Basic Information | |
---|---|
Family ID | F031915 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 181 |
Average Sequence Length | 42 residues |
Representative Sequence | MKFMFTIYHDENVLDAMPEKEMQALVDSAIEYAEEIRRSGHY |
Number of Associated Samples | 149 |
Number of Associated Scaffolds | 181 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 98.34 % |
% of genes near scaffold ends (potentially truncated) | 93.92 % |
% of genes from short scaffolds (< 2000 bps) | 94.48 % |
Associated GOLD sequencing projects | 144 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.51 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (94.475 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (10.497 % of family members) |
Environment Ontology (ENVO) | Unclassified (23.204 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.541 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 38.57% β-sheet: 0.00% Coil/Unstructured: 61.43% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 181 Family Scaffolds |
---|---|---|
PF03795 | YCII | 27.62 |
PF02668 | TauD | 3.31 |
PF01575 | MaoC_dehydratas | 2.76 |
PF08281 | Sigma70_r4_2 | 2.21 |
PF00903 | Glyoxalase | 1.66 |
PF00501 | AMP-binding | 1.10 |
PF07589 | PEP-CTERM | 1.10 |
PF07690 | MFS_1 | 1.10 |
PF00378 | ECH_1 | 0.55 |
PF02515 | CoA_transf_3 | 0.55 |
PF13428 | TPR_14 | 0.55 |
PF02728 | Cu_amine_oxidN3 | 0.55 |
PF12681 | Glyoxalase_2 | 0.55 |
PF09865 | DUF2092 | 0.55 |
PF08240 | ADH_N | 0.55 |
PF07963 | N_methyl | 0.55 |
PF12867 | DinB_2 | 0.55 |
PF04397 | LytTR | 0.55 |
PF00389 | 2-Hacid_dh | 0.55 |
PF02826 | 2-Hacid_dh_C | 0.55 |
PF06983 | 3-dmu-9_3-mt | 0.55 |
PF04075 | F420H2_quin_red | 0.55 |
PF13592 | HTH_33 | 0.55 |
PF00496 | SBP_bac_5 | 0.55 |
PF13561 | adh_short_C2 | 0.55 |
PF02627 | CMD | 0.55 |
PF13191 | AAA_16 | 0.55 |
PF00106 | adh_short | 0.55 |
PF00072 | Response_reg | 0.55 |
COG ID | Name | Functional Category | % Frequency in 181 Family Scaffolds |
---|---|---|---|
COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 27.62 |
COG2175 | Taurine dioxygenase, alpha-ketoglutarate-dependent | Secondary metabolites biosynthesis, transport and catabolism [Q] | 3.31 |
COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.55 |
COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 0.55 |
COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.55 |
COG2764 | Zn-dependent glyoxalase, PhnB family | Energy production and conversion [C] | 0.55 |
COG3733 | Cu2+-containing amine oxidase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.55 |
COG3865 | Glyoxalase superfamily enzyme, possible 3-demethylubiquinone-9 3-methyltransferase | General function prediction only [R] | 0.55 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 94.48 % |
Unclassified | root | N/A | 5.52 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000559|F14TC_100594162 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
3300000891|JGI10214J12806_10132458 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Hahellaceae → Hahella → Hahella chejuensis | 1072 | Open in IMG/M |
3300000955|JGI1027J12803_107207372 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 874 | Open in IMG/M |
3300000956|JGI10216J12902_112323042 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300001228|SwM_102805 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
3300001661|JGI12053J15887_10378644 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
3300001661|JGI12053J15887_10576017 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
3300002908|JGI25382J43887_10412306 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
3300004114|Ga0062593_102591659 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
3300005176|Ga0066679_10541263 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 758 | Open in IMG/M |
3300005177|Ga0066690_10961085 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
3300005181|Ga0066678_11061529 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
3300005186|Ga0066676_10172935 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1372 | Open in IMG/M |
3300005295|Ga0065707_10349639 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 920 | Open in IMG/M |
3300005332|Ga0066388_103598333 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 791 | Open in IMG/M |
3300005332|Ga0066388_105961839 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 616 | Open in IMG/M |
3300005336|Ga0070680_101371645 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 612 | Open in IMG/M |
3300005434|Ga0070709_11194979 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
3300005440|Ga0070705_100105845 | All Organisms → cellular organisms → Bacteria | 1787 | Open in IMG/M |
3300005445|Ga0070708_101264523 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
3300005446|Ga0066686_10619706 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
3300005447|Ga0066689_10616361 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 683 | Open in IMG/M |
3300005447|Ga0066689_10644791 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
3300005450|Ga0066682_10738578 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
3300005467|Ga0070706_101685224 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 577 | Open in IMG/M |
3300005468|Ga0070707_102127812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 529 | Open in IMG/M |
3300005536|Ga0070697_101401620 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
3300005540|Ga0066697_10372522 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
3300005546|Ga0070696_100533523 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 938 | Open in IMG/M |
3300005546|Ga0070696_101036707 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 687 | Open in IMG/M |
3300005549|Ga0070704_100467835 | All Organisms → cellular organisms → Bacteria | 1089 | Open in IMG/M |
3300005549|Ga0070704_101488098 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 623 | Open in IMG/M |
3300005553|Ga0066695_10713682 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
3300005556|Ga0066707_10527309 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
3300005568|Ga0066703_10111769 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1616 | Open in IMG/M |
3300005616|Ga0068852_100771950 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 974 | Open in IMG/M |
3300005713|Ga0066905_100123775 | All Organisms → cellular organisms → Bacteria | 1810 | Open in IMG/M |
3300005713|Ga0066905_101117591 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 701 | Open in IMG/M |
3300005764|Ga0066903_100914282 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1590 | Open in IMG/M |
3300005764|Ga0066903_101932211 | All Organisms → cellular organisms → Bacteria | 1131 | Open in IMG/M |
3300005764|Ga0066903_102861957 | All Organisms → cellular organisms → Bacteria | 936 | Open in IMG/M |
3300005841|Ga0068863_100477312 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1226 | Open in IMG/M |
3300005841|Ga0068863_100820996 | All Organisms → cellular organisms → Bacteria | 928 | Open in IMG/M |
3300005937|Ga0081455_10883696 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
3300006196|Ga0075422_10356170 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 639 | Open in IMG/M |
3300006358|Ga0068871_102252585 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 519 | Open in IMG/M |
3300006806|Ga0079220_10038961 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2166 | Open in IMG/M |
3300006806|Ga0079220_10970513 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
3300006846|Ga0075430_101359755 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
3300006852|Ga0075433_11220062 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
3300006854|Ga0075425_100847027 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1047 | Open in IMG/M |
3300006871|Ga0075434_100953290 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
3300006903|Ga0075426_11110800 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
3300006904|Ga0075424_100766869 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1029 | Open in IMG/M |
3300006954|Ga0079219_10133985 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1290 | Open in IMG/M |
3300007255|Ga0099791_10510129 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
3300009012|Ga0066710_100290695 | All Organisms → cellular organisms → Bacteria | 2388 | Open in IMG/M |
3300009012|Ga0066710_101805407 | All Organisms → cellular organisms → Bacteria | 923 | Open in IMG/M |
3300009012|Ga0066710_104116467 | Not Available | 544 | Open in IMG/M |
3300009012|Ga0066710_104902633 | Not Available | 501 | Open in IMG/M |
3300009148|Ga0105243_10378955 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1308 | Open in IMG/M |
3300009162|Ga0075423_12214821 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
3300009174|Ga0105241_12524065 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
3300009177|Ga0105248_13108029 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 528 | Open in IMG/M |
3300009553|Ga0105249_12285139 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
3300009792|Ga0126374_10134196 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1472 | Open in IMG/M |
3300009792|Ga0126374_10477692 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
3300009792|Ga0126374_11502604 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
3300009821|Ga0105064_1131221 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
3300010043|Ga0126380_11797808 | Not Available | 554 | Open in IMG/M |
3300010046|Ga0126384_11847999 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
3300010047|Ga0126382_10574941 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 922 | Open in IMG/M |
3300010081|Ga0127457_1068176 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300010322|Ga0134084_10128318 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
3300010335|Ga0134063_10340374 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
3300010359|Ga0126376_10478946 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1146 | Open in IMG/M |
3300010359|Ga0126376_10621056 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1026 | Open in IMG/M |
3300010359|Ga0126376_11257175 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 758 | Open in IMG/M |
3300010362|Ga0126377_10976502 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
3300010362|Ga0126377_12724457 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
3300010366|Ga0126379_13629226 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
3300010376|Ga0126381_104546407 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
3300010397|Ga0134124_12085547 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 605 | Open in IMG/M |
3300010398|Ga0126383_10541220 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1229 | Open in IMG/M |
3300010398|Ga0126383_12161121 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
3300010399|Ga0134127_11499665 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
3300010400|Ga0134122_10752195 | All Organisms → cellular organisms → Bacteria | 923 | Open in IMG/M |
3300010401|Ga0134121_13127305 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 511 | Open in IMG/M |
3300012203|Ga0137399_11665393 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
3300012205|Ga0137362_11152920 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
3300012362|Ga0137361_11107838 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
3300012582|Ga0137358_10257281 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1187 | Open in IMG/M |
3300012582|Ga0137358_10598546 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
3300012685|Ga0137397_10366039 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1074 | Open in IMG/M |
3300012883|Ga0157281_1110847 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
3300012912|Ga0157306_10007325 | All Organisms → cellular organisms → Bacteria | 2060 | Open in IMG/M |
3300012918|Ga0137396_11073007 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
3300012922|Ga0137394_11158991 | Not Available | 637 | Open in IMG/M |
3300012923|Ga0137359_10908862 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
3300012925|Ga0137419_11575079 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
3300012931|Ga0153915_10760067 | All Organisms → cellular organisms → Bacteria | 1122 | Open in IMG/M |
3300012944|Ga0137410_11352456 | Not Available | 617 | Open in IMG/M |
3300012948|Ga0126375_11608660 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
3300012971|Ga0126369_11237326 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 836 | Open in IMG/M |
3300012972|Ga0134077_10296572 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
3300012977|Ga0134087_10680068 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
3300013100|Ga0157373_11095520 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
3300013297|Ga0157378_12455628 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 573 | Open in IMG/M |
3300014154|Ga0134075_10042359 | All Organisms → cellular organisms → Bacteria | 1869 | Open in IMG/M |
3300014157|Ga0134078_10051433 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1428 | Open in IMG/M |
3300014308|Ga0075354_1044078 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
3300015053|Ga0137405_1226009 | All Organisms → cellular organisms → Bacteria | 1041 | Open in IMG/M |
3300015371|Ga0132258_12119652 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1413 | Open in IMG/M |
3300015371|Ga0132258_12165785 | Not Available | 1396 | Open in IMG/M |
3300015373|Ga0132257_100009379 | All Organisms → cellular organisms → Bacteria | 9715 | Open in IMG/M |
3300017656|Ga0134112_10202902 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
3300017657|Ga0134074_1135644 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 856 | Open in IMG/M |
3300018032|Ga0187788_10171534 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
3300019883|Ga0193725_1124531 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
3300021560|Ga0126371_10342523 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1628 | Open in IMG/M |
3300021560|Ga0126371_12051598 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
3300025318|Ga0209519_10169589 | All Organisms → cellular organisms → Bacteria | 1290 | Open in IMG/M |
3300025549|Ga0210094_1078436 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
3300025893|Ga0207682_10618748 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300025915|Ga0207693_10388155 | All Organisms → cellular organisms → Bacteria | 1092 | Open in IMG/M |
3300025922|Ga0207646_11491092 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
3300025938|Ga0207704_11120719 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
3300025938|Ga0207704_11296328 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
3300025941|Ga0207711_11936077 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
3300025942|Ga0207689_10017674 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6027 | Open in IMG/M |
3300026015|Ga0208286_1021861 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
3300026089|Ga0207648_10338810 | All Organisms → cellular organisms → Bacteria | 1354 | Open in IMG/M |
3300026102|Ga0208914_1048397 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
3300026116|Ga0207674_10579053 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1084 | Open in IMG/M |
3300026116|Ga0207674_11123781 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
3300026310|Ga0209239_1239070 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
3300026313|Ga0209761_1080016 | All Organisms → cellular organisms → Bacteria | 1698 | Open in IMG/M |
3300026328|Ga0209802_1079029 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1532 | Open in IMG/M |
3300026332|Ga0209803_1254667 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
3300026498|Ga0257156_1026919 | All Organisms → cellular organisms → Bacteria | 1157 | Open in IMG/M |
3300027654|Ga0209799_1146273 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula → Pedosphaera parvula Ellin514 | 538 | Open in IMG/M |
3300027874|Ga0209465_10084231 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1550 | Open in IMG/M |
3300028380|Ga0268265_10057418 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2966 | Open in IMG/M |
3300028381|Ga0268264_10737377 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 981 | Open in IMG/M |
3300028809|Ga0247824_10418726 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
3300030336|Ga0247826_10384039 | All Organisms → cellular organisms → Bacteria | 1033 | Open in IMG/M |
3300031226|Ga0307497_10384929 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 666 | Open in IMG/M |
3300031231|Ga0170824_123686552 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
3300031231|Ga0170824_123918850 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 934 | Open in IMG/M |
3300031446|Ga0170820_14373904 | Not Available | 1246 | Open in IMG/M |
3300031474|Ga0170818_108582691 | Not Available | 1465 | Open in IMG/M |
3300031561|Ga0318528_10274240 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
3300031668|Ga0318542_10494837 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
3300031679|Ga0318561_10294999 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
3300031682|Ga0318560_10739310 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
3300031682|Ga0318560_10783080 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 515 | Open in IMG/M |
3300031720|Ga0307469_10696104 | All Organisms → cellular organisms → Bacteria | 921 | Open in IMG/M |
3300031736|Ga0318501_10041532 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2102 | Open in IMG/M |
3300031740|Ga0307468_102415439 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300031747|Ga0318502_10137158 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Variibacter → Variibacter gotjawalensis | 1386 | Open in IMG/M |
3300031754|Ga0307475_10424457 | All Organisms → cellular organisms → Bacteria | 1069 | Open in IMG/M |
3300031764|Ga0318535_10444923 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
3300031781|Ga0318547_10492509 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
3300031820|Ga0307473_10012127 | All Organisms → cellular organisms → Bacteria | 3187 | Open in IMG/M |
3300031821|Ga0318567_10687826 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 580 | Open in IMG/M |
3300031896|Ga0318551_10630694 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
3300031942|Ga0310916_11212364 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 624 | Open in IMG/M |
3300031946|Ga0310910_10034620 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 3464 | Open in IMG/M |
3300032013|Ga0310906_10442840 | All Organisms → cellular organisms → Bacteria | 867 | Open in IMG/M |
3300032067|Ga0318524_10744388 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
3300032067|Ga0318524_10791331 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
3300032094|Ga0318540_10565908 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 548 | Open in IMG/M |
3300032174|Ga0307470_10072228 | Not Available | 1868 | Open in IMG/M |
3300032180|Ga0307471_100121645 | All Organisms → cellular organisms → Bacteria | 2433 | Open in IMG/M |
3300032180|Ga0307471_100431226 | All Organisms → cellular organisms → Bacteria | 1453 | Open in IMG/M |
3300032180|Ga0307471_100533146 | All Organisms → cellular organisms → Bacteria | 1326 | Open in IMG/M |
3300032180|Ga0307471_101092818 | All Organisms → cellular organisms → Bacteria | 963 | Open in IMG/M |
3300032180|Ga0307471_101415442 | Not Available | 855 | Open in IMG/M |
3300032180|Ga0307471_103171321 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Frateuria → unclassified Frateuria → Frateuria sp. Soil773 | 583 | Open in IMG/M |
3300033432|Ga0326729_1011919 | All Organisms → cellular organisms → Bacteria | 1506 | Open in IMG/M |
3300034661|Ga0314782_186537 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 10.50% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 9.39% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.39% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.18% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.63% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.08% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.97% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.97% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.42% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.87% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.76% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.21% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.21% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.21% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.21% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.21% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.66% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.66% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.66% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.66% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.10% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.10% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.55% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.55% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.55% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.55% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.55% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.55% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.55% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.55% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.55% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.55% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.55% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.55% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.55% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.55% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.55% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.55% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.55% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.55% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001228 | Switchgrass rhizosphere microbial communities from Knoxville, Tennessee, USA - 12_joined | Host-Associated | Open in IMG/M |
3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300009821 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010081 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012883 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 | Environmental | Open in IMG/M |
3300012912 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2 | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300014308 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleC_D1 | Environmental | Open in IMG/M |
3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
3300019883 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2 | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300025318 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 1 | Environmental | Open in IMG/M |
3300025549 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026015 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_401 (SPAdes) | Environmental | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026102 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D1 (SPAdes) | Environmental | Open in IMG/M |
3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
3300026498 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-A | Environmental | Open in IMG/M |
3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028809 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48 | Environmental | Open in IMG/M |
3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300033432 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF6AY SIP fraction | Environmental | Open in IMG/M |
3300034661 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
F14TC_1005941622 | 3300000559 | Soil | MKFLFMIFHDEGVLDALPKGEMQTLVDSALDYDEEIRQSGHYIVS |
JGI10214J12806_101324581 | 3300000891 | Soil | MKFMFMIYHDENVLDALPEGEMQALIDSALDYDEEIRRSGHYIV |
JGI1027J12803_1072073722 | 3300000955 | Soil | MKFMFTIYHDPKVMDALPEDEMQALVDSAIEYSEELERSGH |
JGI10216J12902_1123230421 | 3300000956 | Soil | MKFMFTIYHEEKVLDAMPEKEMQALVDSAIEYAEEIRRSGH |
SwM_1028051 | 3300001228 | Switchgrass Rhizosphere | MKFMFTIYHDGKVLAAMADNERQALVDSAIEYAEELQTERSLRRLECSAA |
JGI12053J15887_103786442 | 3300001661 | Forest Soil | MKFLFLIYHDEKTLDTLPDGEMQDLVDSALDYDEKIRQSGHYIV |
JGI12053J15887_105760173 | 3300001661 | Forest Soil | MKFLFMIFHDEKTLDALPKPQMQTLVDSALDYTDELRRSGHFIV |
JGI25382J43887_104123062 | 3300002908 | Grasslands Soil | MKFMFTIYHDENVLDAMPEKEMQALVDSAIEYAEEIRRSGHY |
Ga0062593_1025916592 | 3300004114 | Soil | MQIQEDAMTFLFTIYHDPKVLDAIPENEMQALIDSAIEYAEEI |
Ga0066679_105412633 | 3300005176 | Soil | MKFMFMIYHDENVLDAMPEKEMQSLVDSAIEYAEEIRRSGHYI |
Ga0066690_109610851 | 3300005177 | Soil | MKFMFTIYHDENVLDAMPETEMQALVDSAIEYAEEIRRSGHYIVSDALQRA |
Ga0066678_110615291 | 3300005181 | Soil | MKFMFTIYHDENVLDAMPETEMQALVDSAIEYAEEIRRSGHYIVSDALQR |
Ga0066676_101729351 | 3300005186 | Soil | MKFMFMIYHDQNVLDAMPEKEMQALVDSAIEYAEEIRRSGHYI |
Ga0065707_103496392 | 3300005295 | Switchgrass Rhizosphere | MKFLFMIFHDEGVLDALPKDEMQTLVDSALDYDEEIRQSGHYIVS |
Ga0066388_1035983331 | 3300005332 | Tropical Forest Soil | MRFVFMIHHDEDVLDALPEQELQGLIDSALDYTEGLRRSGHYIA |
Ga0066388_1059618391 | 3300005332 | Tropical Forest Soil | MRFMFTIHHDENVLDALPEREMQALIDSALDYTDDLRRSGHYIVSDALQ |
Ga0070680_1013716451 | 3300005336 | Corn Rhizosphere | MKFMFMIYRDETVLDGLPKDEMQALVDSALDYDDEIRRSGHYI |
Ga0070709_111949792 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MKFVFLIYHEEKTLDALPAKEMQTLVDGALDYDEEIRRSG |
Ga0070705_1001058451 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MKFLFMIYHDETMMDALPKKEMQGLIDSALEYDEEIKKSGHYIVSNALQ |
Ga0070708_1012645231 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MKFVFLIYHDEKTLDALPGKEMQALVDGALDYDEEIRRSG |
Ga0066686_106197061 | 3300005446 | Soil | MKFMFMIYHDENVLDAMPEKEMQPLVDSAIEYAEEIRRSGHYI |
Ga0066689_106163611 | 3300005447 | Soil | MKFMFTIYHDENVLNAMPEKEMQALVDSAIEYAEEIRRSGHYI |
Ga0066689_106447911 | 3300005447 | Soil | MKFMFTIYHDEKVMDAMPEKEMQALVDSAIEYAEEIRRSGHYI |
Ga0066682_107385782 | 3300005450 | Soil | MKFMFVIYHDENVLDAMPEKEMQPLVDSAIEYAEEIRRSGHYIAS |
Ga0070706_1016852242 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MKFVFLIYHEEKTLDALPAKEMQTLVDGALDYDEEIRRSGHYIVSNALQRAR |
Ga0070707_1021278122 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MKFMFTIYHDENVLDAMPENEMQALVDSAIEYAEEIRRSGHYIVS |
Ga0070697_1014016202 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MKFMFTIYHDGNVMAAMADNERQALVDSAIEYAEELQRSGHF |
Ga0066697_103725221 | 3300005540 | Soil | MKFMFTIYHDENVLDAMPEKEMQALVDSAIEYAEELR |
Ga0070696_1005335231 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MKFLFTIYHEEKTLDALSEREMQTLVDSALEYDEEIRRSGHYI |
Ga0070696_1010367071 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MKFLFMIYHDERVLEALPEQEMQALVDSALDYDEEIRRSGHY |
Ga0070704_1004678353 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MKFVFLIYHDETTLDALPGKEMQALVDGALDYDEEIRRSGHYIV |
Ga0070704_1014880982 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MKFMFMIYHDETVLDALPKGEMQALIDSALDYDDEIRETGHYIVSD |
Ga0066695_107136821 | 3300005553 | Soil | MKFMFMIYHDENVLDAMPEKEMQPLVDSAIEYAEEIRRS |
Ga0066707_105273091 | 3300005556 | Soil | MKFMFTIYHDPTVLDAMPEKEMQALVDSAIEYAEE |
Ga0066703_101117693 | 3300005568 | Soil | MRFMFTIYHDEKVMDAMPEKEMQALVDSAIEYAEELRQSGHYI |
Ga0068852_1007719501 | 3300005616 | Corn Rhizosphere | MKFLFMIFHDEGVLDALPKDEMQTLVDSALDYDGEIRQSGHYIVS |
Ga0066905_1001237751 | 3300005713 | Tropical Forest Soil | MKFMFTIYHDENVMDAMPEQERQALIDSAIEYAEEIRR |
Ga0066905_1011175911 | 3300005713 | Tropical Forest Soil | MKFMFMIYHDERDLDAMPKGEMQALVDAALDYTDEIDKSGHRIVSNALQR |
Ga0066903_1009142823 | 3300005764 | Tropical Forest Soil | MKFMFMIYHDENVLDSMPEGELQTLIDSALDYDETIRKSGHYIVSNA |
Ga0066903_1019322111 | 3300005764 | Tropical Forest Soil | MKFLFAIYHEEKMLDELPERQMQTLVDAALDYTEEIRQSGHYI |
Ga0066903_1028619571 | 3300005764 | Tropical Forest Soil | MRFVFMIYHDENVLDALPEGERQALIDSSLDYDDEL |
Ga0068863_1004773122 | 3300005841 | Switchgrass Rhizosphere | MKFMFTIYHDENVLDAMPAKEMQALVDSAIEYAEEIR* |
Ga0068863_1008209961 | 3300005841 | Switchgrass Rhizosphere | MKFLFLIYHDETVMDALPEGEMQTLVDSALDYDEQIRQSGHYIVSNALQ |
Ga0081455_108836962 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MRFMFMIHHEEKVLDAMPEKEMQALVDSAIEFAEEIERTGH |
Ga0075422_103561701 | 3300006196 | Populus Rhizosphere | MKFIFMIYHDESVLEALPDDEMQALVDSALEYDDE |
Ga0068871_1022525852 | 3300006358 | Miscanthus Rhizosphere | MKFVFLIYHDETTLDALPPKEMQTLVDSALDYDETIRRSG |
Ga0079220_100389611 | 3300006806 | Agricultural Soil | MKFLFLIYHEEKVLDTMPPKEMQKLVDSALDYDDEIH |
Ga0079220_109705132 | 3300006806 | Agricultural Soil | MKFLFMIFHDEGTLDSLPKKEMQTLVDSALDYTEELGKSGHYIRR* |
Ga0075430_1013597551 | 3300006846 | Populus Rhizosphere | MKFMFTIYHDENVLNAMPEKEMQALVDSAIEYAEE |
Ga0075433_112200621 | 3300006852 | Populus Rhizosphere | MKFMFTIYHDENVLDAMPEKEMQALVDSAIEYDKEIR* |
Ga0075425_1008470271 | 3300006854 | Populus Rhizosphere | MKFMFTIYHDEKVMDAMPENEMQTLVDSAIEYAEELRRSGHYI |
Ga0075434_1009532901 | 3300006871 | Populus Rhizosphere | MKFMFAINHDEKVLDAMPEKEMQALVDSAIEYAEDL |
Ga0075426_111108002 | 3300006903 | Populus Rhizosphere | MKFMFAINHDEKVLDAMPEKEMQALVDSAIEYAEEIRRSGHYIV |
Ga0075424_1007668691 | 3300006904 | Populus Rhizosphere | MKFMFTIYHDPKVLDAMPEKEMQALVDSAIEYAEEIRQS |
Ga0079219_101339853 | 3300006954 | Agricultural Soil | MKFLFMIYHEEKVLDGMPPEDMQTLVDSALEYDDEIRR |
Ga0099791_105101291 | 3300007255 | Vadose Zone Soil | MKFMFTIYHDEKLLDAMPEQEMQALVDGAIEYAEEIRRSGHYVASDALQRAQTART |
Ga0066710_1002906955 | 3300009012 | Grasslands Soil | MKFMFMIYHDENVLDAMPEKEMQPLVDSAIEYAEEIR |
Ga0066710_1018054073 | 3300009012 | Grasslands Soil | MKFMFMIYHDENVLDAMPEKEMQPLVDSAIEYAEEIRRSGHYIV |
Ga0066710_1041164672 | 3300009012 | Grasslands Soil | MKFLFMIFHDEKTLDALPEPQMQTLVDSALDYMEELRRSGHFIVSNALQRAR |
Ga0066710_1049026332 | 3300009012 | Grasslands Soil | MKFMFMIYHDENVLDAMPEKEMQALVDSAIEYAEE |
Ga0105243_103789551 | 3300009148 | Miscanthus Rhizosphere | MKFMFTIYHDEKVLDAMPEQEMRPLVDSAIEYAEEIR |
Ga0075423_122148211 | 3300009162 | Populus Rhizosphere | MKFMFTIYHHENVLDSMPEKELQALVDSAIEYAEEIRQSGHY |
Ga0105241_125240651 | 3300009174 | Corn Rhizosphere | MKFLFMIFHDEHILDSMPEGEMQTLVDSALGYDDEIRRSGHYIV |
Ga0105248_131080291 | 3300009177 | Switchgrass Rhizosphere | MRPPEARALAQANHEEDPMKFLFLIYHDESVLDALAEGEMQTLVASALDYDEQIRQSGHYIVSN |
Ga0105249_122851391 | 3300009553 | Switchgrass Rhizosphere | MKFMFMIYHDETVLDALPKGEMQALIDSALDYDDEIRETGHYIVS |
Ga0126374_101341963 | 3300009792 | Tropical Forest Soil | MKFLFMIFHDEGTLDAMPKDEMQTLVDAAIDYTDEIEKSGH |
Ga0126374_104776922 | 3300009792 | Tropical Forest Soil | MKFMFTIYHDENVMDAMPEQERQALIDSAIEYAEEI |
Ga0126374_115026041 | 3300009792 | Tropical Forest Soil | MKFMFTIYHDEKVLDAMPENEMRALVDSAIEYADELR |
Ga0105064_11312211 | 3300009821 | Groundwater Sand | VIYHDANVLDEMPEKERQPLVDSAIEYAEEIRRSGHYIVSNA |
Ga0126380_117978081 | 3300010043 | Tropical Forest Soil | MFAIYHDENVLDALSGGEMQALVDAALDYTDGLRRSGHYIASDAL |
Ga0126384_118479991 | 3300010046 | Tropical Forest Soil | MKFLFMIFHDEKTLDELPGKEMQTLVDAALDYTEEIRDSGHYIVSN |
Ga0126382_105749413 | 3300010047 | Tropical Forest Soil | MKFLFMIFHEEATLDALPEKEMQTLVDSALDYDEEIRES |
Ga0127457_10681761 | 3300010081 | Grasslands Soil | MKFMFMIYHDENVLNALPEGELQTLIDSALDYDETIRRSGHYIVSDALQRS |
Ga0134084_101283183 | 3300010322 | Grasslands Soil | MKFMFTIYHDEKVMEAMPEKEKQALVDSAIEYAEEIRSSGHYI |
Ga0134063_103403742 | 3300010335 | Grasslands Soil | MKFMFTIYHEENVLDAMPEKEMQALVDSAIEYAEEIRRSGHY |
Ga0126376_104789461 | 3300010359 | Tropical Forest Soil | MKFMFVIYHDEKVLDAMPEKDMQALVDSAIEYAEELRR |
Ga0126376_106210561 | 3300010359 | Tropical Forest Soil | VRRIAMKFMFTIYHDPKVMDALPEKEMQALVDSAIEYSEEL |
Ga0126376_112571753 | 3300010359 | Tropical Forest Soil | MRFMFMIYHDEREMDVLPKEEMQTLIDSALEYDEKIKQSGHYIVSDALQSSRTS |
Ga0126377_109765021 | 3300010362 | Tropical Forest Soil | MMKFMFMIYHDENQLEAMPEVEKQTLIDSALDYDEEIRRSGHYI |
Ga0126377_127244571 | 3300010362 | Tropical Forest Soil | MKFMFTIHHDPKVMDAMPEKEMQALVDSAIEYAEEL |
Ga0126379_136292261 | 3300010366 | Tropical Forest Soil | MKFLFMIFHDEGTLDAMPMDEMQTLVDAAIDYTDEIEKSGHYIVSNALQRA |
Ga0126381_1045464071 | 3300010376 | Tropical Forest Soil | MKFLFMIFHDEGTLDAMPKDEMQTLVDAAIDYTDEIEKSGHYIVSNALQR |
Ga0134124_120855471 | 3300010397 | Terrestrial Soil | VQASHEEDAMKFLFLIYHDETVMDALPEGEMQTLIDSALDYDEEIRQSGHYIVSNA |
Ga0126383_105412202 | 3300010398 | Tropical Forest Soil | MKFMVTIFHDENVLDAMPEKEMQALVDSAIEYAEELRR |
Ga0126383_121611211 | 3300010398 | Tropical Forest Soil | MKFMFTIHHDEKVLDAMPEKEMQALVDSAIEYAEE |
Ga0134127_114996652 | 3300010399 | Terrestrial Soil | MKFMFTIYHDEQVLDAMPEKEMQALVDSAIEYAEEIRRS |
Ga0134122_107521953 | 3300010400 | Terrestrial Soil | MKFLFMIFHDENILDSMPEGEMQTLVDSALGYDDEIRRSGHY |
Ga0134121_131273051 | 3300010401 | Terrestrial Soil | MKFMFMIYHDETVLDALPKGEMQALIDSALDYDDEIRETGHYIVSDALQSSRTARTIR |
Ga0137399_116653931 | 3300012203 | Vadose Zone Soil | MKFLFLIYHDEKTLDTLPDGEMQDLVDSALDYDEKIRQSGHY |
Ga0137362_111529201 | 3300012205 | Vadose Zone Soil | MKFMFMIYHDEDELDALPEGEMQALVDSALDYDAEIRRSGHYIVS |
Ga0137361_111078383 | 3300012362 | Vadose Zone Soil | MKFMFMIYHDENVLNALPEEEMQALIDSALDYDETIRQS |
Ga0137358_102572813 | 3300012582 | Vadose Zone Soil | MKFMFLIYHDENVLHALPEKEMQALIDSALDYDEE |
Ga0137358_105985463 | 3300012582 | Vadose Zone Soil | MKFMFMIYHDESVLDAMPDKEMQALVDSAIEYAEEIRRSGHYIVSDALQR |
Ga0137397_103660391 | 3300012685 | Vadose Zone Soil | MRFMFMIYHDENVLDAMPEKELQALVDSAIEYAEEIRGSGHYI |
Ga0157281_11108473 | 3300012883 | Soil | MKFLFTIFHDEQTLDDMPEPEMQALVDAALDYDEEIR |
Ga0157306_100073254 | 3300012912 | Soil | VQASHEEDAMKFLFLIYHDETVLDALPKGEMQALVDSALEYDEEIRQSGHYIVSN |
Ga0137396_110730071 | 3300012918 | Vadose Zone Soil | MKFMFTIYHDENVLDAMPEKEMQALVDSAIEYAEEIRRSGHYIVSD |
Ga0137394_111589911 | 3300012922 | Vadose Zone Soil | MKFLFMIFHDEKTLDGLPEPQMQTLVDSALDYMEELRRSGHFIVSNALQRARTART |
Ga0137359_109088621 | 3300012923 | Vadose Zone Soil | MKFMFMIYHDENVLDAMPEKEMQALVDSAIEYAEEIRRSGHYIVSD |
Ga0137419_115750792 | 3300012925 | Vadose Zone Soil | MKFMFMIHHDQQVMDAMPEKEMQALVDSAIEYAEEI |
Ga0153915_107600674 | 3300012931 | Freshwater Wetlands | MKFLFLIYHDEKILDALPEKEMQALVDGALDYDEEIRRSGHYIVSN |
Ga0137410_113524561 | 3300012944 | Vadose Zone Soil | MKFLFMIFHDEKTLDALPEPQMQTLVDSALDYMEELRRSGHFIVSNA |
Ga0126375_116086602 | 3300012948 | Tropical Forest Soil | MKFMFTIYHDEKVLDEMPEKEMQTLVDSAIEYAEEIRRSGHYIL |
Ga0126369_112373262 | 3300012971 | Tropical Forest Soil | MKFMFMIFHDEKTLDELPGKEMQTLVDAALDYTEEIRESGHYI |
Ga0134077_102965723 | 3300012972 | Grasslands Soil | MKFMFTIYHDENVLNAMPEKEMQALVDSAIEYAEEIRRSGH |
Ga0134087_106800682 | 3300012977 | Grasslands Soil | MKFMFTIYHDENVLDAMPEKERQALVDSAIEYAEEIRQSG |
Ga0157373_110955201 | 3300013100 | Corn Rhizosphere | MKFMFTIYHDEHVLDAMPEQEMRPLVDSAIEYAEELRQSGHYIA |
Ga0157378_124556281 | 3300013297 | Miscanthus Rhizosphere | MKFMFMIYHDETVLDALPKGEMQALIDSALDYDDEIRETGHYIVSDALQSSRTARTI |
Ga0134075_100423591 | 3300014154 | Grasslands Soil | MKFMFMIYHDENVLDAMPEKEMQPLVDSAIEYAEE |
Ga0134078_100514332 | 3300014157 | Grasslands Soil | MKFMFMIYHDENVLDAMPEKEMQPLVDSAIEYAEEIRRSGHYIA |
Ga0075354_10440781 | 3300014308 | Natural And Restored Wetlands | MKFLFLIYHDEQTLDALADAEMRTLVDGALDYDEE |
Ga0137405_12260093 | 3300015053 | Vadose Zone Soil | MKFLFLIYHDEKTLDTLPDGEMQDLVDSALDYDEKIRQSG |
Ga0132258_121196522 | 3300015371 | Arabidopsis Rhizosphere | MKFMFTIYHDENVLDAMPEKEMRALVDSAIEYAEEIR* |
Ga0132258_121657852 | 3300015371 | Arabidopsis Rhizosphere | MKFMFTIYHDENVLDAMPEQEMQALVDSAIECAEEIR* |
Ga0132257_1000093795 | 3300015373 | Arabidopsis Rhizosphere | MKFMFTIYHDENVLDAMPEKEMQALVDSAIEYAEEIR* |
Ga0134112_102029021 | 3300017656 | Grasslands Soil | MKFMFMIYHDENVLDAMSEKEMQPLVDSAIEYAEEIRRSGHYIAS |
Ga0134074_11356441 | 3300017657 | Grasslands Soil | MKFMFTIYHDENVLDAMPEKEMQALVDSAIEYAEE |
Ga0187788_101715341 | 3300018032 | Tropical Peatland | MKFMFTIYHDERMMEAMPQQEMQGLVDSALEYVDEIK |
Ga0193725_11245311 | 3300019883 | Soil | MKFLFMIFHDENILDSMPEGEMRTLVDSALGYDDEIRRSGH |
Ga0126371_103425232 | 3300021560 | Tropical Forest Soil | MKFMFTIYHDENVLDAMPEKERQALVDSAIEYAEEIRR |
Ga0126371_120515981 | 3300021560 | Tropical Forest Soil | MKFMFTIYHDEHVMDAMPEQERQALIDSAIEYAEEIRRGGHYVA |
Ga0209519_101695894 | 3300025318 | Soil | MRFMFMIYHDETVLDALPEAEMQALVDSALDYDEEIRLSG |
Ga0210094_10784362 | 3300025549 | Natural And Restored Wetlands | MKFMFVICHDEKVLDAMPEKESQAVVDSAIEYAEEIRRSGHFIVSNAL |
Ga0207682_106187482 | 3300025893 | Miscanthus Rhizosphere | MKFMFTIYHDGNVMAAMADNERQALVDSAIEYAEEL |
Ga0207693_103881551 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MKFVFLIYHDEKTLDALPGKEMQALVDGALDYDEEIRRSGHY |
Ga0207646_114910922 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MKFLFMIYHDEKTLDDMPEEEMQTLVDSALDYMEEIRRS |
Ga0207704_111207191 | 3300025938 | Miscanthus Rhizosphere | MKFMFTIYHDEHVLDAMPEQEMRPLVDSAIEYAEELRQSGH |
Ga0207704_112963281 | 3300025938 | Miscanthus Rhizosphere | MRFMFMIHHDEDELRALPADEMRELVDGALEYTDELRRTGHYIVSDALQFSPTARTIRVR |
Ga0207711_119360771 | 3300025941 | Switchgrass Rhizosphere | MKFMFTIYHDEHVLDAMPEQEMRPLVDSAIEYAEELRQSGHY |
Ga0207689_100176741 | 3300025942 | Miscanthus Rhizosphere | MKFLFMIFHDENILDSMPEGEMQTLVDSALGYDDEIR |
Ga0208286_10218612 | 3300026015 | Rice Paddy Soil | MKFLFLIYHDEQILDALPGKEMQALVDGALDYDEEIRRSGH |
Ga0207648_103388104 | 3300026089 | Miscanthus Rhizosphere | MKFLFMIFHDENILDSMPEGEMQTLVDSALGYDDEIRRSGGIFA |
Ga0208914_10483971 | 3300026102 | Natural And Restored Wetlands | MKFMFVICHDEKVLDAMPEKESQAVVDSAIEYAEEIRRSGHFIVSN |
Ga0207674_105790531 | 3300026116 | Corn Rhizosphere | MKFLFLIYHDEKVLDALPEGEMQTLIDSALDYDEEIRQSGHYIVS |
Ga0207674_111237811 | 3300026116 | Corn Rhizosphere | VKFMFMIYHDERDLEALPRGEMQALVNSALDYDDEIRRSGHYI |
Ga0209239_12390703 | 3300026310 | Grasslands Soil | MKFMFMIYHDENVLDAMPEKEMQPLVDSAIEYAEEIRRSG |
Ga0209761_10800161 | 3300026313 | Grasslands Soil | MKFMFMIYHDENMLEALPKMEMQTLIDSALDYDDEIRRSGHYIVS |
Ga0209802_10790293 | 3300026328 | Soil | MRFMFTIYHDEKVMDAMPEKEMQALVDSAIEYAEEL |
Ga0209803_12546671 | 3300026332 | Soil | MKFMFMIYHDENVLDAMPEKEMQPLVDSAIEYAEEI |
Ga0257156_10269192 | 3300026498 | Soil | MKFMFTIYHDENVLNAMPEKEMLALVDSAIEYAEEIR |
Ga0209799_11462732 | 3300027654 | Tropical Forest Soil | MKFMFMIYHDENQLETLPEGEVQTLIDSALDYDDEIRK |
Ga0209465_100842311 | 3300027874 | Tropical Forest Soil | MKFMFTIYHDENVMDAMPEQERQALIDSAIEYAEEIRRSGH |
Ga0268265_100574186 | 3300028380 | Switchgrass Rhizosphere | MKFLFLIYHEEKVLDTMPPKEMQKLVDSALDYDDEIRGSGH |
Ga0268264_107373771 | 3300028381 | Switchgrass Rhizosphere | MKFMFMIYHDETVLDALPKGEMQALIDSALDYDDEIRETGH |
Ga0247824_104187263 | 3300028809 | Soil | MKFLFMIFHDENILDSMPEGEMQTLVDSALGYDDEIRRSGHYI |
Ga0247826_103840393 | 3300030336 | Soil | MKFLFLIYHEEKVLDAMPPEEMQKLVDSALDYDDEIRGS |
Ga0307497_103849292 | 3300031226 | Soil | MKFMFMIYHDENVLDALPEGEMQALIDSALDYDDEIRQSGHYIV |
Ga0170824_1236865521 | 3300031231 | Forest Soil | MKFMFTIYHDENVLDAMPEKEMQALVDSAIEYAEEIR |
Ga0170824_1239188502 | 3300031231 | Forest Soil | MKFLFMIFHDEGVLDALPKGEMQTLVDSALDYDEEIRQSGHYIVSNAL |
Ga0170820_143739043 | 3300031446 | Forest Soil | MKFLFMIFHDEGVLDALPKGEMQTLVDSALDYDEE |
Ga0170818_1085826911 | 3300031474 | Forest Soil | MKFLFMIFHDEGVLDALPKGEMQTLVDSALDYDEEIRQSGHYIVSNALQRARSA |
Ga0318528_102742401 | 3300031561 | Soil | MRFLFTIHHDEHELDALPEGERQALIDAALDYTDELRR |
Ga0318542_104948371 | 3300031668 | Soil | MKFMFTIHHDPKVMDAMPEKEMQALVDSAIEYAEEIRQSGHYIVSNAL |
Ga0318561_102949992 | 3300031679 | Soil | MKFMFTIHHDPKVMDAMPEKEMQALVDSAIEYAEELRQSGHYIA |
Ga0318560_107393102 | 3300031682 | Soil | MKFMFTIHHDPKVMDAMPEKEMQALVDSAIEYAEEIRQSGH |
Ga0318560_107830802 | 3300031682 | Soil | MRFMFMIYHDEREMEALPKEEMQTLIDSALEYDEKIKQSGHYIVSDALQSSRT |
Ga0307469_106961042 | 3300031720 | Hardwood Forest Soil | MKFMFTIYHDEHVLDAMPEKDRQALVDGAIEYAEEIRRSGH |
Ga0318501_100415321 | 3300031736 | Soil | MKFMFMIFHDEKTLDELPGKEMQTLVDADLLGVIE |
Ga0307468_1024154391 | 3300031740 | Hardwood Forest Soil | MKFMFVIYHDENVLDAMPETEMQDLVDSAIEYAEEIRRSGHYVASD |
Ga0318502_101371581 | 3300031747 | Soil | MKFMFMIFHDEKTLDELPGKEMQTLVDAALDYTEEIRES |
Ga0307475_104244571 | 3300031754 | Hardwood Forest Soil | MKFMFVIYHDEQTLDALPAGEMQTLVDSALDYTEEIRRS |
Ga0318535_104449232 | 3300031764 | Soil | MKFMFMIYHDERDLDALPKGEMQALVDAALDYTDEIDRSGHRI |
Ga0318547_104925092 | 3300031781 | Soil | MKFMFTIHHDPKVMDAMPEKEMQALVDSAIEYAEEIRQSGHY |
Ga0307473_100121271 | 3300031820 | Hardwood Forest Soil | MKFMFIIFHDEKTLDALPEPEKQTLVDSALDYMDDLRRSGHFIVSNALQRG |
Ga0318567_106878261 | 3300031821 | Soil | MKFLFMIYHDENQLEAMPEGEKQTLIDSALDYDDEIRRSGHYIVSD |
Ga0318551_106306942 | 3300031896 | Soil | MKFLFMIYHDENQLEAMPEGEKQTLIDSALDYDDEIRRSGHY |
Ga0310916_112123641 | 3300031942 | Soil | MRFMFMIYHDEREMEALPKEEMQTLIDSALEYDEKIKQSGHYI |
Ga0310910_100346201 | 3300031946 | Soil | MKFMFMIFHDEKTLDELPGKEMQTLVDAALDYTEE |
Ga0310906_104428401 | 3300032013 | Soil | MKFMFMIYHDENVLDALPEGEMQALIDSALDYDEE |
Ga0318524_107443882 | 3300032067 | Soil | MKFMFMIFHDEKTLDELPGKEMQTLVDAALDYTEEIRESGHYIV |
Ga0318524_107913311 | 3300032067 | Soil | MKFMFTIHHDPKVMDAMPEKEMQALVDSAIEYAEEIRQSGHYIVSN |
Ga0318540_105659081 | 3300032094 | Soil | MRFMFMIYHDEREMEALPKEEMQTLIDSALEYDEKIKQSGHYIVS |
Ga0307470_100722282 | 3300032174 | Hardwood Forest Soil | MKFMFTIYHDENVLDAMPEKEMRALVDSAIEYAEEIR |
Ga0307471_1001216455 | 3300032180 | Hardwood Forest Soil | MKFVFLIYHEEKTLDALPAKEMQTLVDGALDYDEE |
Ga0307471_1004312261 | 3300032180 | Hardwood Forest Soil | MKFMFMIYHDENVLDSLPEGELQTLIDSALDYDETIRKSGHYIVSDA |
Ga0307471_1005331461 | 3300032180 | Hardwood Forest Soil | MKFVFLIYHDEKTLEALPGKEMQALVDGALDYDEEIRRSGHYIVSN |
Ga0307471_1010928181 | 3300032180 | Hardwood Forest Soil | MKFMFMIYHDENVLNAMPEREMQALVDSAIEYAEE |
Ga0307471_1014154422 | 3300032180 | Hardwood Forest Soil | MKFLFTIYHDEKALEALPEGEMQALVDSALDYMEEIRKSGHYHRPRS |
Ga0307471_1031713211 | 3300032180 | Hardwood Forest Soil | MKFLFMIYHEEKMLDAVPEGEMQTLVDGALDYSEEIRRSGHYIVSNALQRART |
Ga0326729_10119194 | 3300033432 | Peat Soil | MKFLFLIYHDERTLDALPEGEMQALVDSALDYDEEIRQS |
Ga0314782_186537_390_530 | 3300034661 | Soil | MKFMFMIYHDENVLDALPTGEMQALIDSALDYDDEIRQSGHYIVSDA |
⦗Top⦘ |