| Basic Information | |
|---|---|
| Family ID | F031890 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 181 |
| Average Sequence Length | 44 residues |
| Representative Sequence | VILVDTHVVVWLAFDQDQLSRKARAAIDDARKNGDGLAISDITL |
| Number of Associated Samples | 162 |
| Number of Associated Scaffolds | 181 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 84.53 % |
| % of genes near scaffold ends (potentially truncated) | 95.58 % |
| % of genes from short scaffolds (< 2000 bps) | 88.40 % |
| Associated GOLD sequencing projects | 154 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.895 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (13.812 % of family members) |
| Environment Ontology (ENVO) | Unclassified (20.442 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.276 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 22.22% β-sheet: 2.78% Coil/Unstructured: 75.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 181 Family Scaffolds |
|---|---|---|
| PF02604 | PhdYeFM_antitox | 76.24 |
| PF00005 | ABC_tran | 1.66 |
| PF14833 | NAD_binding_11 | 1.10 |
| PF00970 | FAD_binding_6 | 1.10 |
| PF01850 | PIN | 1.10 |
| PF09137 | Glucodextran_N | 0.55 |
| PF00132 | Hexapep | 0.55 |
| PF02369 | Big_1 | 0.55 |
| PF03738 | GSP_synth | 0.55 |
| PF05592 | Bac_rhamnosid | 0.55 |
| PF08534 | Redoxin | 0.55 |
| PF07676 | PD40 | 0.55 |
| PF13358 | DDE_3 | 0.55 |
| PF12704 | MacB_PCD | 0.55 |
| PF03972 | MmgE_PrpD | 0.55 |
| PF03988 | DUF347 | 0.55 |
| PF01902 | Diphthami_syn_2 | 0.55 |
| PF04545 | Sigma70_r4 | 0.55 |
| PF02368 | Big_2 | 0.55 |
| PF12796 | Ank_2 | 0.55 |
| PF01402 | RHH_1 | 0.55 |
| PF05015 | HigB-like_toxin | 0.55 |
| PF13646 | HEAT_2 | 0.55 |
| PF05729 | NACHT | 0.55 |
| PF08546 | ApbA_C | 0.55 |
| PF01523 | PmbA_TldD | 0.55 |
| PF13635 | DUF4143 | 0.55 |
| PF00196 | GerE | 0.55 |
| PF01063 | Aminotran_4 | 0.55 |
| PF09957 | VapB_antitoxin | 0.55 |
| PF00072 | Response_reg | 0.55 |
| COG ID | Name | Functional Category | % Frequency in 181 Family Scaffolds |
|---|---|---|---|
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 76.24 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 76.24 |
| COG0115 | Branched-chain amino acid aminotransferase/4-amino-4-deoxychorismate lyase | Amino acid transport and metabolism [E] | 1.10 |
| COG0312 | Zn-dependent protease PmbA/TldA or its inactivated homolog | General function prediction only [R] | 0.55 |
| COG0754 | Glutathionylspermidine synthase, CHAP domain | Amino acid transport and metabolism [E] | 0.55 |
| COG1893 | Ketopantoate reductase | Coenzyme transport and metabolism [H] | 0.55 |
| COG2079 | 2-methylcitrate dehydratase PrpD | Carbohydrate transport and metabolism [G] | 0.55 |
| COG2102 | Diphthamide synthase (EF-2-diphthine--ammonia ligase) | Translation, ribosomal structure and biogenesis [J] | 0.55 |
| COG3387 | Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 family | Carbohydrate transport and metabolism [G] | 0.55 |
| COG3408 | Glycogen debranching enzyme (alpha-1,6-glucosidase) | Carbohydrate transport and metabolism [G] | 0.55 |
| COG3549 | Plasmid maintenance system killer protein | Defense mechanisms [V] | 0.55 |
| COG4705 | Uncharacterized membrane-anchored protein | Function unknown [S] | 0.55 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.90 % |
| Unclassified | root | N/A | 1.10 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001471|JGI12712J15308_10157729 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300001593|JGI12635J15846_10009690 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 8173 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100063035 | All Organisms → cellular organisms → Bacteria | 3403 | Open in IMG/M |
| 3300003369|JGI24140J50213_10178148 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300005172|Ga0066683_10336821 | All Organisms → cellular organisms → Bacteria | 937 | Open in IMG/M |
| 3300005178|Ga0066688_10590303 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 714 | Open in IMG/M |
| 3300005451|Ga0066681_10924417 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300005467|Ga0070706_100499754 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1131 | Open in IMG/M |
| 3300005468|Ga0070707_101767541 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 585 | Open in IMG/M |
| 3300005529|Ga0070741_11636509 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300005534|Ga0070735_10284308 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 999 | Open in IMG/M |
| 3300005541|Ga0070733_11096590 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300005556|Ga0066707_10856831 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300005576|Ga0066708_10019737 | All Organisms → cellular organisms → Bacteria | 3421 | Open in IMG/M |
| 3300005586|Ga0066691_10463054 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 758 | Open in IMG/M |
| 3300005591|Ga0070761_10950390 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 544 | Open in IMG/M |
| 3300005712|Ga0070764_10673321 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300006059|Ga0075017_100631455 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
| 3300006354|Ga0075021_10075070 | All Organisms → cellular organisms → Bacteria | 1982 | Open in IMG/M |
| 3300006806|Ga0079220_11113882 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 641 | Open in IMG/M |
| 3300006871|Ga0075434_100660870 | All Organisms → cellular organisms → Bacteria | 1063 | Open in IMG/M |
| 3300007076|Ga0075435_100421327 | All Organisms → cellular organisms → Bacteria | 1150 | Open in IMG/M |
| 3300009012|Ga0066710_101958954 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 872 | Open in IMG/M |
| 3300009524|Ga0116225_1297441 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300009548|Ga0116107_1193343 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300009616|Ga0116111_1110726 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300009624|Ga0116105_1158979 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 603 | Open in IMG/M |
| 3300009760|Ga0116131_1007736 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 4542 | Open in IMG/M |
| 3300009764|Ga0116134_1095191 | All Organisms → cellular organisms → Bacteria | 1083 | Open in IMG/M |
| 3300009764|Ga0116134_1305438 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300010043|Ga0126380_10873280 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300010048|Ga0126373_12814821 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300010303|Ga0134082_10353146 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300010320|Ga0134109_10443277 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300010320|Ga0134109_10494255 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300010335|Ga0134063_10196704 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
| 3300010341|Ga0074045_10076127 | All Organisms → cellular organisms → Bacteria | 2358 | Open in IMG/M |
| 3300010358|Ga0126370_11777099 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300010360|Ga0126372_13263731 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300010379|Ga0136449_103400869 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300010398|Ga0126383_13274466 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300011269|Ga0137392_10163455 | All Organisms → cellular organisms → Bacteria | 1804 | Open in IMG/M |
| 3300011270|Ga0137391_10104845 | All Organisms → cellular organisms → Bacteria | 2450 | Open in IMG/M |
| 3300011270|Ga0137391_10803414 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 775 | Open in IMG/M |
| 3300011270|Ga0137391_10917571 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300012096|Ga0137389_10022649 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4443 | Open in IMG/M |
| 3300012189|Ga0137388_10055707 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 3229 | Open in IMG/M |
| 3300012200|Ga0137382_11072132 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300012202|Ga0137363_10753531 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
| 3300012206|Ga0137380_11305831 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 610 | Open in IMG/M |
| 3300012357|Ga0137384_11258416 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300012361|Ga0137360_11890616 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300012362|Ga0137361_11272491 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300012582|Ga0137358_10405578 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 922 | Open in IMG/M |
| 3300012685|Ga0137397_10762481 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 718 | Open in IMG/M |
| 3300012923|Ga0137359_11261123 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300012927|Ga0137416_10434337 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1119 | Open in IMG/M |
| 3300012930|Ga0137407_10241776 | All Organisms → cellular organisms → Bacteria | 1633 | Open in IMG/M |
| 3300012944|Ga0137410_10959817 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300012971|Ga0126369_11481245 | Not Available | 768 | Open in IMG/M |
| 3300013308|Ga0157375_13478564 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300014150|Ga0134081_10359313 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300014490|Ga0182010_10007145 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5146 | Open in IMG/M |
| 3300014501|Ga0182024_10654988 | All Organisms → cellular organisms → Bacteria | 1304 | Open in IMG/M |
| 3300014745|Ga0157377_10568442 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 804 | Open in IMG/M |
| 3300014839|Ga0182027_11443545 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300016341|Ga0182035_10490996 | All Organisms → cellular organisms → Bacteria | 1047 | Open in IMG/M |
| 3300017928|Ga0187806_1381470 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300017929|Ga0187849_1045769 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2087 | Open in IMG/M |
| 3300017933|Ga0187801_10069348 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1303 | Open in IMG/M |
| 3300017933|Ga0187801_10495946 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300017937|Ga0187809_10070085 | All Organisms → cellular organisms → Bacteria | 1148 | Open in IMG/M |
| 3300017938|Ga0187854_10354220 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300017943|Ga0187819_10375208 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 820 | Open in IMG/M |
| 3300017948|Ga0187847_10037149 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2856 | Open in IMG/M |
| 3300017955|Ga0187817_10593734 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300017955|Ga0187817_11139750 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300017959|Ga0187779_11029614 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300017961|Ga0187778_10188576 | All Organisms → cellular organisms → Bacteria | 1311 | Open in IMG/M |
| 3300017973|Ga0187780_10197097 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1403 | Open in IMG/M |
| 3300017994|Ga0187822_10358121 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300017995|Ga0187816_10084234 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1355 | Open in IMG/M |
| 3300017995|Ga0187816_10414450 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300017996|Ga0187891_1139118 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
| 3300017999|Ga0187767_10148863 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300017999|Ga0187767_10162689 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300018006|Ga0187804_10023706 | All Organisms → cellular organisms → Bacteria | 2260 | Open in IMG/M |
| 3300018006|Ga0187804_10182106 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
| 3300018007|Ga0187805_10011493 | All Organisms → cellular organisms → Bacteria | 3740 | Open in IMG/M |
| 3300018012|Ga0187810_10114984 | All Organisms → cellular organisms → Bacteria | 1064 | Open in IMG/M |
| 3300018012|Ga0187810_10466681 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300018016|Ga0187880_1490318 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300018026|Ga0187857_10034367 | All Organisms → cellular organisms → Bacteria | 2697 | Open in IMG/M |
| 3300018034|Ga0187863_10572404 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300018086|Ga0187769_10340735 | All Organisms → cellular organisms → Bacteria | 1124 | Open in IMG/M |
| 3300018089|Ga0187774_10676325 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300018090|Ga0187770_10267534 | All Organisms → cellular organisms → Bacteria | 1326 | Open in IMG/M |
| 3300018090|Ga0187770_10935964 | Not Available | 696 | Open in IMG/M |
| 3300018090|Ga0187770_10979505 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300018433|Ga0066667_11724363 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 563 | Open in IMG/M |
| 3300018468|Ga0066662_12842924 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
| 3300020034|Ga0193753_10437563 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
| 3300020150|Ga0187768_1040414 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1028 | Open in IMG/M |
| 3300020580|Ga0210403_10947401 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300020581|Ga0210399_10219081 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1585 | Open in IMG/M |
| 3300020581|Ga0210399_10410882 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1129 | Open in IMG/M |
| 3300020582|Ga0210395_11230462 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300020583|Ga0210401_10032492 | All Organisms → cellular organisms → Bacteria | 4970 | Open in IMG/M |
| 3300021046|Ga0215015_10640598 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300021088|Ga0210404_10718836 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300021168|Ga0210406_10226730 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1541 | Open in IMG/M |
| 3300021171|Ga0210405_10306110 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1256 | Open in IMG/M |
| 3300021171|Ga0210405_11335478 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300021178|Ga0210408_11128335 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300021181|Ga0210388_10542860 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1019 | Open in IMG/M |
| 3300021402|Ga0210385_11044152 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300021404|Ga0210389_11172813 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300021406|Ga0210386_11521313 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300021420|Ga0210394_10022339 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 5822 | Open in IMG/M |
| 3300021474|Ga0210390_10296697 | All Organisms → cellular organisms → Bacteria | 1369 | Open in IMG/M |
| 3300021474|Ga0210390_11195279 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300021476|Ga0187846_10038636 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2137 | Open in IMG/M |
| 3300021559|Ga0210409_10621525 | All Organisms → cellular organisms → Bacteria | 949 | Open in IMG/M |
| 3300021559|Ga0210409_10739476 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
| 3300023090|Ga0224558_1054808 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1599 | Open in IMG/M |
| 3300023090|Ga0224558_1105664 | All Organisms → cellular organisms → Bacteria | 975 | Open in IMG/M |
| 3300023259|Ga0224551_1085979 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300025472|Ga0208692_1078198 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300025500|Ga0208686_1078902 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 723 | Open in IMG/M |
| 3300025576|Ga0208820_1079597 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
| 3300025906|Ga0207699_11352679 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300025922|Ga0207646_10940747 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 765 | Open in IMG/M |
| 3300026309|Ga0209055_1212058 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 592 | Open in IMG/M |
| 3300026330|Ga0209473_1256566 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300026557|Ga0179587_10528129 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300027069|Ga0208859_1036847 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300027109|Ga0208603_1002008 | All Organisms → cellular organisms → Bacteria | 3390 | Open in IMG/M |
| 3300027591|Ga0209733_1084347 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 814 | Open in IMG/M |
| 3300027625|Ga0208044_1058470 | All Organisms → cellular organisms → Bacteria | 1209 | Open in IMG/M |
| 3300027655|Ga0209388_1111544 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300027678|Ga0209011_1015166 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2540 | Open in IMG/M |
| 3300027696|Ga0208696_1021746 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2408 | Open in IMG/M |
| 3300027701|Ga0209447_10007427 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Silvibacterium → Silvibacterium bohemicum | 3234 | Open in IMG/M |
| 3300027703|Ga0207862_1253768 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300027783|Ga0209448_10118372 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 887 | Open in IMG/M |
| 3300027846|Ga0209180_10553192 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300027857|Ga0209166_10527732 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 605 | Open in IMG/M |
| 3300027894|Ga0209068_10129993 | All Organisms → cellular organisms → Bacteria | 1350 | Open in IMG/M |
| 3300027908|Ga0209006_10842996 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300028906|Ga0308309_10953893 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 744 | Open in IMG/M |
| 3300029943|Ga0311340_11222231 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300030007|Ga0311338_11182301 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
| 3300030848|Ga0075388_11396608 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300030855|Ga0075374_10841060 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300030862|Ga0265753_1024752 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 927 | Open in IMG/M |
| 3300031090|Ga0265760_10169885 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 724 | Open in IMG/M |
| 3300031226|Ga0307497_10240418 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 804 | Open in IMG/M |
| 3300031231|Ga0170824_105004769 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300031234|Ga0302325_10963503 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1172 | Open in IMG/M |
| 3300031446|Ga0170820_15314784 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300031474|Ga0170818_102807077 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300031525|Ga0302326_11236426 | All Organisms → cellular organisms → Bacteria | 1024 | Open in IMG/M |
| 3300031561|Ga0318528_10183815 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1117 | Open in IMG/M |
| 3300031708|Ga0310686_112026950 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300031753|Ga0307477_10189186 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1433 | Open in IMG/M |
| 3300031823|Ga0307478_10462079 | All Organisms → cellular organisms → Bacteria | 1056 | Open in IMG/M |
| 3300031910|Ga0306923_12118207 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300031942|Ga0310916_10929211 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300031954|Ga0306926_11059822 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
| 3300031962|Ga0307479_11484222 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 635 | Open in IMG/M |
| 3300031962|Ga0307479_12035819 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300032035|Ga0310911_10578921 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300032041|Ga0318549_10429725 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300032160|Ga0311301_12387022 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300032261|Ga0306920_102127603 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300032261|Ga0306920_102702479 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300032783|Ga0335079_11332763 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 715 | Open in IMG/M |
| 3300032892|Ga0335081_11614627 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 711 | Open in IMG/M |
| 3300033405|Ga0326727_11115376 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300033433|Ga0326726_11252581 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 722 | Open in IMG/M |
| 3300034091|Ga0326724_0190878 | All Organisms → cellular organisms → Bacteria | 1225 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.81% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.60% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 8.29% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 6.08% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 4.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.42% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.42% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 3.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.31% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.31% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.76% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.76% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.21% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.21% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.21% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.21% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.66% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.66% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.66% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.66% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.66% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.66% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.10% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.10% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 1.10% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.10% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.10% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.55% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.55% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.55% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.55% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.55% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.55% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003369 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 002-22A | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009548 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100 | Environmental | Open in IMG/M |
| 3300009616 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 | Environmental | Open in IMG/M |
| 3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
| 3300009760 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_100 | Environmental | Open in IMG/M |
| 3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014490 | Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014839 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017929 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300017996 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_40 | Environmental | Open in IMG/M |
| 3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018016 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40 | Environmental | Open in IMG/M |
| 3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300020034 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c2 | Environmental | Open in IMG/M |
| 3300020150 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_20_MG | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300023090 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 20-24 | Environmental | Open in IMG/M |
| 3300023259 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 20-24 | Environmental | Open in IMG/M |
| 3300025472 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025500 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025576 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027069 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF002 (SPAdes) | Environmental | Open in IMG/M |
| 3300027109 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF008 (SPAdes) | Environmental | Open in IMG/M |
| 3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027625 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027696 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027701 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027703 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030848 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA8 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030855 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA9 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030862 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300034091 | Peat soil microbial communities from McLean, Ithaca, NY, United States - MB00N | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12712J15308_101577292 | 3300001471 | Forest Soil | VILVDTHVVVWLAFDEDQISRKARSAIDVARKNADGLAISDITLL |
| JGI12635J15846_100096901 | 3300001593 | Forest Soil | VILVDTHVVVWLAFDQDQLSRKARAAIDDARKNGDGLAISD |
| JGIcombinedJ26739_1000630356 | 3300002245 | Forest Soil | MGRAEVILVGTHVVVWLAFDQDRLSKKARAAIDDARQ |
| JGI24140J50213_101781481 | 3300003369 | Arctic Peat Soil | VGGTEVILVDTHVVIWLAFDQRQLSKNAKAAINEARQNGEGL |
| Ga0066683_103368213 | 3300005172 | Soil | MGQPEVILLDTHVVLWLAFDQTKLSGKARTAIDEARRSGEGLAISDI |
| Ga0066688_105903033 | 3300005178 | Soil | VILVDTHVVVWLAFDQDQISRKARAAIDNARRNGDGLAISD |
| Ga0066681_109244172 | 3300005451 | Soil | VILVDTHVVVWLALDQTHLSKNARAAIDDARQNGDGLAISDITLLELATLSSK |
| Ga0070706_1004997541 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | VEAAQVILVDTHVVVWVAGDPQKLSSKARAAIDQELRAGQALAISC |
| Ga0070707_1017675411 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | VILVDTHVVVWLALDQTHLSKNARAAIDDARRNGDGLAISDITLLELATLHHQAVAR* |
| Ga0070741_116365091 | 3300005529 | Surface Soil | VILLDTHVVAWLAFDRDQISRKARTAIDAARKNADGLAICDI |
| Ga0070735_102843081 | 3300005534 | Surface Soil | VILVDTHVVVWIAFESSKLSTNARAAVSEARKSGDGLAVSGI |
| Ga0070733_110965902 | 3300005541 | Surface Soil | VILVDTHVVVWLAFAQDRISRKARTAIDDARKGADGLAISDITLFELATL |
| Ga0066707_108568312 | 3300005556 | Soil | VILVDTHVVVWVAGDPQKLSSKARAAIDQELRAGQALAISCMT |
| Ga0066708_100197371 | 3300005576 | Soil | VILVDTHVVVWLAFDQGQLSGKARAAIDDARKKGDGLAIC |
| Ga0066691_104630541 | 3300005586 | Soil | MGRTLLILVDTHVLVWLAFDQSQISSKARTAIDEARDLGDGLAISDF |
| Ga0070761_109503902 | 3300005591 | Soil | LILVDTHVVVWLAFDQARLSQKARTAIKDARKNNGGLAISAITLLELA |
| Ga0070764_106733211 | 3300005712 | Soil | VILVDTHVVVWLAFDQNQLSKRARAAIDEARKNGDGLA |
| Ga0075017_1006314553 | 3300006059 | Watersheds | MGQAEVTLVDTHVVLWLAFEQNRLSRKARAAIDDARQKGEG |
| Ga0075021_100750701 | 3300006354 | Watersheds | VILVDTHIVVWLASDPSRLSKNAKAAIDDARKDGEGLAVSDI |
| Ga0079220_111138821 | 3300006806 | Agricultural Soil | VILVDTPVVVWLAFDPGQLSPKAIAAIDSARKKEGGLAISD |
| Ga0075434_1006608704 | 3300006871 | Populus Rhizosphere | VILVDTPVVVWLAFDPGQLSPKAIAAIDSARKKEGGLAISDMTLLE |
| Ga0075435_1004213271 | 3300007076 | Populus Rhizosphere | VILLDTHVVVWLALDQARISNNARRAIQRARASGGGLAIS |
| Ga0066710_1019589541 | 3300009012 | Grasslands Soil | VILLDTHVVFWMASKPERLSREAQRAIAKAAGREGLAIS |
| Ga0116225_12974411 | 3300009524 | Peatlands Soil | VILLDTHVVVWLAFYQAQLSMKARAAIDDARRSGDG |
| Ga0116107_11933432 | 3300009548 | Peatland | VILVDTHVVVWLAFDQGQLSKNARAAINEARQNGEGLAISDITLL |
| Ga0116111_11107261 | 3300009616 | Peatland | VILLDTHVVVWLALDPSRLSRKATSAIDNARKNGDGLAICDV |
| Ga0116105_11589793 | 3300009624 | Peatland | VILIDTHVVVWLAFDQTQLSKNARAAIDDARENGDGLAISDITLLELT |
| Ga0116131_10077369 | 3300009760 | Peatland | VILLDTHVVVWLAFDPSRLSCKATSAIDNARKNGDGLAICD |
| Ga0116134_10951911 | 3300009764 | Peatland | VILVDTHVVVWLALDQTHLSKNARAAIDDARRNGDGLAISDI |
| Ga0116134_13054383 | 3300009764 | Peatland | VILVDTHVVVWLAFDPSRLSQKARTAIDQARENGEGLAISDITLLELT |
| Ga0126380_108732801 | 3300010043 | Tropical Forest Soil | VILVDTHVVVWLAFAPQEISRKARQAIEDARKDADGLAISDISL |
| Ga0126373_128148213 | 3300010048 | Tropical Forest Soil | VILVDTHVVVWLALQPDKISKKARTAIEDARRSGQGIAISDIALLEISILE |
| Ga0134082_103531463 | 3300010303 | Grasslands Soil | LILVDTHVLVWLAFDQSQISSKARTAIDEASDLGDGLAISDFSLLEVGT |
| Ga0134109_104432771 | 3300010320 | Grasslands Soil | MGKPEVILLDTDVVLWLAFGQVKISKRAKAAIEEARSS |
| Ga0134109_104942551 | 3300010320 | Grasslands Soil | VILVDTHVVVWLAFDQGQLSGRARAAIDDARKNGDGLAISDITLLELATL |
| Ga0134063_101967043 | 3300010335 | Grasslands Soil | LILVDTHVLVWLAFDQSQISSKARTAIDEASDLGDGLA |
| Ga0074045_100761275 | 3300010341 | Bog Forest Soil | VILVDTHVVVWLAFDEAQLSKDARAAISEARQNGEGLAISDI |
| Ga0126370_117770993 | 3300010358 | Tropical Forest Soil | LVVVDTHVVIWLAFEQRRFSPLARATIDRERHTGGGLAISGITLLELTTL |
| Ga0126372_132637311 | 3300010360 | Tropical Forest Soil | LILVDTHVVAWLAFDPAQLSRRARTAIDEARKQGDGLAISDITL |
| Ga0136449_1034008693 | 3300010379 | Peatlands Soil | LILVDTHVVVWLAFEQSQISSNARAAIDEARNVRDGLAVSDMTLWEVGTLASR |
| Ga0126383_132744662 | 3300010398 | Tropical Forest Soil | MILVDTHVVVWLAYEAHRLSKNAKAAISDARQNGE |
| Ga0137392_101634554 | 3300011269 | Vadose Zone Soil | LILVDTHVVVWLAFDAARISKNARSAIEKARQNGEGLAISDISLFELARIFNR |
| Ga0137391_101048453 | 3300011270 | Vadose Zone Soil | VILVDTQVVVWLAFDRARLSKNARAAINDARQNGEGLAISDITLLELATLAN* |
| Ga0137391_108034141 | 3300011270 | Vadose Zone Soil | VILVDTHVVVWLAFDPDQISRRARTAIDDARKNADGLAISDITLLEL |
| Ga0137391_109175714 | 3300011270 | Vadose Zone Soil | LILVDTHVVVWLAFDQDQISMKAKTAIDDARKNADG |
| Ga0137389_100226497 | 3300012096 | Vadose Zone Soil | LILVDTHVVVWLAFDVARISKQARSAIEKARQNGEGLAISDISLFELARIFN* |
| Ga0137388_100557071 | 3300012189 | Vadose Zone Soil | VILVDTHVVVWLALDQTHLSKNARAAIDDARRNGDGLAISDISLLELATLSSKGR |
| Ga0137382_110721323 | 3300012200 | Vadose Zone Soil | VILVDTHVVVWLAFDQDQISRKARAAIDNARRNGDGLAISDITLFGA |
| Ga0137363_107535313 | 3300012202 | Vadose Zone Soil | VILVDTHVVVWLAFDQAQLSKNARAAINDARQNGDGLSISD |
| Ga0137380_113058313 | 3300012206 | Vadose Zone Soil | MILVDTHVVAWLAFDQDLLSKRARAAIDHARQDGDGLAISDITLLELAAL |
| Ga0137384_112584161 | 3300012357 | Vadose Zone Soil | VILVDTHVVVWLALDQTHLSKNARAAIDDARQNGDGLAVSDITLLELATL |
| Ga0137360_118906161 | 3300012361 | Vadose Zone Soil | LILVDTHVVVWLAFEEAQLSRKARTTIEVARRNAEALAI |
| Ga0137361_112724911 | 3300012362 | Vadose Zone Soil | MGRAEVILVDTHVVVWLAFDQDRLSKKARAAIDDARQNADGLAI |
| Ga0137358_104055783 | 3300012582 | Vadose Zone Soil | LILVDTHVVVWLAFDQSQISSKARAAIDEARALGDGLAISDFTLLEL |
| Ga0137397_107624811 | 3300012685 | Vadose Zone Soil | LILVDTHVVVWLAFDQNQMSRKARAAIDEARDLGDGLAISDMTLLEVGTLAS |
| Ga0137359_112611232 | 3300012923 | Vadose Zone Soil | VILVDTHVVVWLALDQTHLSKNARAAIDDARRNGDGLA |
| Ga0137416_104343373 | 3300012927 | Vadose Zone Soil | VILVDTHVAVWLAFDHNHLSKRARAAIDDARKHGDGLAISDIT |
| Ga0137407_102417761 | 3300012930 | Vadose Zone Soil | VILVDTHVVVWLALDQTHLSKNARAAIDAARRNGDGLAISDITLL |
| Ga0137410_109598171 | 3300012944 | Vadose Zone Soil | MAAIVYLDTHVVVWLAFDQDRLSKKARAAIDDARQN |
| Ga0126369_114812451 | 3300012971 | Tropical Forest Soil | VILVDTHVVAWLALDQRKISRRARTTIDAVRENAEGLAIELRA |
| Ga0157375_134785641 | 3300013308 | Miscanthus Rhizosphere | MILVDTHVVVWLAFDQSHLSKNARAAIDDARLKGDGLAIC |
| Ga0134081_103593132 | 3300014150 | Grasslands Soil | VILVDTHVVVWLAFDQGQLSGKARAAIDDARKNGDGLAISDITLLE |
| Ga0182010_100071451 | 3300014490 | Fen | VILVDTHVVVWLALDQTQLSKNARAAIDDARRNGDGLAISDITLLELAT |
| Ga0182024_106549883 | 3300014501 | Permafrost | VILVDTHVVVWLAFDPSRLSKKARTAIDNAREKGDGLAISDITLLELT |
| Ga0157377_105684423 | 3300014745 | Miscanthus Rhizosphere | MILVDTHVVVWLAFDQSHLSKNARAAIDDARLKGDGLAICDITLLELAALS |
| Ga0182027_114435451 | 3300014839 | Fen | VILVDTHVVVWLAFDPSRLSRKARAAIEDARKNGDGLAISDI |
| Ga0182035_104909961 | 3300016341 | Soil | VILVDTHVVVWLAFDQRKISGKARGAIDDARKNGQGLAISDVTL |
| Ga0187806_13814701 | 3300017928 | Freshwater Sediment | VILLDTHVVVWLAFDQAQLSMKARAAIDDARQNADG |
| Ga0187849_10457691 | 3300017929 | Peatland | VILLDTHVVVWLALDPSRLSRKATSAIDNARKNGDGLAICD |
| Ga0187801_100693483 | 3300017933 | Freshwater Sediment | VILVDTHVVVWLALDQTHLSKNARAAIDDARGSGDGLAISDITLLELA |
| Ga0187801_104959461 | 3300017933 | Freshwater Sediment | VILVDTHVVVWLALDRTHLSKNARAAIDDARRNGDGLAISDITL |
| Ga0187809_100700851 | 3300017937 | Freshwater Sediment | VILLDTHVVVWLAFDQAQLSKNARAAINDARQNGDGLAISD |
| Ga0187854_103542201 | 3300017938 | Peatland | VILVDTHVVVWLALDQTHLSKNARAAIDDARRNGDG |
| Ga0187819_103752081 | 3300017943 | Freshwater Sediment | VILVDTHVVVWLALDQTHLSKNARAAIDDARRNGDGLAISDITLL |
| Ga0187847_100371494 | 3300017948 | Peatland | VILVDTHVVVWLAFDPSRLSKKAKTAIDNAREKGDGLAISDITLLELTTL |
| Ga0187817_105937342 | 3300017955 | Freshwater Sediment | VILVDTHVVIWLAFEPGQLSRKGRVAIDDARKKAAGLAISD |
| Ga0187817_111397501 | 3300017955 | Freshwater Sediment | VILVDTHVVVWLAFDQDQISRKARTAIDDARKNADGLAISDIT |
| Ga0187779_110296141 | 3300017959 | Tropical Peatland | VILVDTHVVAWMAFEPSRISKNAKAAIDDARMNGGGLAIS |
| Ga0187778_101885761 | 3300017961 | Tropical Peatland | MGQPSVILVDTHVVVWLALQPEKISKKARTAIEDARRSGQGIAISDIAL |
| Ga0187780_101970971 | 3300017973 | Tropical Peatland | VILVDTHVVAWMAFEPSRISKNAKAAIDDARMNGGGLAISGITLWELATHAGR |
| Ga0187822_103581211 | 3300017994 | Freshwater Sediment | VILVDTHVVVWLALDQTHLSKRARAAIDDARRNGDGLAISDITL |
| Ga0187816_100842343 | 3300017995 | Freshwater Sediment | VILVDTHIVVWLASDPSRLSKNARAAIDAARKDGEGLAVSDI |
| Ga0187816_104144503 | 3300017995 | Freshwater Sediment | VILVDTHVVVWLAFDQDRMSKKARAAIDDARQNGDGL |
| Ga0187891_11391181 | 3300017996 | Peatland | VILLDTHVVVWLALDPSRLSRKATSAIDNARKNGDGLAIC |
| Ga0187767_101488632 | 3300017999 | Tropical Peatland | MGQSQVILIDTHVVVWLAFEQVRLSGRARAAIDDARSKGEGLAISQITLLELATLASK |
| Ga0187767_101626891 | 3300017999 | Tropical Peatland | VILVDTHVVAWMAFEPSRISKNAKAAIDDARMNGG |
| Ga0187804_100237061 | 3300018006 | Freshwater Sediment | VILVDTHVVVWLAFDPGRISKRARAAIDDARQTGEGLAICDITLLEL |
| Ga0187804_101821063 | 3300018006 | Freshwater Sediment | VILVDTHVVAWMAFEQNRLSKNARAAIDDARTNGGGLAISGITLWELAT |
| Ga0187805_100114931 | 3300018007 | Freshwater Sediment | VILVDTHVVVWLAFDPGQLSKHARAAIDEARQNGEGLAISDITLLELMT |
| Ga0187810_101149843 | 3300018012 | Freshwater Sediment | VILLDTHVVVWLALDQNRLSQKARAAIEHARMKGG |
| Ga0187810_104666811 | 3300018012 | Freshwater Sediment | VILVDTHVVVWLAFQPDAVSRKAKNAIDDARKNGEGLAISDITLLELA |
| Ga0187880_14903182 | 3300018016 | Peatland | HVVVWLALDQTHLSKNARAAIDDARRNGDGLAISV |
| Ga0187857_100343676 | 3300018026 | Peatland | VILVDTHVVVWLALDQALITRKAKTAIDDARQNANGLAISDITLYELSTLASKG |
| Ga0187863_105724043 | 3300018034 | Peatland | VILVDTHIVVWLAFDPAQLSKNARAAINDARENGDGLAISDITLLELTTLSS |
| Ga0187769_103407351 | 3300018086 | Tropical Peatland | LILVDTHVVVWLALEPERISKNAQAAIDDARRNEDGLAVCG |
| Ga0187774_106763253 | 3300018089 | Tropical Peatland | MILVDTHVVAWLAFEQHRLSKNARAAIDDARKSGEGLAICDITLLELA |
| Ga0187770_102675341 | 3300018090 | Tropical Peatland | LILVDTHVVVWLALEPERISKDAQAAIDDARQNEDGLAVCGITL |
| Ga0187770_109359641 | 3300018090 | Tropical Peatland | VILLDTHVVAWLAFDSTRLSRAAKAAIDEAREHGDGLAIS |
| Ga0187770_109795051 | 3300018090 | Tropical Peatland | VILLDTHVVVWLAFDPSRLSRKAISAIDKARKGGEGLAISD |
| Ga0066667_117243633 | 3300018433 | Grasslands Soil | VILVDTHVVVWLAFDPSQLSRKARAAIDKAHKNGDGLAISDITILEL |
| Ga0066662_128429242 | 3300018468 | Grasslands Soil | LILVDTHVVVWLAFDEDRISKRARSAIEKARQNGEGLAISDISLFELAR |
| Ga0193753_104375632 | 3300020034 | Soil | MPTRMNQVTLVDTHVFVWLAFDQARLSGKARAAINDARPNGQGL |
| Ga0187768_10404141 | 3300020150 | Tropical Peatland | VILVDTHVVVWLAFAQQKISNSARMAIDDVRRDAKGVAISDITLLELAALANKG |
| Ga0210403_109474011 | 3300020580 | Soil | VILVDTHVVVWLAFDQKQISIRAKAAIADARKNADGLA |
| Ga0210399_102190811 | 3300020581 | Soil | VILVDTHVVVWLAFDQEQISRKARTAIEDARKNADGLAISD |
| Ga0210399_104108821 | 3300020581 | Soil | VILVDTHVVIWLAFDPGQLSRKARVAIDDARKKAA |
| Ga0210395_112304621 | 3300020582 | Soil | VILVDTHVVVWLAFAQERISPNARTAIHNARNKEDGL |
| Ga0210401_100324925 | 3300020583 | Soil | VILLDAHVVVWLALDQTHLSKNARAAINHARENGDGLAISDITPGIGHAFK |
| Ga0215015_106405981 | 3300021046 | Soil | VILVDTHVVVWLAFHQDQLSQRAREAIDNARKTEDGLAISDITLLELSLIHISEPTRPLYIS |
| Ga0210404_107188362 | 3300021088 | Soil | VILVDTHVVIWLAFDPGQLSRKARVAIDNARKKAAGLAISDISLLELA |
| Ga0210406_102267303 | 3300021168 | Soil | LILVDTHVVVWLAFDHTQISSKAQAAIDNARKFQDGLAISGVTL |
| Ga0210405_103061103 | 3300021171 | Soil | VILVDTHVVAWLAFDQDRISGNARSAIDEARKNGDGLAI |
| Ga0210405_113354782 | 3300021171 | Soil | VILLDTHVIVWLALDQTHLSKNARAAIDDARQNGDGLAIS |
| Ga0210408_111283352 | 3300021178 | Soil | VILVDTHVVVWLAFDESRLSGKARAAIDKARRNGD |
| Ga0210388_105428604 | 3300021181 | Soil | VGRTQVILVDTHVVVWLAFDQAQLSKNAKSAINRARQDGEGLAISNITLLELTTLSRK |
| Ga0210385_110441523 | 3300021402 | Soil | LILVDTHVVLWLLSDPARLSKAAHAAIDDARRNGGGL |
| Ga0210389_111728131 | 3300021404 | Soil | MGRPVLILVDTHVVVWLAFDQTRLSKMARATIEGSRLKGEPVAISGITLF |
| Ga0210386_115213131 | 3300021406 | Soil | VILLDTHVIVWLALDQTHLSKNARAAIDDARQNGDGLAISD |
| Ga0210394_100223391 | 3300021420 | Soil | VILVDTHVVVWLALDPSSLSKTARAAIDEARKNEGGLAI |
| Ga0210390_102966973 | 3300021474 | Soil | VILVDTHVVVWLALDPSSLSKAARAAIDEARKNEGGLAIADITLL |
| Ga0210390_111952793 | 3300021474 | Soil | LILVDTHVVLWLLSDPARLSKAAHAAIDDARRNGGGLA |
| Ga0187846_100386364 | 3300021476 | Biofilm | VILVDTHVVVWLAFDQKQISRKARTAIDDARKDSAGLAICDITLMEQVKTASVSRSL |
| Ga0210409_106215251 | 3300021559 | Soil | LILVDTHVVVWLAFDQEQISRKARNAIDEARALSDGLAISDM |
| Ga0210409_107394762 | 3300021559 | Soil | VILVDTHVVVWLAFDQDQISRKARTAIDEARRNADGLAISDIT |
| Ga0224558_10548083 | 3300023090 | Soil | VILVDTHIVVWLALDQTHLSKNARAAIDDARRNGDGLAISDITLLELATLSSKG |
| Ga0224558_11056643 | 3300023090 | Soil | VILVDTHVVVWLAFDQGQLSKNARAAINEARQNGEGLAISDITLLELMTL |
| Ga0224551_10859792 | 3300023259 | Soil | MGRTQVILLDTHVVVWLAFDQHRISKRARTAIDQTRKSTEGL |
| Ga0208692_10781981 | 3300025472 | Peatland | VILVDTHVVVWLAFDQGQLSKNARAAINEARQNGEGLAI |
| Ga0208686_10789023 | 3300025500 | Peatland | VILVDTHVVVWLALDQTHLSKNARAAIDDARRNGDGLAI |
| Ga0208820_10795973 | 3300025576 | Peatland | VILVDTHVVVWLALDQTHLSKNARAAIDDARRNGDGLAISDITLLEL |
| Ga0207699_113526792 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | VILVDTHVVVWLAFDQDHISRKARAAIDNARRSGDGLAVSDIT |
| Ga0207646_109407472 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VILVDTHIVVWLALDQTRLSKNARAAIDDARRNGDGLAISDITLLELATLHHQAVAR |
| Ga0209055_12120583 | 3300026309 | Soil | VILVDTHVVVWLAFDQDQISKKARAAIDNARRNGDGLAISDITLLELATLA |
| Ga0209473_12565661 | 3300026330 | Soil | VILLDTHVVVWMASDPGRLSRTAGDAIRKAGREGGIGIS |
| Ga0179587_105281291 | 3300026557 | Vadose Zone Soil | VILVDTHVVVWLAFDQNRLSKKARAAIDDARKNGQGLAISDISLLELAT |
| Ga0208859_10368472 | 3300027069 | Forest Soil | VILVDTHVVVWLAFGQNQISRKARTAINDARKNAEGLAI |
| Ga0208603_10020086 | 3300027109 | Forest Soil | MGRTQVILLDTHVVVWLAFDQSQLSRNAKATINDARQNGDGLAI |
| Ga0209733_10843471 | 3300027591 | Forest Soil | LILLDTHVVVWLVSEPERLSKKARAVIDDARQNGDGLAVSG |
| Ga0208044_10584704 | 3300027625 | Peatlands Soil | VILVDTNVVVWLAFDQDQISPKARAAINDARNQGDGL |
| Ga0209388_11115443 | 3300027655 | Vadose Zone Soil | MGRSLLILVDTHVVVWLAFEEYRISSKAKAAIDEARDLRDGLAISDMT |
| Ga0209011_10151667 | 3300027678 | Forest Soil | VILVDTHVVVWLAFDQDQLSRKARAAIDDARKNGDGLAISDITL |
| Ga0208696_10217465 | 3300027696 | Peatlands Soil | VILVDTNVVVWLAFDQDQISPKARAAINDARNQGDGLAI |
| Ga0209447_100074271 | 3300027701 | Bog Forest Soil | VILVDTHVVVWLAFEQARISKPARQAIDAARRHENGLAIC |
| Ga0207862_12537682 | 3300027703 | Tropical Forest Soil | VILVDTHVVVWLAFAQEQISRRARTTIDGARKNAEGLAISDITLMELATLV |
| Ga0209448_101183723 | 3300027783 | Bog Forest Soil | VILVDTHVVVWLVLDAERVSAKARSAISEARKSANGLAIS |
| Ga0209180_105531923 | 3300027846 | Vadose Zone Soil | LILVDTHVVVWLAFDAARISKNARSAIEKARQNGEGLAISDISLFELAGIFNRE |
| Ga0209166_105277323 | 3300027857 | Surface Soil | VILVDTHVVVWLAFAQDRISRKARTAIDDARKGADGLAIS |
| Ga0209068_101299931 | 3300027894 | Watersheds | MGQSEVILVDTHIVVWLASDPSRLSKNAKAAIDDARKDGEGLAVSDITLLELTT |
| Ga0209006_108429961 | 3300027908 | Forest Soil | VILVDTHVVMWMAVEGDRISRKATAAIDDARRNGDGLAISDITLLELARLASEGRIDLYSGV |
| Ga0308309_109538931 | 3300028906 | Soil | MILVDTHVVVWLAFDQDQISRKARSAIDVARKSGDGLAISDITLLELATL |
| Ga0311340_112222313 | 3300029943 | Palsa | VILVDTHIVVWLAFDQDQISRKARTTIDNARKNADGLAISDITL |
| Ga0311338_111823011 | 3300030007 | Palsa | VILVDTHVVVWLAFDENRISKQARTAIDDARKNADGLAICDITLFELA |
| Ga0075388_113966082 | 3300030848 | Soil | VIIVDTHVVIWLAFDQAQLSRKARSAIDDTREKAEGLAISDITL |
| Ga0075374_108410601 | 3300030855 | Soil | VIIVDTHVVIWLAFDQAQLSRKARSAIDDTRKKAEGLAISDITLFELA |
| Ga0265753_10247523 | 3300030862 | Soil | VILVDTHVVAWLAFDQDRISGKARSAIDEARKNADGLAISDITLLEL |
| Ga0265760_101698851 | 3300031090 | Soil | VILVDTHVVAWLAFDQDRISGNARSAIDEARKNGDGLAISDITLLEL |
| Ga0307497_102404183 | 3300031226 | Soil | VILLDTHVVVWLAFDPSQLSKNARAAINDARQKGE |
| Ga0170824_1050047691 | 3300031231 | Forest Soil | VILVDTHVVVWLAFDQAQLSKNAKAAINDARQSGEGLAISDIT |
| Ga0302325_109635031 | 3300031234 | Palsa | MILVDTHVVVWLAFDQDRISRKARAAIDGARKNAHALAIS |
| Ga0170820_153147843 | 3300031446 | Forest Soil | VILVDTHVVVWLAFDQNQLSKKARAAIDDARKNGD |
| Ga0170818_1028070771 | 3300031474 | Forest Soil | VILVDTHVVIWLAFDPGQLSRKARVAIDDARKKAAGLAISDISL |
| Ga0302326_112364261 | 3300031525 | Palsa | MGRTQVILLDTHVVVWLAFDQHRISKRARTAIDQTRK |
| Ga0318528_101838153 | 3300031561 | Soil | VILVDTHVVVWLALDPGQLSRQARAAIDRARKSGEGLAISDISLLE |
| Ga0310686_1120269501 | 3300031708 | Soil | VILVDTHVVVWLVLDAERVSAKARSAISEARKSANGLAI |
| Ga0307477_101891864 | 3300031753 | Hardwood Forest Soil | VILVDTHVVVWLAFDQNQISKKARTAINDARKSADGLAISDITLLELATLVSKARI |
| Ga0307478_104620793 | 3300031823 | Hardwood Forest Soil | VILVDTHVVVWLAFDQNQISKKARTAINDARKSADGLAISDITLLELATL |
| Ga0306923_121182072 | 3300031910 | Soil | VILVDTHVVIWLAFDPGQLSRKARVAIDDARKKAAGLAISDITLLELATPCV |
| Ga0310916_109292111 | 3300031942 | Soil | MILVDTHVVAWLAFDQDQISRKARATIDNARKNADGLAISDITLLELAT |
| Ga0306926_110598222 | 3300031954 | Soil | VILVDTHVVVWLAFDQTEISTKARTAIDGERKNGDGLAISDITLFELANLESKGR |
| Ga0307479_114842221 | 3300031962 | Hardwood Forest Soil | VILVDTHVVLWLAFDQELISSKAKAAIDDVRQNADGLAISDITL |
| Ga0307479_120358191 | 3300031962 | Hardwood Forest Soil | VILVDTHVVAWLAFDQTQLSKKARAAIDGARKNGDGLAISDITLL |
| Ga0310911_105789213 | 3300032035 | Soil | VILVDTHVVAWLALDQHKISRRARTAIDGARKNAEGLAISDITLLELAT |
| Ga0318549_104297251 | 3300032041 | Soil | VILVDTHVVVWLALDPGQLSRQARAAIDRARKSGEGLAIS |
| Ga0311301_123870222 | 3300032160 | Peatlands Soil | LILVDTHVVLWLADGAVKLSPGARAAIDEERRNGQALAICDITLAELATSYG |
| Ga0306920_1021276031 | 3300032261 | Soil | VILVDTHVVVWLACEAHRLSKNAKAAISDARKNGEGIAISDISLLEL |
| Ga0306920_1027024791 | 3300032261 | Soil | VILVDTHVVAWLALDQRKISRRARTAIDRVRENAEGLAISDITLAELAALQTNGRI |
| Ga0335079_113327633 | 3300032783 | Soil | VILIDTHVVVWLAFDQDQISPKARAAINDARNYGDGLAI |
| Ga0335081_116146273 | 3300032892 | Soil | VILIDTHVVVWLAFDQDQISPKARAAINDARNHGDGL |
| Ga0326727_111153761 | 3300033405 | Peat Soil | VILLDTHVVVWLAFDPSRLSKKARTAINHARENGD |
| Ga0326726_112525812 | 3300033433 | Peat Soil | VILVDTHVVVWLALDQTHLSKNARAAIDDARRNGDGLAISDITLLE |
| Ga0326724_0190878_2_124 | 3300034091 | Peat Soil | MILVDTHVVVWLAFDPSRLSKKAKTAIDEARENGEGLAISD |
| ⦗Top⦘ |