| Basic Information | |
|---|---|
| Family ID | F031938 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 181 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MEKRLVTRYAMRSADAADENQRRVEGVFDELAAAKPDNVSY |
| Number of Associated Samples | 164 |
| Number of Associated Scaffolds | 181 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 92.18 % |
| % of genes near scaffold ends (potentially truncated) | 96.69 % |
| % of genes from short scaffolds (< 2000 bps) | 94.48 % |
| Associated GOLD sequencing projects | 160 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.52 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (80.663 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (15.470 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.072 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.961 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 30.43% β-sheet: 0.00% Coil/Unstructured: 69.57% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 181 Family Scaffolds |
|---|---|---|
| PF07883 | Cupin_2 | 5.52 |
| PF00903 | Glyoxalase | 5.52 |
| PF01022 | HTH_5 | 3.31 |
| PF04828 | GFA | 2.76 |
| PF04075 | F420H2_quin_red | 2.21 |
| PF16859 | TetR_C_11 | 2.21 |
| PF12840 | HTH_20 | 2.21 |
| PF00795 | CN_hydrolase | 1.66 |
| PF08327 | AHSA1 | 1.66 |
| PF12120 | Arr-ms | 1.66 |
| PF05899 | Cupin_3 | 1.10 |
| PF07676 | PD40 | 1.10 |
| PF00583 | Acetyltransf_1 | 1.10 |
| PF03795 | YCII | 1.10 |
| PF00144 | Beta-lactamase | 0.55 |
| PF11999 | Ice_binding | 0.55 |
| PF09413 | DUF2007 | 0.55 |
| PF00342 | PGI | 0.55 |
| PF13460 | NAD_binding_10 | 0.55 |
| PF13673 | Acetyltransf_10 | 0.55 |
| PF13304 | AAA_21 | 0.55 |
| PF13427 | DUF4111 | 0.55 |
| PF01757 | Acyl_transf_3 | 0.55 |
| PF12681 | Glyoxalase_2 | 0.55 |
| PF01386 | Ribosomal_L25p | 0.55 |
| PF00437 | T2SSE | 0.55 |
| PF01872 | RibD_C | 0.55 |
| PF00781 | DAGK_cat | 0.55 |
| PF07690 | MFS_1 | 0.55 |
| PF13577 | SnoaL_4 | 0.55 |
| PF13193 | AMP-binding_C | 0.55 |
| PF09948 | DUF2182 | 0.55 |
| PF07040 | DUF1326 | 0.55 |
| PF03466 | LysR_substrate | 0.55 |
| PF02653 | BPD_transp_2 | 0.55 |
| PF13483 | Lactamase_B_3 | 0.55 |
| PF00106 | adh_short | 0.55 |
| PF01152 | Bac_globin | 0.55 |
| PF00501 | AMP-binding | 0.55 |
| PF01195 | Pept_tRNA_hydro | 0.55 |
| PF06224 | HTH_42 | 0.55 |
| PF02567 | PhzC-PhzF | 0.55 |
| PF01168 | Ala_racemase_N | 0.55 |
| PF00775 | Dioxygenase_C | 0.55 |
| PF02744 | GalP_UDP_tr_C | 0.55 |
| PF00400 | WD40 | 0.55 |
| PF00005 | ABC_tran | 0.55 |
| PF13602 | ADH_zinc_N_2 | 0.55 |
| PF02156 | Glyco_hydro_26 | 0.55 |
| PF02655 | ATP-grasp_3 | 0.55 |
| PF00027 | cNMP_binding | 0.55 |
| PF13302 | Acetyltransf_3 | 0.55 |
| PF01609 | DDE_Tnp_1 | 0.55 |
| PF00230 | MIP | 0.55 |
| PF14333 | DUF4389 | 0.55 |
| PF00211 | Guanylate_cyc | 0.55 |
| PF03992 | ABM | 0.55 |
| COG ID | Name | Functional Category | % Frequency in 181 Family Scaffolds |
|---|---|---|---|
| COG3791 | Uncharacterized conserved protein | Function unknown [S] | 2.76 |
| COG1597 | Phosphatidylglycerol kinase, diacylglycerol kinase family | Lipid transport and metabolism [I] | 1.10 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.10 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.55 |
| COG0166 | Glucose-6-phosphate isomerase | Carbohydrate transport and metabolism [G] | 0.55 |
| COG5588 | Uncharacterized conserved protein, DUF1326 domain | Function unknown [S] | 0.55 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.55 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.55 |
| COG4124 | Beta-mannanase | Carbohydrate transport and metabolism [G] | 0.55 |
| COG3485 | Protocatechuate 3,4-dioxygenase beta subunit | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.55 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.55 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.55 |
| COG3214 | DNA glycosylase YcaQ, repair of DNA interstrand crosslinks | Replication, recombination and repair [L] | 0.55 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.55 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.55 |
| COG2346 | Truncated hemoglobin YjbI | Inorganic ion transport and metabolism [P] | 0.55 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.55 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.55 |
| COG1825 | Ribosomal protein L25 (general stress protein Ctc) | Translation, ribosomal structure and biogenesis [J] | 0.55 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.55 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.55 |
| COG0580 | Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family) | Carbohydrate transport and metabolism [G] | 0.55 |
| COG0384 | Predicted epimerase YddE/YHI9, PhzF superfamily | General function prediction only [R] | 0.55 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.55 |
| COG0193 | Peptidyl-tRNA hydrolase | Translation, ribosomal structure and biogenesis [J] | 0.55 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 80.66 % |
| Unclassified | root | N/A | 17.68 % |
| Polyangium | genus | Polyangium | 1.66 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908009|FWIRA_GRAM18401CL5AV | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 2170459007|GJ61VE201C102S | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300000880|AL20A1W_1257883 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 533 | Open in IMG/M |
| 3300001454|JGI20204J15135_1015733 | Not Available | 702 | Open in IMG/M |
| 3300001537|A2065W1_10656912 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 887 | Open in IMG/M |
| 3300001538|A10PFW1_10601171 | Not Available | 518 | Open in IMG/M |
| 3300001991|JGI24743J22301_10100787 | Polyangium → Polyangium aurulentum | 622 | Open in IMG/M |
| 3300004463|Ga0063356_104616947 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 592 | Open in IMG/M |
| 3300004480|Ga0062592_101968999 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 576 | Open in IMG/M |
| 3300005093|Ga0062594_101520463 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300005334|Ga0068869_100539512 | All Organisms → cellular organisms → Bacteria | 978 | Open in IMG/M |
| 3300005341|Ga0070691_11022174 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis orientalis | 517 | Open in IMG/M |
| 3300005364|Ga0070673_102268836 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 516 | Open in IMG/M |
| 3300005468|Ga0070707_102082006 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 535 | Open in IMG/M |
| 3300005518|Ga0070699_101070358 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 740 | Open in IMG/M |
| 3300005526|Ga0073909_10666878 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300005536|Ga0070697_100493011 | All Organisms → cellular organisms → Bacteria | 1071 | Open in IMG/M |
| 3300005544|Ga0070686_101724691 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 532 | Open in IMG/M |
| 3300005545|Ga0070695_100441353 | All Organisms → cellular organisms → Bacteria | 995 | Open in IMG/M |
| 3300005558|Ga0066698_10419528 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 917 | Open in IMG/M |
| 3300005558|Ga0066698_10654174 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300005559|Ga0066700_10419076 | All Organisms → cellular organisms → Bacteria | 943 | Open in IMG/M |
| 3300005586|Ga0066691_10569209 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 675 | Open in IMG/M |
| 3300005718|Ga0068866_10595314 | Not Available | 746 | Open in IMG/M |
| 3300006028|Ga0070717_10410039 | All Organisms → cellular organisms → Bacteria | 1218 | Open in IMG/M |
| 3300006055|Ga0097691_1162572 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300006059|Ga0075017_101305230 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 570 | Open in IMG/M |
| 3300006102|Ga0075015_100189904 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1089 | Open in IMG/M |
| 3300006102|Ga0075015_100672211 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 612 | Open in IMG/M |
| 3300006102|Ga0075015_100724331 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 592 | Open in IMG/M |
| 3300006176|Ga0070765_101407706 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 657 | Open in IMG/M |
| 3300006573|Ga0074055_11288229 | Not Available | 506 | Open in IMG/M |
| 3300006575|Ga0074053_10704768 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella | 655 | Open in IMG/M |
| 3300006575|Ga0074053_11311914 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1045 | Open in IMG/M |
| 3300006576|Ga0074047_11986315 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 909 | Open in IMG/M |
| 3300006581|Ga0074048_10055463 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1361 | Open in IMG/M |
| 3300006581|Ga0074048_11514861 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium | 633 | Open in IMG/M |
| 3300006642|Ga0075521_10597484 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300006796|Ga0066665_11167887 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 587 | Open in IMG/M |
| 3300006796|Ga0066665_11487276 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 528 | Open in IMG/M |
| 3300006800|Ga0066660_10348084 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1203 | Open in IMG/M |
| 3300006844|Ga0075428_100292501 | All Organisms → cellular organisms → Bacteria | 1752 | Open in IMG/M |
| 3300006871|Ga0075434_102148982 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 562 | Open in IMG/M |
| 3300006953|Ga0074063_13802639 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 554 | Open in IMG/M |
| 3300006954|Ga0079219_10695443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 771 | Open in IMG/M |
| 3300009011|Ga0105251_10647634 | Polyangium → Polyangium aurulentum | 505 | Open in IMG/M |
| 3300009093|Ga0105240_10051453 | All Organisms → cellular organisms → Bacteria | 5182 | Open in IMG/M |
| 3300009101|Ga0105247_11063920 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 636 | Open in IMG/M |
| 3300009101|Ga0105247_11853877 | Not Available | 503 | Open in IMG/M |
| 3300009162|Ga0075423_12380441 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 577 | Open in IMG/M |
| 3300009176|Ga0105242_11207526 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 776 | Open in IMG/M |
| 3300009553|Ga0105249_12271849 | Not Available | 615 | Open in IMG/M |
| 3300009610|Ga0105340_1232404 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300009627|Ga0116109_1181509 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 503 | Open in IMG/M |
| 3300009759|Ga0116101_1104988 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 660 | Open in IMG/M |
| 3300009811|Ga0105084_1041480 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300009815|Ga0105070_1120973 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 527 | Open in IMG/M |
| 3300010322|Ga0134084_10136796 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 813 | Open in IMG/M |
| 3300010325|Ga0134064_10326081 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 592 | Open in IMG/M |
| 3300010397|Ga0134124_10325663 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1440 | Open in IMG/M |
| 3300010401|Ga0134121_12642419 | Not Available | 546 | Open in IMG/M |
| 3300011106|Ga0151489_1714333 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 553 | Open in IMG/M |
| 3300011270|Ga0137391_10744052 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 812 | Open in IMG/M |
| 3300011271|Ga0137393_11291992 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 618 | Open in IMG/M |
| 3300012010|Ga0120118_1109048 | Not Available | 670 | Open in IMG/M |
| 3300012010|Ga0120118_1119001 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 637 | Open in IMG/M |
| 3300012011|Ga0120152_1037793 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1647 | Open in IMG/M |
| 3300012011|Ga0120152_1038914 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1613 | Open in IMG/M |
| 3300012014|Ga0120159_1018975 | All Organisms → cellular organisms → Bacteria | 2587 | Open in IMG/M |
| 3300012201|Ga0137365_10370174 | All Organisms → cellular organisms → Bacteria | 1058 | Open in IMG/M |
| 3300012208|Ga0137376_10232029 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1599 | Open in IMG/M |
| 3300012208|Ga0137376_11261387 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 629 | Open in IMG/M |
| 3300012211|Ga0137377_11833086 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 525 | Open in IMG/M |
| 3300012349|Ga0137387_10933487 | Not Available | 626 | Open in IMG/M |
| 3300012892|Ga0157294_10183948 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci → Deinococcales → Deinococcaceae → Deinococcus → Deinococcus alpinitundrae | 604 | Open in IMG/M |
| 3300012917|Ga0137395_10014750 | All Organisms → cellular organisms → Bacteria | 4388 | Open in IMG/M |
| 3300012930|Ga0137407_11638955 | Not Available | 613 | Open in IMG/M |
| 3300012955|Ga0164298_11262295 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 563 | Open in IMG/M |
| 3300012985|Ga0164308_11279070 | Not Available | 665 | Open in IMG/M |
| 3300012987|Ga0164307_10530153 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 895 | Open in IMG/M |
| 3300013307|Ga0157372_12435746 | Not Available | 601 | Open in IMG/M |
| 3300013768|Ga0120155_1174978 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 576 | Open in IMG/M |
| 3300013770|Ga0120123_1052505 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 877 | Open in IMG/M |
| 3300014829|Ga0120104_1016339 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 1316 | Open in IMG/M |
| 3300014968|Ga0157379_12333536 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 533 | Open in IMG/M |
| 3300015358|Ga0134089_10346901 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300015359|Ga0134085_10122052 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1093 | Open in IMG/M |
| 3300015359|Ga0134085_10128368 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1066 | Open in IMG/M |
| 3300015359|Ga0134085_10267697 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 746 | Open in IMG/M |
| 3300015373|Ga0132257_103546871 | Not Available | 568 | Open in IMG/M |
| 3300015374|Ga0132255_101563666 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 999 | Open in IMG/M |
| 3300017943|Ga0187819_10715253 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 564 | Open in IMG/M |
| 3300017965|Ga0190266_11250614 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 518 | Open in IMG/M |
| 3300018030|Ga0187869_10577495 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300018047|Ga0187859_10592125 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300018061|Ga0184619_10418446 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 603 | Open in IMG/M |
| 3300018071|Ga0184618_10371188 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 608 | Open in IMG/M |
| 3300018071|Ga0184618_10419981 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 565 | Open in IMG/M |
| 3300018079|Ga0184627_10302260 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 839 | Open in IMG/M |
| 3300018081|Ga0184625_10336520 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 786 | Open in IMG/M |
| 3300019361|Ga0173482_10333526 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Propionibacteriaceae → unclassified Propionibacteriaceae → Propionibacteriaceae bacterium | 681 | Open in IMG/M |
| 3300019786|Ga0182025_1039785 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1508 | Open in IMG/M |
| 3300020016|Ga0193696_1017699 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1920 | Open in IMG/M |
| 3300021080|Ga0210382_10458470 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 565 | Open in IMG/M |
| 3300021082|Ga0210380_10515357 | Not Available | 548 | Open in IMG/M |
| 3300021344|Ga0193719_10239635 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 769 | Open in IMG/M |
| 3300022694|Ga0222623_10273050 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Cyanophyceae | 651 | Open in IMG/M |
| 3300023058|Ga0193714_1044662 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 642 | Open in IMG/M |
| 3300023259|Ga0224551_1013709 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1361 | Open in IMG/M |
| 3300024224|Ga0247673_1074682 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 503 | Open in IMG/M |
| 3300024295|Ga0224556_1003802 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4243 | Open in IMG/M |
| 3300025326|Ga0209342_11191522 | Not Available | 563 | Open in IMG/M |
| 3300025579|Ga0207927_1076151 | Not Available | 803 | Open in IMG/M |
| 3300025634|Ga0208589_1097764 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300025878|Ga0209584_10443831 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 501 | Open in IMG/M |
| 3300025893|Ga0207682_10535929 | Not Available | 554 | Open in IMG/M |
| 3300025899|Ga0207642_10397184 | Not Available | 824 | Open in IMG/M |
| 3300025924|Ga0207694_11229969 | Polyangium → Polyangium aurulentum | 634 | Open in IMG/M |
| 3300025934|Ga0207686_10580247 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 880 | Open in IMG/M |
| 3300025934|Ga0207686_11438682 | Not Available | 568 | Open in IMG/M |
| 3300025935|Ga0207709_11351921 | Not Available | 589 | Open in IMG/M |
| 3300026088|Ga0207641_10511622 | Not Available | 1167 | Open in IMG/M |
| 3300026088|Ga0207641_12229777 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
| 3300026089|Ga0207648_12162461 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 517 | Open in IMG/M |
| 3300026142|Ga0207698_11808159 | Not Available | 626 | Open in IMG/M |
| 3300026300|Ga0209027_1197834 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 650 | Open in IMG/M |
| 3300026328|Ga0209802_1330891 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 504 | Open in IMG/M |
| 3300026799|Ga0207485_100124 | All Organisms → cellular organisms → Bacteria | 1234 | Open in IMG/M |
| 3300027648|Ga0209420_1093678 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 858 | Open in IMG/M |
| 3300027738|Ga0208989_10014476 | All Organisms → cellular organisms → Bacteria | 2702 | Open in IMG/M |
| 3300027882|Ga0209590_10469629 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 813 | Open in IMG/M |
| 3300027903|Ga0209488_10046127 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3205 | Open in IMG/M |
| 3300027910|Ga0209583_10771269 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 509 | Open in IMG/M |
| 3300028572|Ga0302152_10278207 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium | 548 | Open in IMG/M |
| 3300028709|Ga0307279_10084150 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 571 | Open in IMG/M |
| 3300028716|Ga0307311_10086876 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 863 | Open in IMG/M |
| 3300028719|Ga0307301_10269020 | Not Available | 558 | Open in IMG/M |
| 3300028722|Ga0307319_10170206 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 709 | Open in IMG/M |
| 3300028780|Ga0302225_10133532 | All Organisms → cellular organisms → Bacteria | 1206 | Open in IMG/M |
| 3300028791|Ga0307290_10101475 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1049 | Open in IMG/M |
| 3300028793|Ga0307299_10110499 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1029 | Open in IMG/M |
| 3300028802|Ga0307503_10411702 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300028802|Ga0307503_10580259 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 616 | Open in IMG/M |
| 3300028803|Ga0307281_10237554 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 666 | Open in IMG/M |
| 3300028807|Ga0307305_10347953 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300028819|Ga0307296_10121162 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1406 | Open in IMG/M |
| 3300028828|Ga0307312_10160167 | All Organisms → cellular organisms → Bacteria | 1432 | Open in IMG/M |
| 3300028860|Ga0302199_1233516 | Not Available | 556 | Open in IMG/M |
| 3300028875|Ga0307289_10263507 | Not Available | 709 | Open in IMG/M |
| 3300028878|Ga0307278_10064951 | All Organisms → cellular organisms → Bacteria | 1647 | Open in IMG/M |
| 3300028906|Ga0308309_11483677 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300029952|Ga0311346_10035582 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 7516 | Open in IMG/M |
| 3300029984|Ga0311332_11006722 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 669 | Open in IMG/M |
| 3300029994|Ga0302283_1350017 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 500 | Open in IMG/M |
| 3300031058|Ga0308189_10272161 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 649 | Open in IMG/M |
| 3300031092|Ga0308204_10082376 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 853 | Open in IMG/M |
| 3300031093|Ga0308197_10215682 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300031238|Ga0265332_10343638 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 616 | Open in IMG/M |
| 3300031251|Ga0265327_10214207 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 868 | Open in IMG/M |
| 3300031455|Ga0307505_10682244 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 503 | Open in IMG/M |
| 3300031474|Ga0170818_103325473 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300031671|Ga0307372_10286900 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 941 | Open in IMG/M |
| 3300031671|Ga0307372_10333293 | Not Available | 825 | Open in IMG/M |
| 3300031708|Ga0310686_102589236 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 721 | Open in IMG/M |
| 3300031712|Ga0265342_10517581 | Not Available | 607 | Open in IMG/M |
| 3300031747|Ga0318502_10309496 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 930 | Open in IMG/M |
| 3300031765|Ga0318554_10197966 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1143 | Open in IMG/M |
| 3300031769|Ga0318526_10118763 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1065 | Open in IMG/M |
| 3300031862|Ga0315280_10304695 | Not Available | 795 | Open in IMG/M |
| 3300031879|Ga0306919_10527050 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 911 | Open in IMG/M |
| 3300031946|Ga0310910_10934791 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 679 | Open in IMG/M |
| 3300031962|Ga0307479_11735187 | Not Available | 577 | Open in IMG/M |
| 3300032000|Ga0310903_10781266 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300032043|Ga0318556_10039382 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2243 | Open in IMG/M |
| 3300032067|Ga0318524_10149691 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1179 | Open in IMG/M |
| 3300032163|Ga0315281_11205008 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
| 3300032177|Ga0315276_12231501 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 553 | Open in IMG/M |
| 3300032893|Ga0335069_10776150 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1082 | Open in IMG/M |
| 3300034129|Ga0370493_0301609 | Not Available | 550 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 15.47% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.08% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 6.08% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.42% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 3.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.87% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.31% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.31% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.76% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.76% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.21% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.21% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.21% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.66% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.66% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.66% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.66% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.66% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.10% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.10% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.10% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.10% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.10% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.10% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.10% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 1.10% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.10% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.10% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.10% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.10% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.10% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.55% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.55% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.55% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.55% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.55% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.55% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.55% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.55% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.55% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.55% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.55% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.55% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.55% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.55% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.55% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.55% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.55% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.55% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.55% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.55% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.55% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.55% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.55% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908009 | Soil microbial communities from sample at FACE Site Metagenome WIR_Amb2 | Environmental | Open in IMG/M |
| 2170459007 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect in plug lysis (for fosmid construction) 10-21cm | Environmental | Open in IMG/M |
| 3300000880 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A35-65cm-20A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300001454 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 shallow-092012 | Environmental | Open in IMG/M |
| 3300001537 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A20-65 cm-11A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300001538 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-PF 4A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Host-Associated | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006055 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006573 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006575 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006576 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006581 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006642 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009610 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 | Environmental | Open in IMG/M |
| 3300009627 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_10 | Environmental | Open in IMG/M |
| 3300009759 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10 | Environmental | Open in IMG/M |
| 3300009811 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 | Environmental | Open in IMG/M |
| 3300009815 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011106 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMC (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012010 | Permafrost microbial communities from Nunavut, Canada - A7_35cm_12M | Environmental | Open in IMG/M |
| 3300012011 | Permafrost microbial communities from Nunavut, Canada - A30_65cm_6M | Environmental | Open in IMG/M |
| 3300012014 | Permafrost microbial communities from Nunavut, Canada - A10_80cm_6M | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012892 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013768 | Permafrost microbial communities from Nunavut, Canada - A35_65cm_0M | Environmental | Open in IMG/M |
| 3300013770 | Permafrost microbial communities from Nunavut, Canada - A15_5cm_18M | Environmental | Open in IMG/M |
| 3300014829 | Permafrost microbial communities from Nunavut, Canada - A10_35cm_6M | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020016 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1 | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300023058 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m1 | Environmental | Open in IMG/M |
| 3300023259 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 20-24 | Environmental | Open in IMG/M |
| 3300024224 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK14 | Environmental | Open in IMG/M |
| 3300024295 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 1-5 | Environmental | Open in IMG/M |
| 3300025326 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025427 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025579 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025634 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-2 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025878 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes) | Environmental | Open in IMG/M |
| 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026799 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G06.2A2a-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300027045 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 40 (SPAdes) | Environmental | Open in IMG/M |
| 3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300028572 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_1 | Environmental | Open in IMG/M |
| 3300028709 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_118 | Environmental | Open in IMG/M |
| 3300028716 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198 | Environmental | Open in IMG/M |
| 3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
| 3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
| 3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
| 3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300028803 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028860 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_3 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029952 | II_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300029984 | I_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029994 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_4 | Environmental | Open in IMG/M |
| 3300031058 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031092 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031093 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Host-Associated | Open in IMG/M |
| 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Host-Associated | Open in IMG/M |
| 3300031455 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_S | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031671 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-1 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Host-Associated | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031862 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_40 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
| 3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300034129 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_16 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FWIRA_07079500 | 2124908009 | Soil | MEKRLVTRYAMRSSGDADENQRRVEDVFAELAETRPDNVSYIV |
| L02_02769970 | 2170459007 | Grass Soil | MEKRLVTRYAMQSADDADENQRRIEGVFAELAANKPDNVSYIVL |
| AL20A1W_12578831 | 3300000880 | Permafrost | MQKRLVTRYAMPSAEAADENQRRVEGVFAELEATTPDSVSY |
| JGI20204J15135_10157332 | 3300001454 | Arctic Peat Soil | VEERLVARYATQSHAATDENQKRIEGVFEELDLTKPDNVSD |
| A2065W1_106569122 | 3300001537 | Permafrost | MQKRLVTRYAMQSAEAANENQRRVEGVFDELAATKPDNV |
| A10PFW1_106011712 | 3300001538 | Permafrost | VQKRLVTRYAMRSAEAADENQKRVEGVFAEPATAKPDNVSYIV |
| JGI24743J22301_101007872 | 3300001991 | Corn, Switchgrass And Miscanthus Rhizosphere | MEKRLVTRYAMQSAEAADENQRRVEGVFDELATTNPDNVSY |
| Ga0063356_1046169471 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MQKRLVTRYATRSAEAADENQRRVEGVFDELAATKPDTVSYIVLRLADD |
| Ga0062592_1019689992 | 3300004480 | Soil | VEKRLVTRYAMRSAEEADENQRRIEGVFRELATAQPDNVSYLVLRLA |
| Ga0062594_1015204633 | 3300005093 | Soil | MEKRLVTRYAMRSVEAADENQRRVEGVFDELAATKPETVSYIVLRLADDSFV |
| Ga0068869_1005395123 | 3300005334 | Miscanthus Rhizosphere | MEKRLVTRYAMRSVEAADENQRRVEGVFDELAATKPETVSYIVLR |
| Ga0070691_110221741 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | MHKRLVTRYAMKSPEAADENQQRIERVFEELAAAKPDTVSYIV |
| Ga0070673_1022688361 | 3300005364 | Switchgrass Rhizosphere | VEKRLVTRYAMWSAEAADENQRRVEGVFDELAATKPDNVSYIVLRL |
| Ga0070707_1020820061 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MQKRLVTRYAMRSAEVADENQRRVEGVFAELSAARPDTVSYIVLRL |
| Ga0070699_1010703581 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | VEKRLVTRYAMRSAEAADENQRRVEGVFDELAVSEPDNVS |
| Ga0073909_106668782 | 3300005526 | Surface Soil | MEKRLVTRYATKSAEAADENQRRVEAVFDELAAAK |
| Ga0070697_1004930113 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | VQKRLVTRYAMPTAEAANENQRRIEGVFAELAAAKPNNVSYIVLRLADDSF |
| Ga0070686_1017246912 | 3300005544 | Switchgrass Rhizosphere | VEKRLVTRYAMWSAEAADENQRRVEGVFDELAATKPDNVS |
| Ga0070695_1004413531 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MQKRLVTRYAMRSVEAADENQRRVEGVFAELAATKPDNVSYIVLRL |
| Ga0066698_104195282 | 3300005558 | Soil | MQKRLVTRYAMRSAEAANENQQRVEGVFAELAASKPDSVS |
| Ga0066698_106541742 | 3300005558 | Soil | LQKRLVTRYAMRSAEAANENQQRVEGVFAELAASKPDSVS |
| Ga0066700_104190761 | 3300005559 | Soil | VEKRLVTRYAMRSAEEADENQRRVEGVFDELAAGKPDNVSYIVLRLADDSF |
| Ga0066691_105692091 | 3300005586 | Soil | MHKRLVTSYATQNSIAADENQRRIEAVFTELAANQP |
| Ga0068866_105953141 | 3300005718 | Miscanthus Rhizosphere | VEKRLVTRYAMRSAEDADENQRRVEGVFQELAAAQP |
| Ga0070717_104100393 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MQKRLVTRYATRSPEAAAENQRRVESVFAELAETKPANVSYLVL |
| Ga0097691_11625722 | 3300006055 | Arctic Peat Soil | MEKRLVTRYAMRSAEAADENERRVEGVFAELAANKPDNVSYIV |
| Ga0075017_1013052301 | 3300006059 | Watersheds | MEKRLVTQYAMKSSDAADENQRRVEAVFAELAATAPPN |
| Ga0075015_1001899041 | 3300006102 | Watersheds | VEKRLVTRYAMKSAEAADENQRRVEGVFAELARAKPDSVSYIV |
| Ga0075015_1006722111 | 3300006102 | Watersheds | MNKRLVTRYWTQSADAAEENQRRVEAVFAELAETRPDTVSYLVL |
| Ga0075015_1007243313 | 3300006102 | Watersheds | MQKRLVTRYAMQSADAADENQKRVEGVFAELAANKPDNVSYIVL |
| Ga0070765_1014077061 | 3300006176 | Soil | MEKRLVTRYATRSPDAADENQKRIEGVFTELADAKPDNV |
| Ga0074055_112882292 | 3300006573 | Soil | MEKRLVTRYAMRSAAAADENQRRVEGVFAELAAAK |
| Ga0074053_107047681 | 3300006575 | Soil | MHKRLVTRYATSSRAAADENQRRVEAVFDELAATKPDI |
| Ga0074053_113119142 | 3300006575 | Soil | MEKRLVTRYAMRSAAAADENQRRVEGVFAELAAAKP |
| Ga0074047_119863152 | 3300006576 | Soil | MEKRLVTRYAMRSAAAADENQRRVEGVFAELAAAKPDSVSYIVLRLADDS |
| Ga0074048_100554631 | 3300006581 | Soil | MEKRLVTRYAMRSTEAADENQRRVEGVFAELNATKPD |
| Ga0074048_115148612 | 3300006581 | Soil | MEKRLVTRYAMQSAEAADENQRRVEGVFEELSTTKPDNVSYIVLRLADDSF |
| Ga0075521_105974841 | 3300006642 | Arctic Peat Soil | MQKRLVRRYATQLAEAANENQRRVEGVFDELSATRPDMVSYIVLRLEDDHLCTC |
| Ga0066665_111678872 | 3300006796 | Soil | MEKRLVTRYAMRSAEAANENQRRVEGVFDELAAATPGNVSYSV |
| Ga0066665_114872761 | 3300006796 | Soil | MEKRLVTRYATRSAEAADENQQRVEAVFDELAAAAPDNVSYIVLRLA |
| Ga0066660_103480843 | 3300006800 | Soil | MQKRLVTRYAMQSAEAADENQRRVEGVFAELAEAGPENVSYIVLRLADD |
| Ga0075428_1002925011 | 3300006844 | Populus Rhizosphere | VEKRLVTRYAMRSAEAADENQRRVEGVFEELADTRPDNVSYLVL |
| Ga0075434_1021489821 | 3300006871 | Populus Rhizosphere | MEKRLVTRYASRSPEAADENQRRVEAVFDELAAAK |
| Ga0074063_138026392 | 3300006953 | Soil | MEKRLVTRYASRSPEAADENQRRIEAVFDELAASKPDNVSYIVL |
| Ga0079219_106954432 | 3300006954 | Agricultural Soil | VQFRLVTRYASRSAEAADDNQRRVEAVFAELDRARPGNVSYLVLRL |
| Ga0105251_106476342 | 3300009011 | Switchgrass Rhizosphere | MEKRLVTRYAMQSAEAADENQRRVEGVFDELATTNPDN |
| Ga0105240_100514531 | 3300009093 | Corn Rhizosphere | VTSNLQEAHVQKRLVTRYAMRSTGDADENQRRIEGVFADLAASQPDNVSYVV |
| Ga0105247_110639202 | 3300009101 | Switchgrass Rhizosphere | VQFRLVTRYASRSAEAADDNQRRVEAVFAELDRTRPDNVSYLVM |
| Ga0105247_118538771 | 3300009101 | Switchgrass Rhizosphere | MEKRLVTRYAMRSSEDADENQRRVEAVFAQLAEDAPNN |
| Ga0075423_123804412 | 3300009162 | Populus Rhizosphere | MPQPERSNPVEKRLVTRYAMRSAEAADENQRRVEGVFEELADTGPDNVSYLVLRL |
| Ga0105242_112075261 | 3300009176 | Miscanthus Rhizosphere | MQKRLVTRYAMQSAEEADENQRRVEGVFAELEATAPDNVS* |
| Ga0105249_122718491 | 3300009553 | Switchgrass Rhizosphere | MTNSEPVQYRLVTRYASSSADAADENQRRIEGVFAELAENAPDNVSYI |
| Ga0105340_12324042 | 3300009610 | Soil | MQERLVTRYAMPSTEAADENQRRVEGVFAELDTSKPDNVSYLVLRLA |
| Ga0116109_11815091 | 3300009627 | Peatland | MMARNKENSMEKRLVTQYATKSSDDADENQRRIEGVFAELAEVQPDNV |
| Ga0116101_11049882 | 3300009759 | Peatland | VEKRLVTRYATKSKADADENQRRVEGVFEELALNRPYDVSYIV |
| Ga0105084_10414803 | 3300009811 | Groundwater Sand | MEKRLVTRYATRSAEAANENQRRVEGVFDELAATKPDNV |
| Ga0105070_11209731 | 3300009815 | Groundwater Sand | VSQEPGIGERSNVKKRLVTRYAMRSAEAANENQRRVEGVFDELAAAKPDNVS |
| Ga0134084_101367963 | 3300010322 | Grasslands Soil | MEKRLVTRYATKSPEAADENQRRIEGVFEDLAANRPGTVS |
| Ga0134064_103260812 | 3300010325 | Grasslands Soil | MEKRLVTCYATRSVEAADENQRRVEAVFDELEAAKPDSVSYI |
| Ga0134124_103256631 | 3300010397 | Terrestrial Soil | VQFRLVTRYASRSAEAADDNQRRVEAVFAELDRTRPDNVSYLVMRLA |
| Ga0134121_126424192 | 3300010401 | Terrestrial Soil | TISQPVQYRLVTRYASSSADAADDNQRRIEGVFAELAENAPDCVWCP* |
| Ga0151489_17143331 | 3300011106 | Soil | VQFRLVTRYASRSAEAADDNQRRVEAVFAELDQTRPGNVSYLVL |
| Ga0137391_107440522 | 3300011270 | Vadose Zone Soil | MQKRLVTRYAMQSSEAADENQQRVEGVFSELAATAPDNVSYIVLRLAD |
| Ga0137393_112919922 | 3300011271 | Vadose Zone Soil | VEKRLVTRYAMRSADAADENQRRVEGVFAELAASKPDSVSY |
| Ga0120118_11090481 | 3300012010 | Permafrost | VQKRLVTRYAMRSAEAADENQQRIEGVFAELAASKPDTVSY |
| Ga0120118_11190011 | 3300012010 | Permafrost | MQKRLVTSYAMQSPEAADENQRRVEGVFAELAANRPDNVSYIVLR |
| Ga0120152_10377932 | 3300012011 | Permafrost | MQKRLVTRYAMQSAEAANENQRRVEGVFDELAATKPDNVSYI |
| Ga0120152_10389142 | 3300012011 | Permafrost | MHKRLVTRYATQSSVAADENQRRIEGVFAELAANKPDNVSYIVLRL |
| Ga0120159_10189755 | 3300012014 | Permafrost | MQKRLVTRYAMQSAEAADENQRRVEGVFAELVATAP |
| Ga0137365_103701741 | 3300012201 | Vadose Zone Soil | VKKRLVTRYAMRSAEAANENQRRVEGVFDELAAAKPDSVSYMVLRLADDSF |
| Ga0137376_102320292 | 3300012208 | Vadose Zone Soil | MHKRLVTSYATQNSIAADENQRRIEAVFAELAKNQPD |
| Ga0137376_112613871 | 3300012208 | Vadose Zone Soil | MEKRLVTRYATRSVEAADENQRRVEAVFDELETGKPDNVSYIVLRLADESF |
| Ga0137377_118330862 | 3300012211 | Vadose Zone Soil | VQFRLVTRYARRSAGAAEDNQRRVEAVFAELDRARPGNVSYLVLRLADDSFVH |
| Ga0137387_109334871 | 3300012349 | Vadose Zone Soil | MQKRLVTHYGMRSAEAADENQRRVEGVFAELGETKPDSVSYIVLRLADD |
| Ga0157294_101839481 | 3300012892 | Soil | MEKRLVTRYAMRSVEAADENQRRVEGVFDELATTKPDTVSYIVLRLADDS |
| Ga0137395_100147504 | 3300012917 | Vadose Zone Soil | MHKRLVTRYATQSSIAADENQRRIEGVFAELAANKPDNVSYIVLRL |
| Ga0137407_116389551 | 3300012930 | Vadose Zone Soil | MEKRLVTRYAMASAEAADENQRRVEGVFADLAAAKPGNVSYLVL |
| Ga0164298_112622951 | 3300012955 | Soil | MQKRLVTRYAMPSAEAADENQRRVEGLFAELEAATPDNVSY |
| Ga0164308_112790702 | 3300012985 | Soil | MTNSEPVQYRLVTRYASSSADAADENQRRIEGVFAELAENAPDNVSYTVLRLQDDSFL |
| Ga0164307_105301533 | 3300012987 | Soil | MQKRLVTRYATQSAEAADENQRRVEGVFGELAASKPG |
| Ga0157372_124357461 | 3300013307 | Corn Rhizosphere | MHKRLVTRYAMKSAEDAEENQRRVEGVFADLEQTKPDNVSYLVLRL |
| Ga0120155_11749781 | 3300013768 | Permafrost | MQKRLVTRYAMQSPEAADENQRRVEGVFAELATNTPDNVSY |
| Ga0120123_10525053 | 3300013770 | Permafrost | MQKRLVTRYAMRSAEAADENQRRVEGVFDELAADN |
| Ga0120104_10163391 | 3300014829 | Permafrost | MQKRLVTRYATKSAEAADENQRRGGAVFSELAGAQPDK |
| Ga0157379_123335362 | 3300014968 | Switchgrass Rhizosphere | VQKRLVTRYAMPSAEAADENQRRVEGVFDELAETRPDSVSYIVLRLAD |
| Ga0134089_103469012 | 3300015358 | Grasslands Soil | MEKRLVTRYAMRSAEEADENQQRVEGVFAELAVSKPDNVSYI |
| Ga0134085_101220522 | 3300015359 | Grasslands Soil | MQKRLVTRYAMRSAEAANENQRRIEGVFDELAAAKPDNVSY |
| Ga0134085_101283681 | 3300015359 | Grasslands Soil | MEKRLVTRYATKSPEAADENQRRIEGVFEDLAANRPGIVSYIVLR |
| Ga0134085_102676971 | 3300015359 | Grasslands Soil | MEKRLVTRYAMRSVEAANENQRRVEGVFAELAAAEPDSVSYI |
| Ga0132257_1035468712 | 3300015373 | Arabidopsis Rhizosphere | MEKRLVTRYAMRSSEDADENQRRVEAVFAQLAEDAPNNVSYI |
| Ga0132255_1015636661 | 3300015374 | Arabidopsis Rhizosphere | MEKRLVTRYDTKSAEAADENQRRVEAVFEELAATKPDN |
| Ga0187819_107152532 | 3300017943 | Freshwater Sediment | MQKRLVTRYATKSPADTDENQRRIESVFAELKETQ |
| Ga0190266_112506142 | 3300017965 | Soil | MQKRLVTRYATQSAEAADENQRRVEGVFDELVATKPDNVSYIVLR |
| Ga0187869_105774952 | 3300018030 | Peatland | MKKRLVTRYATQSTEAADENERRVKGVFAELEASKPDNVSYIV |
| Ga0187859_105921251 | 3300018047 | Peatland | MQKRLVTRYATKSTEAADENELRVKGVFAELEANKPDNVSYIVLRL |
| Ga0184619_104184461 | 3300018061 | Groundwater Sediment | MEKRLVTRYAMRSADAADENQRRVEGVFDELAAAK |
| Ga0184618_103711881 | 3300018071 | Groundwater Sediment | MKKRLVTRYAMRSAEAADENQRRVEGVFDELATAKPDSVSYIVLRLA |
| Ga0184618_104199812 | 3300018071 | Groundwater Sediment | MQKRLVTRYAMTSAEAADENQRRVEGVFAELVANKPDSVSYIVLRLAD |
| Ga0184627_103022601 | 3300018079 | Groundwater Sediment | MKKRLVTRYAMRSAEAANENQRRVEGVFDELAAAKPDS |
| Ga0184625_103365203 | 3300018081 | Groundwater Sediment | MEKRLVTRYAMRSAEAADENQRRVEVVFDELAAAKPDNVSYIVLRLAD |
| Ga0173482_103335261 | 3300019361 | Soil | MTNSEPVQYRLVTRYATSSADAADENQRRIEGVFAELADNGPDNVSYIAAVG |
| Ga0182025_10397851 | 3300019786 | Permafrost | MEKRLVTRYSTKSKDDADENQRRVEAVFVELNESKPDNVSQRQLHRPS |
| Ga0193696_10176995 | 3300020016 | Soil | MEKRLVTRYAMQSAEAADENQRRVEGVFDELATTNPDNVSYIVLRLAD |
| Ga0210382_104584701 | 3300021080 | Groundwater Sediment | MEKRLVTRYSMQSAEAADENQRRVEGVFDELAETKPESVSYIVLRLAD |
| Ga0210380_105153572 | 3300021082 | Groundwater Sediment | VEKRLVTRYAMRSAEEADENQRRVEGVFQELAATQPD |
| Ga0193719_102396351 | 3300021344 | Soil | MQKRLVTRYAMQSAEAADENQRRVEGVFAELEATTPDNVSY |
| Ga0222623_102730502 | 3300022694 | Groundwater Sediment | MQKRLVTRYAMQSAESADENQRRVEGVFVELEATTPD |
| Ga0193714_10446621 | 3300023058 | Soil | MQKRLVTRYAMQSAEASDENQRRVEGVFAELEATTPDNVSYIVL |
| Ga0224551_10137091 | 3300023259 | Soil | VEKRLVTRYATKSEVAADENQKRIEGVFEELDNTKPDNVSYI |
| Ga0247673_10746822 | 3300024224 | Soil | MEKRLVTRYAMRSAEAANENQRRVEGVFDELAAAKPDNVSYIVLRLA |
| Ga0224556_10038025 | 3300024295 | Soil | VEKRLVTRYATQSQVAADENQKRIEGVFEELAKKRPDNV |
| Ga0209342_111915221 | 3300025326 | Soil | MKKRLVTRYAMRSAEAANENQRRVEAVFDELAAAKPDS |
| Ga0208077_10623901 | 3300025427 | Arctic Peat Soil | LNEGIHVEKRLVTRYATKSPDAADENQRRIEGVFDELSQ |
| Ga0207927_10761511 | 3300025579 | Arctic Peat Soil | MEKRLVTRYAMRSAEAADENERRVEGVFAELAANKPDNVSYIVLRL |
| Ga0208589_10977643 | 3300025634 | Arctic Peat Soil | MHKRLVTRYATKSKESADENQRRVEGVFAELEANK |
| Ga0209584_104438311 | 3300025878 | Arctic Peat Soil | MQKRLVRRYATQLAEAANENQRRVEGVFDELSATRPDMVS |
| Ga0207682_105359291 | 3300025893 | Miscanthus Rhizosphere | MEKRLVTRYAMRSVEAADENQRRVEGVFDELAATKPETV |
| Ga0207642_103971842 | 3300025899 | Miscanthus Rhizosphere | VEKRLVTRYAMRSAEDADENQRRVEGVFQELAAAQPHNVSYLV |
| Ga0207694_112299691 | 3300025924 | Corn Rhizosphere | MEKRLVTRYAMQSAEAADENQRRVEGVFDELATTNPDNVSYIV |
| Ga0207686_105802472 | 3300025934 | Miscanthus Rhizosphere | MQKRLVTRYAMRSAEEADENQRRVEGVFAELEATAPDNVS |
| Ga0207686_114386821 | 3300025934 | Miscanthus Rhizosphere | MEKRLVTRYAVRSAEDADENQRRIEGVFAELAEAKPDNVSY |
| Ga0207709_113519211 | 3300025935 | Miscanthus Rhizosphere | MEKRLVTRYAMRSSEDADEYQRRVEAVFAQLAEDAPNNVSYI |
| Ga0207641_105116221 | 3300026088 | Switchgrass Rhizosphere | VEKRLVTRYAMQSPEAADENQRRVEGVFAELEAAKPGNVSYLVFRLVD |
| Ga0207641_122297771 | 3300026088 | Switchgrass Rhizosphere | MEKRLVTSYAMRSAEDADENQRRVEGVFAELAEAKPEN |
| Ga0207648_121624612 | 3300026089 | Miscanthus Rhizosphere | VEKRLVTRYAMRSAEDADENQRRVEGVFQELAAAQPDNVSYLVL |
| Ga0207698_118081592 | 3300026142 | Corn Rhizosphere | VTNSEPVQYRLVTRYATSSADAADENQRRIEGVFAELADNGPDNVSYIAAVG |
| Ga0209027_11978342 | 3300026300 | Grasslands Soil | VEKRLVTRYAMRSAEAADENQRRVEGVFDELAAARPDNVSYIVLR |
| Ga0209802_13308912 | 3300026328 | Soil | VEKRLVTRYAMRSADAADENQRRVEGVFAELAASKPDSVSYIV |
| Ga0207485_1001241 | 3300026799 | Soil | MQKRLVTRYAMRSAEAAAENQRRVEGVFEELAAAKPDNVSYIVLRLA |
| Ga0207726_10384101 | 3300027045 | Tropical Forest Soil | MEKRLVTRYASKSSEAADENERRIRDVFADLEQSRP |
| Ga0209420_10936783 | 3300027648 | Forest Soil | MQKRLVTRYATKSKEAADENQRRVEGVFAELEANTP |
| Ga0208989_100144761 | 3300027738 | Forest Soil | MHKRLVTRYATQSAIAADENQRRIEAVFGDLAAKKPDNVSYIVLRL |
| Ga0209590_104696291 | 3300027882 | Vadose Zone Soil | MQKRLVTRYSMRSTEAANENQRRVEGVFDELAATEPG |
| Ga0209488_100461274 | 3300027903 | Vadose Zone Soil | MQKRLVTRYAMRSAEAADENQQRVEGVFAELTASKPDNVSYIVLRLAD |
| Ga0209583_107712691 | 3300027910 | Watersheds | MHKRLVTRYAMKSAEDADENQRRVEGVFAELAANQPDTVSYIV |
| Ga0302152_102782072 | 3300028572 | Bog | MFISMEGCNVEKRLFTRYATSSQVAADENQKRIEGVFEELAQKKPDNVSYIVLRLADD |
| Ga0307279_100841502 | 3300028709 | Soil | MQKRLVTRYAMQSAEAADENQRRVEGVFAELEATTPDNVSYIVLRL |
| Ga0307311_100868763 | 3300028716 | Soil | MQKRLVTRYAMRSAEEADENQRRVEGVFAELEATTPDNVSYIVLRLAD |
| Ga0307301_102690201 | 3300028719 | Soil | MEKRLVTRYAMQSAEAADENQRRVEGVFDELVANKPD |
| Ga0307319_101702061 | 3300028722 | Soil | MEKRLVTRYAMKSAETADENQRRVEGVFDELAAAKP |
| Ga0302225_101335321 | 3300028780 | Palsa | MQKRLVTRYATKSTEAADENQRRVEGVFAELEANKPGNVSYIV |
| Ga0307290_101014751 | 3300028791 | Soil | MQKRLVTRYAMQSAEAADENQRRVEGVFAELDSTA |
| Ga0307299_101104991 | 3300028793 | Soil | MEKRLVTRYAMRSADAADENQRRVEGVFDELAAAKPDNVSY |
| Ga0307503_104117021 | 3300028802 | Soil | MEKRLVTRYAMRSAEDADENHRRIEGVFAELAEAKPDNVSYIVL |
| Ga0307503_105802591 | 3300028802 | Soil | MQKRLVTRYAMQSAEAADENQRRVEGVSAELEATKPGNVS |
| Ga0307281_102375542 | 3300028803 | Soil | MTTSQPVQFRLVTRYASSSTEAADENQRRIEGVFAELADNAPDNVSY |
| Ga0307305_103479531 | 3300028807 | Soil | MEKRLVTRYAMRSAEAADENQRRVEGVFDELATAKPDNVSYVVL |
| Ga0307296_101211621 | 3300028819 | Soil | MEKRLVTRYAMSSPEAANENQRRVEGVFAELAAAQPD |
| Ga0307312_101601673 | 3300028828 | Soil | VNKRLVTRYAMRSTEAADENQRRVEGVFADLAVTKPDNVSYIVLRL |
| Ga0302199_12335162 | 3300028860 | Bog | VEKRLVTRYATKSRADADENQKRIEGVFTELALNQ |
| Ga0307289_102635071 | 3300028875 | Soil | MKKRLVTRYAMRSAEAADENQRRVEGVFDELTAAKPDSVSYIVLRLADD |
| Ga0307278_100649511 | 3300028878 | Soil | VKKRLVTRYATRSAEAANENQRRVEGVFDALAAAKPDSVSYIVLRLADG |
| Ga0308309_114836772 | 3300028906 | Soil | MHKRLVTRYATKSKEAADDNQRRAEGVFAELEANKPGN |
| Ga0311346_100355829 | 3300029952 | Bog | VEKRLFTRYATSSQVAADENQKRIEGVFEELAQKKPDNVSYIVLRLADD |
| Ga0311332_110067222 | 3300029984 | Fen | MQKRLVTRYAMRSAEDADENQRRVEAVFDKLAAAEPDTVSYIVLRLA |
| Ga0302283_13500171 | 3300029994 | Fen | VEKRLVTRYATKSRADADENQKRIEGVFTELALNQPEDVSYIVLRLADDSFVH |
| Ga0308189_102721613 | 3300031058 | Soil | MQKRLVTRYAMQSAEASDENQRRVEGVFAELEATTPD |
| Ga0308204_100823761 | 3300031092 | Soil | MQKRLVTRYAMQSAEAADENQRRVEGVFAELEAAAPDN |
| Ga0308197_102156821 | 3300031093 | Soil | MEKRLVTRYAMPSGEAADENQRRVEGVFDELVETKPDNV |
| Ga0265332_103436382 | 3300031238 | Rhizosphere | VQKRLVTRYAMQSAEAADENQRRVEGVFAELAETNPETGSYIVLRLADDSFV |
| Ga0265327_102142072 | 3300031251 | Rhizosphere | VQKRLVTRYAMRSADDADENQRRIEGVFEALAADQPDNVSYLV |
| Ga0307505_106822441 | 3300031455 | Soil | MEKRLVTRYAMRSAEEADENQRRVEGVFEELAATRPGNVSYIVLR |
| Ga0170818_1033254731 | 3300031474 | Forest Soil | MHKRLVTRYATQSQEAADENQRRVEGVFAELEANKPDNVS |
| Ga0307372_102869001 | 3300031671 | Soil | MQKRLVTHDATRSAAADENQRRVEAVFADLAASRPSSV |
| Ga0307372_103332932 | 3300031671 | Soil | MHKRLVTRYATKSKEAADENQRRVEGVFAELEANKPGNVSYIVL |
| Ga0310686_1025892361 | 3300031708 | Soil | MEKRLVTRYRTSSQAAADENQKRIEGVFEELAATKPDNVSYIVLRLA |
| Ga0265342_105175812 | 3300031712 | Rhizosphere | MHKRLVTRYAMKSADDADENQRRVEGVFAELAANKPDNV |
| Ga0318502_103094963 | 3300031747 | Soil | MQKRLVTRYATNSPADADENQGRIEGVFAALEASQPDNVSYLVFRLADGS |
| Ga0318554_101979664 | 3300031765 | Soil | MQKRLVTRYATNSPADADENQRRVEGVFAALEASQPDNVSY |
| Ga0318526_101187634 | 3300031769 | Soil | MQKRLVTRYATNSPADADENQGRIEGVFAALEASQPDNVSYLVFRL |
| Ga0315280_103046952 | 3300031862 | Sediment | MKKRLVTRYAMRSAEAADENQRRVEGVFDELATAKPDSVSYIVLRLAD |
| Ga0306919_105270503 | 3300031879 | Soil | MQKRLVTRYATNSPADADENQGRIEGVFAALEASQPDNVSYLVLR |
| Ga0310910_109347913 | 3300031946 | Soil | MQKRLVTRYATNSPADADENQGRIEGVFAALEASQPDNVSYLVFRLADG |
| Ga0307479_117351872 | 3300031962 | Hardwood Forest Soil | MEKRLVTRYATRSAEAADENQRRVEAVFEELAAAQPDNVSYLVLR |
| Ga0310903_107812661 | 3300032000 | Soil | MQKRLVTRYAMPTTEAADENQRRVAGVFAELDTAKPDNVSYIV |
| Ga0318556_100393821 | 3300032043 | Soil | MQKRLVTRYATNSPADADENQGRIEGVFAALEASQPDNVSYLVLRL |
| Ga0318524_101496911 | 3300032067 | Soil | MQKRLVTRYATNSPADADENQGRIEGVFAALEASQPDNV |
| Ga0315281_112050082 | 3300032163 | Sediment | MKKRLVTRYAMRSAEAADENQRRVEGVFDELATAKPDSVSYI |
| Ga0315276_122315011 | 3300032177 | Sediment | MKKRLVTRYAMRSAEAADENQRRVEGVFDELATAKPD |
| Ga0335069_107761503 | 3300032893 | Soil | MEKRLVTRYATTSQDAAHENQRRIEGVFTELEATRPDNVSYIVLRL |
| Ga0370493_0301609_418_549 | 3300034129 | Untreated Peat Soil | MSAPIQYRLVTRYTAASPETADENQRRIEKVFAELDAAQPDNVS |
| ⦗Top⦘ |