVACG |
| Ga0182037_110853321 | 3300016404 | Soil | MAMTVREAFDKGTDTFNAHDIDGFTSVLADDAVFRAPGGMTGQGKA |
| Ga0182037_115799271 | 3300016404 | Soil | MMAMSTREAFERGTDTFNAHDIEGFTAVLADDVVF |
| Ga0182038_106749622 | 3300016445 | Soil | MTMTAREAFERGTDTFNAHDIDGFAEVLADDVVFKAPGGIQG |
| Ga0187812_11020242 | 3300017821 | Freshwater Sediment | MAMTIREAFEKGTDTFNAHDIDGFASVLADDVVYQAP |
| Ga0187776_103895732 | 3300017966 | Tropical Peatland | MTMTPREAFEKGTAAFNAYDIDAFAEVLADDVVFTVPALAA |
| Ga0187780_102218482 | 3300017973 | Tropical Peatland | MAKTVREAFDKGTDTFNAHDIDGFTSVLADDAVFRAPGGINGQGKAAC |
| Ga0187780_102809333 | 3300017973 | Tropical Peatland | MTMTVRESFQRGTEAFNAHDIDGFATVLADDVVLRAPGGMSGA |
| Ga0187766_103517022 | 3300018058 | Tropical Peatland | MAMTNREAFAKGTDTFNAHDIDGFASVLADDVVYQAPGGLSGQGK |
| Ga0187765_108518642 | 3300018060 | Tropical Peatland | MAMTVREAFEQGTQTFNAHDIDGFTSVLADDVTYHAP |
| Ga0210403_114370541 | 3300020580 | Soil | MAMTTRAAFEKGTATFNAHDIAGFAEVLADDVVFTAPGGMHGDGKATCAAF |
| Ga0210399_100949421 | 3300020581 | Soil | MTMTVHEAFVKGTETFNAHDIDGFTSVLADDVVFQAPGGISGEGQ |
| Ga0210404_102778251 | 3300021088 | Soil | MTMTVRQAFEKGTATFNAHDLEGFAEVLADDVVFKAPGGMH |
| Ga0213873_102740251 | 3300021358 | Rhizosphere | MTMTTRESFERGTDTFNAHDMDGFAEVVAEDVVVVAPG |
| Ga0213873_103115601 | 3300021358 | Rhizosphere | MTMTTREAFERGTDTFNAHDLDGFAEVLADDVVFAAPGGMHG |
| Ga0213882_101778421 | 3300021362 | Exposed Rock | MTISMREAFERGTDAFNAHDMDGFAEVVADDVVVVAP |
| Ga0213882_104053982 | 3300021362 | Exposed Rock | MTMNTREAFERGTDTFNAHDLDGFAEVIADDVVFAAPGGIHGE |
| Ga0213881_101676642 | 3300021374 | Exposed Rock | MTMTTRESFERGTDTFNAHDMDGFAEVVAEDVVVVAPGVRCDGK |
| Ga0213881_104598341 | 3300021374 | Exposed Rock | MTISMREAFERGTDAFNAHDMDGFAEVIADDVVVV |
| Ga0213874_100605351 | 3300021377 | Plant Roots | MTITTTAQDAFEKGTETFNAHDIAGFSDVLADDVN |
| Ga0213876_105751192 | 3300021384 | Plant Roots | MTMTTRESFERGTDTFNAHDMDGFAEVVAEDVVVV |
| Ga0210389_110520311 | 3300021404 | Soil | MAMTAHEAFVKGTETFNAHDIDGFTSVLADDVVFQAPGGLSGKGKA |
| Ga0210386_118252802 | 3300021406 | Soil | MTMTAREAFEKGTATFNAHDIDGFAQVLADDVTFKAPGGVRGEGKAA |
| Ga0210383_102548402 | 3300021407 | Soil | MAITVREAFEKGTDTFNAHDIDGFTSVLADDVTYSAPGGMS |
| Ga0210383_117404091 | 3300021407 | Soil | MTMTAREAFEKGTATFNAHDIDGFKEVLADNVVFTAPG |
| Ga0210391_104581671 | 3300021433 | Soil | MAMTVREAFEKGTETFNAHDIDGFTSVLADDAAFRAPGGMT |
| Ga0210392_102641032 | 3300021475 | Soil | MTMTVRQAFEKGTATFNAHDLEGFAEVLADDVIFKAPGGMHGEGKAA |
| Ga0210398_103163491 | 3300021477 | Soil | MAMTVREAFEKGTETFNAHDIDGFTSVLADDAAFRAPGGMTGQ |
| Ga0213880_100484201 | 3300021953 | Exposed Rock | MTMTTREAFERGTDTFNAHDLDGFAEVIADDVVFTAPG |
| Ga0207642_100086393 | 3300025899 | Miscanthus Rhizosphere | MTTREAFERGTDTFNAHDIGGFTEVLADDVVVVAPGPVRGE |
| Ga0207710_107092411 | 3300025900 | Switchgrass Rhizosphere | MTTREAFERGTDTFNAHDIDGFAEVLADDVVFVAPGPMRGEGRA |
| Ga0207707_112504432 | 3300025912 | Corn Rhizosphere | VTTLTTREVFQAGTDAFNAHDIDAFAELLADDVVFDA |
| Ga0207671_107009312 | 3300025914 | Corn Rhizosphere | MTTREAFARGTDTFNAHDIAGFAEVLADDVVFVAPG |
| Ga0207652_114033301 | 3300025921 | Corn Rhizosphere | MAMTVREAFEKGTETFNAHDIDGFTSVLAGDVVYRAPGGISGQGKEACAGF |
| Ga0207650_116683642 | 3300025925 | Switchgrass Rhizosphere | MTTTMTTREAFQQGTDTFNAHDLRGFAEVLDDDVAVAAPGGMRSEGKDACVAFFGSWLNG |
| Ga0207659_119207351 | 3300025926 | Miscanthus Rhizosphere | MTMTAREAFQRGTDTFNAHDIDGFADVLADDVVFE |
| Ga0207700_109570322 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MTMTAREAFERGTDTFNAHDIHGFAAVLADNVVFQAPGGMRGHG |
| Ga0207664_105966233 | 3300025929 | Agricultural Soil | MAVSTREAFERGTETFNAHDIEGFREVLADDVVFEAPGGMR |
| Ga0207664_113977471 | 3300025929 | Agricultural Soil | MAMTVREVFEKGTDTFNAHDIDGFTSVLADDVTYSAPGG |
| Ga0207686_117202852 | 3300025934 | Miscanthus Rhizosphere | MTMTAREAFEKGTDTFNAHDVDGFAAVLADDVAFVAPGGIRRTRISIL |
| Ga0207709_112951441 | 3300025935 | Miscanthus Rhizosphere | MADSVREAFDKGTDAFNAHDLGAFGETMADDVVQTAPGG |
| Ga0207669_106840651 | 3300025937 | Miscanthus Rhizosphere | MGDSVREAFDKGTEAFNAHDLGAFGETMADDVVQAAPGGM |
| Ga0207669_115654411 | 3300025937 | Miscanthus Rhizosphere | MTTREAFERGTDTFNAHDIGGFTEVLADDVVVVAPGPVRGEGRAACAAFF |
| Ga0207712_108168101 | 3300025961 | Switchgrass Rhizosphere | MTTREAFERGTETFNAHDINAFAGVLGDDVVFTAPGGMRGEGKAACVAFY |
| Ga0207703_105175692 | 3300026035 | Switchgrass Rhizosphere | MTTREAFERGTDTFNAHDINAFTDVLADDVVFTAPGGMR |
| Ga0207639_114515612 | 3300026041 | Corn Rhizosphere | VTTLTTREVFQAGTDAFNAHDIDAFAELLADDVVFDAPG |
| Ga0208043_10381313 | 3300027570 | Peatlands Soil | MAMTVREAFEKGTETFNAHDIDGFTSVLADDAVFRAPGGM |
| Ga0209382_122600391 | 3300027909 | Populus Rhizosphere | MTTREAFEKGTERFNAHDVQGFAEVLADDVVFSAPGGVRGQ |
| Ga0247828_110305242 | 3300028587 | Soil | MAMTTRDAFEKGTDTFNAHDLVGFAEVLADDVVFRAPGGMQGAGKAACV |
| Ga0247818_101985471 | 3300028589 | Soil | MTTREAFERGTDTFNAHDLAGFADVLADDVAFVAPGGVRGE |
| Ga0247821_105234102 | 3300028596 | Soil | MAITTREAFERGTDTFNAHDLDGFAAVLADDVVFTAPGAVYA |
| Ga0222749_105387632 | 3300029636 | Soil | MTMTVRQAFEKGTATFNAHDLEGFAEVLADDVIFKAPGGM |
| Ga0310038_103604422 | 3300030707 | Peatlands Soil | MAMTIREAFAKGTETFNAHDIDGFTSVLADDVVVRAPGGMSGQGK |
| Ga0318534_102686042 | 3300031544 | Soil | MTMTVREAFEKGTETFNAHDINGFADVLADDAVFRAPGGTGGE |
| Ga0318538_107675921 | 3300031546 | Soil | MTMTARKAFEKGTATFNAHDLHGFAEVLADNVVFKAPGGMQGEGKAAC |
| Ga0318561_106018391 | 3300031679 | Soil | MTMTVREAFEKGTETFNAHDINGFADVLADDAVFRAPGG |
| Ga0318561_106427121 | 3300031679 | Soil | MGTTVREAFETGTETFNAHDLDGFAAVLADDVNFTAPGGLHGEGK |
| Ga0318572_105450352 | 3300031681 | Soil | MAMTIREAFEKGTDTFNAHDIDGFTSVLADDVTYRAPGGIAGQGK |
| Ga0318572_108981361 | 3300031681 | Soil | MAMTVRQAFDKGTETFNAHDIDGFTSVLADDVSYTAPG |
| Ga0318560_106456052 | 3300031682 | Soil | MTMTAREAFEKGTATFNAHDLHGFAEVLADNVVFKAPGGMQGEGKA |
| Ga0310686_1132090231 | 3300031708 | Soil | MAMTIREAFEKGTETFNAHDIDGFTGVLADDVVFRAPGEMNGQGKAAC |
| Ga0310813_122901422 | 3300031716 | Soil | MTMTADEAFEAGTAAFNAHDFDAFADLLTDDVVFEL |
| Ga0306918_102683031 | 3300031744 | Soil | MTMTVREAFEKGTETFNAHDINGFADVLADDAVFRAPGGTGG |
| Ga0306918_113634292 | 3300031744 | Soil | MAMTARKAFERGTDTFNDHDIEGFRGVLADDVIFQAPGGMRGEGKAA |
| Ga0318494_103322402 | 3300031751 | Soil | MAMTVHEAFVKGTETFNAHDIDGFTSVLADDVVFCAPGGMR |
| Ga0318494_105763162 | 3300031751 | Soil | MAMTIREAFEKGTDTFNAHDIDGFTSVLADDVTYRAPGGISGQGKT |
| Ga0318509_100923702 | 3300031768 | Soil | MTMTTREAFEKGTDTFNAHDIEGFASVLAHDVVYQAPGGVSGRGRTA |
| Ga0318521_109671172 | 3300031770 | Soil | MAMTVREAFDKGTETFNAHDIDGFTSVLADDVSYTAPG |
| Ga0318498_103662451 | 3300031778 | Soil | MTMTTREAFEKGTDTFNAHDIEGFASVLADDVVYQAPGGVSGRG |
| Ga0318498_103790941 | 3300031778 | Soil | MAMTTREAFEKGTATFNAHDIGGFAEVLADDVGFEAPGGMRGHGKTACVEFYS |
| Ga0318566_103307432 | 3300031779 | Soil | MAMTIREVFEKGTDTFNAHDIDGFASVLADDVTYRAPGGISGQ |
| Ga0318565_102177103 | 3300031799 | Soil | MAMTARKAFERGTDTFNDHDIEGFRGVLADDVIFQAPGGMRG |
| Ga0318497_106977701 | 3300031805 | Soil | MTMTVREAFDKETEAFNAHDIGGFSAMLADDAMFRAPGGMSGAGKQA |
| Ga0307473_102442332 | 3300031820 | Hardwood Forest Soil | MTMTVHEAFVKGTETFNAHDIDGFTSVLADDVVFQAPGGISGEGQTACAGFF |
| Ga0310904_105872381 | 3300031854 | Soil | MTMTTREAFERGTDTFNAHDINAFTDVLADDVVFTAPGGMRGE |
| Ga0306919_114234771 | 3300031879 | Soil | MAMTVREAFDKGTETFNAHDIDGFTSVLADDVSYTAPGGMTGQGKTAC |
| Ga0306925_112115781 | 3300031890 | Soil | MAMSAREAFERGTNTFNAHDMKGFAEVLADDVAFAAP |
| Ga0318536_102590262 | 3300031893 | Soil | MALTVREAFEKGTDTFNAHDIEGFTSVLADDAVFHAPGGMT |
| Ga0318522_100786512 | 3300031894 | Soil | MTMTPRDAFERGTDAFNAHDMDGFAEVVADDVVGT |
| Ga0306923_107458382 | 3300031910 | Soil | MAMTIREAFEKGTDTFNAHDIDGFTSVLADDVTYRAPGG |
| Ga0306921_117752911 | 3300031912 | Soil | MAMSAREAFERGTNTFNARDMKGFAEVLADDVVFVAPGGIRGEGKTSCAEFFG |
| Ga0306921_124759991 | 3300031912 | Soil | MAMTAREAFEKGTKTFNAHDIDGFAGVLADDVVFEAPGGVRGKG |
| Ga0310912_104490541 | 3300031941 | Soil | MTMTVREAFERGTATFNAHDLDGFAEVLADDVVFKAPGGAHGRG |
| Ga0310912_112289531 | 3300031941 | Soil | MTAREAFEKGTATFNAHDLGGFAEVLADDVVFNAPGGAH |
| Ga0310916_112190282 | 3300031942 | Soil | MTMTVHEAFERGTDTFNTHDLDGFAEVLAADVVFEAAKRSEYADC |
| Ga0310910_101526111 | 3300031946 | Soil | MTMTAREAFEKGTATFNAHDLHGFAEVLADNVVFKAPGGMQGEG |
| Ga0310909_106153632 | 3300031947 | Soil | MTMTAREAFERGTVTFNSHDIDGFAEVLANDLVFEAPGGLRGQGKASCIEFYGSWFGAF |
| Ga0306926_110392482 | 3300031954 | Soil | MTMTAREAFERGTKTFNAHDIEGFAEVLADDVVFEAP |
| Ga0306922_101010521 | 3300032001 | Soil | MAMTVHQAFVTGTETFNAHDIDGFTSVLADDVVFQAPGGMAGQGKAA |
| Ga0306922_109640892 | 3300032001 | Soil | MAMTVREAFDKGTETFNAHDIDGFTSVLADDVSYTAPGGMTGRGKT |
| Ga0306922_113933741 | 3300032001 | Soil | MTMTAREAFEKGTATFNAHDLDGFAEVLADDVFFKAPGGAH |
| Ga0318562_104322521 | 3300032008 | Soil | MGMSAREAFERGTNAFNAHDMKGFAEVLADDVAFAAPGGIRGQGKTSCTEF |
| Ga0318563_102695491 | 3300032009 | Soil | MTMTVREAFEKGTETFNAHDINGFADVLADDAVFRA |
| Ga0318563_105685021 | 3300032009 | Soil | MTMTAREAFERGTATFNAHDIDGFAKVLADDVVFRAPGSIRGSGKA |
| Ga0318569_103762042 | 3300032010 | Soil | MGMSAREAFERGTNAFNAHDMKGFAEVLADDVAFGAPGGIRGQGKTS |
| Ga0318507_103049081 | 3300032025 | Soil | MAMTVREAFDKGTETFNAHDIDGFTSVLADDVSYTA |
| Ga0318575_102329962 | 3300032055 | Soil | MAITVREAFDKGTETFNAHDIDGFTSVLADDVSYTAPGGMTGR |
| Ga0318553_101131292 | 3300032068 | Soil | MAMTVHQAFVTGTETFNAHDIDGFTSVLADDVVFQAPGGMAGQGK |
| Ga0318553_106021001 | 3300032068 | Soil | MAMTAREAFEKGTETFNAHDIDGFTGVLADDVVYRAPGGVSGQGKAACAA |
| Ga0306924_104242343 | 3300032076 | Soil | MAMTAREAFEKGTKTFNAHDIDGFAGVLANDVVFEA |
| Ga0306924_108211542 | 3300032076 | Soil | MGMSAREAFERGTNAFNAHDMKGFAEVLADDVAFGAPGGIR |
| Ga0318525_105423152 | 3300032089 | Soil | MAMTAREAFEKGTETFNAHDIDGFTGVLADDVVYRAPGGVTGQG |
| Ga0318518_105685201 | 3300032090 | Soil | MAMTTREDFEKGTATFNAHDIGGFAEVLADDVGFEAPGGMRGHGKTACV |
| Ga0307470_100129113 | 3300032174 | Hardwood Forest Soil | MAMTVREAFEKGTETFNAHDIDGFTGVLADDVVYRAPGGISGQGKE |
| Ga0307471_1009849652 | 3300032180 | Hardwood Forest Soil | MAMTVREAFEKGTDTFNAHDIDGFTSVLDDDVVYQAPGG |
| Ga0306920_1027239071 | 3300032261 | Soil | MTMTVHEAFERGMDTFNTHVLDGFAEVLVADVVFE |
| Ga0306920_1041774511 | 3300032261 | Soil | MAMTVREAFQKGTDTFNAHDIDGFTSVLAEDAVYQ |
| Ga0335080_108385421 | 3300032828 | Soil | MAMTVREAFGKGTETFNAHDIDGFTGVLADDVVFH |
| Ga0335081_119958421 | 3300032892 | Soil | MAMTVREAFERGTQTFNAHDIDRFTSVLADDVTYHAPGGMSG |
| Ga0335077_102962333 | 3300033158 | Soil | MTMTIQEAFERGTDTFNAHDMDGFAEVVADDVVVVAPGVRCD |
| Ga0318519_103208152 | 3300033290 | Soil | MAMTVREAFDKGTETFNAHDIDGFTSVLADDVSYTAPGGMTGQGK |
| Ga0247829_115623441 | 3300033550 | Soil | MTMTTREAFERGTDTFNAHDTDGFAGVLADDAVFTAPGGLRGAG |
| Ga0373958_0203859_3_107 | 3300034819 | Rhizosphere Soil | MTMTAREAFERGTATFNAHDLDGFTEVLADDVVFT |
| ⦗Top⦘ |