| Basic Information | |
|---|---|
| Family ID | F031803 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 181 |
| Average Sequence Length | 38 residues |
| Representative Sequence | MTMQSDNKGDSLTDNLWAEMSLMMVLVVIVLALAWRYVW |
| Number of Associated Samples | 86 |
| Number of Associated Scaffolds | 181 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 76.80 % |
| % of genes near scaffold ends (potentially truncated) | 28.73 % |
| % of genes from short scaffolds (< 2000 bps) | 86.19 % |
| Associated GOLD sequencing projects | 76 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (52.486 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (29.834 % of family members) |
| Environment Ontology (ENVO) | Unclassified (47.514 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (66.851 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.75% β-sheet: 0.00% Coil/Unstructured: 49.25% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 181 Family Scaffolds |
|---|---|---|
| PF04392 | ABC_sub_bind | 2.21 |
| PF00072 | Response_reg | 2.21 |
| PF03734 | YkuD | 1.66 |
| PF09992 | NAGPA | 1.10 |
| PF13701 | DDE_Tnp_1_4 | 1.10 |
| PF00430 | ATP-synt_B | 1.10 |
| PF09926 | DUF2158 | 0.55 |
| PF13676 | TIR_2 | 0.55 |
| PF09851 | SHOCT | 0.55 |
| PF02810 | SEC-C | 0.55 |
| PF04519 | Bactofilin | 0.55 |
| PF00239 | Resolvase | 0.55 |
| PF00589 | Phage_integrase | 0.55 |
| PF08309 | LVIVD | 0.55 |
| PF13396 | PLDc_N | 0.55 |
| PF04226 | Transgly_assoc | 0.55 |
| PF16868 | NMT1_3 | 0.55 |
| PF00118 | Cpn60_TCP1 | 0.55 |
| PF00903 | Glyoxalase | 0.55 |
| PF13493 | DUF4118 | 0.55 |
| PF05717 | TnpB_IS66 | 0.55 |
| PF00816 | Histone_HNS | 0.55 |
| PF01569 | PAP2 | 0.55 |
| PF06411 | HdeA | 0.55 |
| PF00034 | Cytochrom_C | 0.55 |
| PF07452 | CHRD | 0.55 |
| PF00497 | SBP_bac_3 | 0.55 |
| COG ID | Name | Functional Category | % Frequency in 181 Family Scaffolds |
|---|---|---|---|
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 2.21 |
| COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 1.66 |
| COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 1.66 |
| COG0711 | FoF1-type ATP synthase, membrane subunit b or b' | Energy production and conversion [C] | 1.10 |
| COG0459 | Chaperonin GroEL (HSP60 family) | Posttranslational modification, protein turnover, chaperones [O] | 0.55 |
| COG1664 | Cytoskeletal protein CcmA, bactofilin family | Cytoskeleton [Z] | 0.55 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.55 |
| COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 0.55 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.55 |
| COG2916 | DNA-binding protein H-NS | Transcription [K] | 0.55 |
| COG3436 | Transposase | Mobilome: prophages, transposons [X] | 0.55 |
| COG5276 | Uncharacterized secreted protein, contains LVIVD repeats, choice-of-anchor domain | Function unknown [S] | 0.55 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 52.49 % |
| All Organisms | root | All Organisms | 47.51 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459015|G14TP7Y01C6SEL | Not Available | 787 | Open in IMG/M |
| 3300000580|AF_2010_repII_A01DRAFT_1021727 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1015 | Open in IMG/M |
| 3300000580|AF_2010_repII_A01DRAFT_1054002 | Not Available | 616 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10007931 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 2929 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10021130 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1784 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10058748 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 989 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10125730 | Not Available | 625 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10177387 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 505 | Open in IMG/M |
| 3300000655|AF_2010_repII_A100DRAFT_1010895 | Not Available | 1737 | Open in IMG/M |
| 3300000655|AF_2010_repII_A100DRAFT_1039913 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 851 | Open in IMG/M |
| 3300000789|JGI1027J11758_12055454 | Not Available | 518 | Open in IMG/M |
| 3300000793|AF_2010_repII_A001DRAFT_10018060 | Not Available | 1697 | Open in IMG/M |
| 3300000793|AF_2010_repII_A001DRAFT_10051966 | Not Available | 914 | Open in IMG/M |
| 3300000837|AP72_2010_repI_A100DRAFT_1006830 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1619 | Open in IMG/M |
| 3300001867|JGI12627J18819_10066444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1500 | Open in IMG/M |
| 3300004267|Ga0066396_10049947 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 669 | Open in IMG/M |
| 3300004633|Ga0066395_11001643 | Not Available | 510 | Open in IMG/M |
| 3300005332|Ga0066388_100057204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4086 | Open in IMG/M |
| 3300005332|Ga0066388_100688371 | Not Available | 1631 | Open in IMG/M |
| 3300005332|Ga0066388_101205722 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1294 | Open in IMG/M |
| 3300005332|Ga0066388_101721655 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1110 | Open in IMG/M |
| 3300005332|Ga0066388_106999578 | Not Available | 567 | Open in IMG/M |
| 3300005332|Ga0066388_108060324 | Not Available | 526 | Open in IMG/M |
| 3300005332|Ga0066388_108486391 | Not Available | 512 | Open in IMG/M |
| 3300005363|Ga0008090_10167458 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1721 | Open in IMG/M |
| 3300005363|Ga0008090_15458542 | Not Available | 529 | Open in IMG/M |
| 3300005713|Ga0066905_100018757 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3611 | Open in IMG/M |
| 3300005713|Ga0066905_100178629 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1563 | Open in IMG/M |
| 3300005713|Ga0066905_100646081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 901 | Open in IMG/M |
| 3300005713|Ga0066905_100689439 | Not Available | 875 | Open in IMG/M |
| 3300005713|Ga0066905_100822085 | Not Available | 807 | Open in IMG/M |
| 3300005713|Ga0066905_100957753 | Not Available | 752 | Open in IMG/M |
| 3300005764|Ga0066903_100240392 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2777 | Open in IMG/M |
| 3300005764|Ga0066903_100309932 | All Organisms → cellular organisms → Bacteria | 2508 | Open in IMG/M |
| 3300005764|Ga0066903_100868868 | Not Available | 1626 | Open in IMG/M |
| 3300005764|Ga0066903_101229844 | Not Available | 1393 | Open in IMG/M |
| 3300005764|Ga0066903_101328571 | Not Available | 1345 | Open in IMG/M |
| 3300005764|Ga0066903_101419092 | Not Available | 1305 | Open in IMG/M |
| 3300005764|Ga0066903_101667239 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1212 | Open in IMG/M |
| 3300005764|Ga0066903_101906593 | Not Available | 1138 | Open in IMG/M |
| 3300005764|Ga0066903_102544926 | Not Available | 991 | Open in IMG/M |
| 3300005764|Ga0066903_102981327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 917 | Open in IMG/M |
| 3300005764|Ga0066903_103800401 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 811 | Open in IMG/M |
| 3300005764|Ga0066903_104192441 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
| 3300005764|Ga0066903_105119631 | Not Available | 694 | Open in IMG/M |
| 3300005764|Ga0066903_107165992 | Not Available | 577 | Open in IMG/M |
| 3300005764|Ga0066903_107604724 | Not Available | 558 | Open in IMG/M |
| 3300006796|Ga0066665_10980915 | Not Available | 650 | Open in IMG/M |
| 3300006852|Ga0075433_10834806 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 804 | Open in IMG/M |
| 3300006852|Ga0075433_11119251 | Not Available | 684 | Open in IMG/M |
| 3300009792|Ga0126374_10930778 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 676 | Open in IMG/M |
| 3300010043|Ga0126380_10639186 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium CG07_land_8_20_14_0_80_52_14 | 845 | Open in IMG/M |
| 3300010043|Ga0126380_11616015 | Not Available | 579 | Open in IMG/M |
| 3300010046|Ga0126384_10099671 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2140 | Open in IMG/M |
| 3300010046|Ga0126384_10639731 | Not Available | 936 | Open in IMG/M |
| 3300010047|Ga0126382_10022790 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3295 | Open in IMG/M |
| 3300010047|Ga0126382_10991192 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 735 | Open in IMG/M |
| 3300010048|Ga0126373_12141356 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 621 | Open in IMG/M |
| 3300010048|Ga0126373_12791316 | Not Available | 545 | Open in IMG/M |
| 3300010359|Ga0126376_12624008 | Not Available | 552 | Open in IMG/M |
| 3300010360|Ga0126372_12005548 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 625 | Open in IMG/M |
| 3300010361|Ga0126378_10388159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1508 | Open in IMG/M |
| 3300010361|Ga0126378_11477495 | Not Available | 770 | Open in IMG/M |
| 3300010366|Ga0126379_10197511 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1931 | Open in IMG/M |
| 3300010366|Ga0126379_10501321 | Not Available | 1285 | Open in IMG/M |
| 3300010366|Ga0126379_11244744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 850 | Open in IMG/M |
| 3300010376|Ga0126381_101089793 | Not Available | 1154 | Open in IMG/M |
| 3300010376|Ga0126381_102933024 | Not Available | 679 | Open in IMG/M |
| 3300010376|Ga0126381_104625080 | Not Available | 530 | Open in IMG/M |
| 3300010398|Ga0126383_12637440 | Not Available | 586 | Open in IMG/M |
| 3300010398|Ga0126383_12953445 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 555 | Open in IMG/M |
| 3300010398|Ga0126383_13000282 | Not Available | 551 | Open in IMG/M |
| 3300010398|Ga0126383_13223721 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 533 | Open in IMG/M |
| 3300010863|Ga0124850_1022175 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2036 | Open in IMG/M |
| 3300010863|Ga0124850_1034159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1624 | Open in IMG/M |
| 3300010863|Ga0124850_1059708 | Not Available | 1180 | Open in IMG/M |
| 3300010868|Ga0124844_1035628 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1635 | Open in IMG/M |
| 3300012201|Ga0137365_10408599 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1001 | Open in IMG/M |
| 3300012204|Ga0137374_10683121 | Not Available | 773 | Open in IMG/M |
| 3300012205|Ga0137362_10615671 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 936 | Open in IMG/M |
| 3300012971|Ga0126369_10106466 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Agrobacterium → Agrobacterium tumefaciens complex → Agrobacterium fabrum | 2551 | Open in IMG/M |
| 3300012971|Ga0126369_10528883 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1241 | Open in IMG/M |
| 3300012971|Ga0126369_11287167 | Not Available | 821 | Open in IMG/M |
| 3300012971|Ga0126369_12639905 | Not Available | 587 | Open in IMG/M |
| 3300012971|Ga0126369_12841866 | Not Available | 567 | Open in IMG/M |
| 3300012971|Ga0126369_13315370 | Not Available | 527 | Open in IMG/M |
| 3300016270|Ga0182036_10741427 | Not Available | 797 | Open in IMG/M |
| 3300016294|Ga0182041_10745654 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 871 | Open in IMG/M |
| 3300016357|Ga0182032_10067672 | Not Available | 2397 | Open in IMG/M |
| 3300016357|Ga0182032_10351192 | Not Available | 1180 | Open in IMG/M |
| 3300016357|Ga0182032_10724815 | Not Available | 836 | Open in IMG/M |
| 3300016371|Ga0182034_11201747 | Not Available | 659 | Open in IMG/M |
| 3300016387|Ga0182040_11312182 | Not Available | 611 | Open in IMG/M |
| 3300016404|Ga0182037_11390004 | Not Available | 620 | Open in IMG/M |
| 3300016422|Ga0182039_12277982 | Not Available | 500 | Open in IMG/M |
| 3300021560|Ga0126371_10212616 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2034 | Open in IMG/M |
| 3300021560|Ga0126371_10325058 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1669 | Open in IMG/M |
| 3300021560|Ga0126371_10489205 | Not Available | 1378 | Open in IMG/M |
| 3300021560|Ga0126371_10943248 | Not Available | 1006 | Open in IMG/M |
| 3300021560|Ga0126371_11346643 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 846 | Open in IMG/M |
| 3300027502|Ga0209622_1031269 | Not Available | 949 | Open in IMG/M |
| 3300027527|Ga0209684_1013858 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1267 | Open in IMG/M |
| 3300027874|Ga0209465_10112930 | Not Available | 1337 | Open in IMG/M |
| 3300031543|Ga0318516_10052478 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2221 | Open in IMG/M |
| 3300031543|Ga0318516_10098298 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1652 | Open in IMG/M |
| 3300031543|Ga0318516_10661699 | Not Available | 594 | Open in IMG/M |
| 3300031543|Ga0318516_10668993 | Not Available | 590 | Open in IMG/M |
| 3300031544|Ga0318534_10282409 | Not Available | 956 | Open in IMG/M |
| 3300031544|Ga0318534_10514696 | Not Available | 683 | Open in IMG/M |
| 3300031545|Ga0318541_10051967 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2106 | Open in IMG/M |
| 3300031545|Ga0318541_10799447 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 526 | Open in IMG/M |
| 3300031546|Ga0318538_10198275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1071 | Open in IMG/M |
| 3300031564|Ga0318573_10554351 | Not Available | 619 | Open in IMG/M |
| 3300031572|Ga0318515_10473526 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300031573|Ga0310915_10052472 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2637 | Open in IMG/M |
| 3300031573|Ga0310915_10138553 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1675 | Open in IMG/M |
| 3300031573|Ga0310915_10157774 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1572 | Open in IMG/M |
| 3300031573|Ga0310915_10160326 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1559 | Open in IMG/M |
| 3300031573|Ga0310915_10473170 | Not Available | 890 | Open in IMG/M |
| 3300031573|Ga0310915_10511195 | Not Available | 853 | Open in IMG/M |
| 3300031573|Ga0310915_10584839 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 791 | Open in IMG/M |
| 3300031573|Ga0310915_10708989 | Not Available | 710 | Open in IMG/M |
| 3300031573|Ga0310915_10770478 | Not Available | 677 | Open in IMG/M |
| 3300031573|Ga0310915_11027308 | Not Available | 574 | Open in IMG/M |
| 3300031679|Ga0318561_10080937 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1681 | Open in IMG/M |
| 3300031682|Ga0318560_10660278 | Not Available | 566 | Open in IMG/M |
| 3300031713|Ga0318496_10772520 | Not Available | 529 | Open in IMG/M |
| 3300031719|Ga0306917_11452225 | Not Available | 528 | Open in IMG/M |
| 3300031720|Ga0307469_10323276 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1282 | Open in IMG/M |
| 3300031736|Ga0318501_10154394 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1183 | Open in IMG/M |
| 3300031736|Ga0318501_10868822 | Not Available | 501 | Open in IMG/M |
| 3300031744|Ga0306918_10095671 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2102 | Open in IMG/M |
| 3300031744|Ga0306918_10194237 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1526 | Open in IMG/M |
| 3300031744|Ga0306918_11127927 | Not Available | 607 | Open in IMG/M |
| 3300031763|Ga0318537_10303962 | Not Available | 590 | Open in IMG/M |
| 3300031768|Ga0318509_10091595 | Not Available | 1627 | Open in IMG/M |
| 3300031770|Ga0318521_10295645 | Not Available | 952 | Open in IMG/M |
| 3300031777|Ga0318543_10565402 | Not Available | 510 | Open in IMG/M |
| 3300031778|Ga0318498_10071591 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1558 | Open in IMG/M |
| 3300031778|Ga0318498_10316175 | Not Available | 700 | Open in IMG/M |
| 3300031819|Ga0318568_10917875 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 541 | Open in IMG/M |
| 3300031832|Ga0318499_10142036 | Not Available | 936 | Open in IMG/M |
| 3300031833|Ga0310917_10498351 | Not Available | 828 | Open in IMG/M |
| 3300031845|Ga0318511_10197845 | Not Available | 892 | Open in IMG/M |
| 3300031845|Ga0318511_10231623 | Not Available | 826 | Open in IMG/M |
| 3300031859|Ga0318527_10014041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2727 | Open in IMG/M |
| 3300031859|Ga0318527_10330608 | Not Available | 649 | Open in IMG/M |
| 3300031879|Ga0306919_10014348 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4597 | Open in IMG/M |
| 3300031879|Ga0306919_10073989 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2329 | Open in IMG/M |
| 3300031879|Ga0306919_10170672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1600 | Open in IMG/M |
| 3300031879|Ga0306919_10707139 | Not Available | 776 | Open in IMG/M |
| 3300031890|Ga0306925_10130408 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2696 | Open in IMG/M |
| 3300031890|Ga0306925_10133980 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2659 | Open in IMG/M |
| 3300031890|Ga0306925_10598654 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1164 | Open in IMG/M |
| 3300031910|Ga0306923_10140657 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → unclassified Methylobacterium → Methylobacterium sp. 17Sr1-1 | 2751 | Open in IMG/M |
| 3300031942|Ga0310916_11557941 | Not Available | 537 | Open in IMG/M |
| 3300031945|Ga0310913_10466916 | Not Available | 896 | Open in IMG/M |
| 3300031945|Ga0310913_10786078 | Not Available | 671 | Open in IMG/M |
| 3300031945|Ga0310913_10820975 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 655 | Open in IMG/M |
| 3300031946|Ga0310910_10072498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2489 | Open in IMG/M |
| 3300031946|Ga0310910_10078503 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2400 | Open in IMG/M |
| 3300031947|Ga0310909_10596056 | Not Available | 923 | Open in IMG/M |
| 3300031947|Ga0310909_10682743 | Not Available | 854 | Open in IMG/M |
| 3300031954|Ga0306926_10490667 | All Organisms → cellular organisms → Bacteria | 1510 | Open in IMG/M |
| 3300031954|Ga0306926_10954288 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1023 | Open in IMG/M |
| 3300031981|Ga0318531_10401558 | Not Available | 620 | Open in IMG/M |
| 3300032001|Ga0306922_10166579 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2361 | Open in IMG/M |
| 3300032001|Ga0306922_11059110 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 833 | Open in IMG/M |
| 3300032001|Ga0306922_11111168 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
| 3300032010|Ga0318569_10408023 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 633 | Open in IMG/M |
| 3300032052|Ga0318506_10258728 | Not Available | 771 | Open in IMG/M |
| 3300032060|Ga0318505_10239946 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 852 | Open in IMG/M |
| 3300032064|Ga0318510_10331765 | Not Available | 638 | Open in IMG/M |
| 3300032076|Ga0306924_11502134 | Not Available | 714 | Open in IMG/M |
| 3300032090|Ga0318518_10104754 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1415 | Open in IMG/M |
| 3300032261|Ga0306920_100392359 | Not Available | 2064 | Open in IMG/M |
| 3300032261|Ga0306920_100613240 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1609 | Open in IMG/M |
| 3300032261|Ga0306920_101136367 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1131 | Open in IMG/M |
| 3300032261|Ga0306920_103093884 | Not Available | 625 | Open in IMG/M |
| 3300032261|Ga0306920_103887828 | Not Available | 544 | Open in IMG/M |
| 3300033289|Ga0310914_11657413 | Not Available | 543 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 29.83% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 19.89% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 18.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.68% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 6.63% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.66% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.10% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.10% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.10% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 1.10% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.55% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.55% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459015 | Litter degradation PV4 | Engineered | Open in IMG/M |
| 3300000580 | Forest soil microbial communities from Amazon forest - 2010 replicate II A01 | Environmental | Open in IMG/M |
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300000655 | Forest soil microbial communities from Amazon forest - 2010 replicate II A100 | Environmental | Open in IMG/M |
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
| 3300000837 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A100 | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300004267 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010863 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300027502 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027527 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 4PV_02290510 | 2170459015 | Switchgrass, Maize And Mischanthus Litter | MTMQIDNKSDSLSNNLWAEMTLMTALVVILLGISWQFL |
| AF_2010_repII_A01DRAFT_10217272 | 3300000580 | Forest Soil | MQSDNRGDSLTDNLWAEMSLMMVLVVIVLALAWRYVW* |
| AF_2010_repII_A01DRAFT_10540022 | 3300000580 | Forest Soil | MQIDNKGESLKANLWAEMSLMMALVVVLLAVFWQFL* |
| AF_2010_repII_A1DRAFT_100079312 | 3300000597 | Forest Soil | MTMQSDNRGDSLTDNLWAEMSLMMVLVVIVLALAWRYVW* |
| AF_2010_repII_A1DRAFT_100211301 | 3300000597 | Forest Soil | DNKGESLNANLWAEMSLMMALVVVLLAVFWQFLW* |
| AF_2010_repII_A1DRAFT_100587481 | 3300000597 | Forest Soil | IDNKGESLNANLWAEMSLMMALVVVLLAVFWQFLW* |
| AF_2010_repII_A1DRAFT_101257302 | 3300000597 | Forest Soil | MTMQINNHKSDSLTDNLWAELSLMMALVVILLAIAWQFL* |
| AF_2010_repII_A1DRAFT_101773871 | 3300000597 | Forest Soil | MQIDNKGESLNANLWAEMSLMMALVVVLLAVFWQFL |
| AF_2010_repII_A100DRAFT_10108953 | 3300000655 | Forest Soil | MTMQIGNKNDTLNGNLWAEMSLMTAVVVILLTILWQFL* |
| AF_2010_repII_A100DRAFT_10399133 | 3300000655 | Forest Soil | MQSXNKGDSLTDNLWAEMSXMMVLVVIVLALAWRYVW* |
| JGI1027J11758_120554542 | 3300000789 | Soil | MTMQSNDQGDSLTDNLWAEMSLMMVLVVIVLALTWQYVW* |
| AF_2010_repII_A001DRAFT_100180603 | 3300000793 | Forest Soil | MTMQIDNKNDSLNDNLWSEMSLMTALVVVVLAILWQFL* |
| AF_2010_repII_A001DRAFT_100519663 | 3300000793 | Forest Soil | REVMTMQSDNRGDSLTDNLWAEMSXMMVLVVIVLALAWRYVW* |
| AP72_2010_repI_A100DRAFT_10068302 | 3300000837 | Forest Soil | MQIDNKSHSLTDNLWAEMSLMTALVVILLAISWQFL* |
| JGI12627J18819_100664443 | 3300001867 | Forest Soil | MRSNNKGDSLIDNLWAEMSLMMVLVVIVLALAWRYV* |
| Ga0066396_100499471 | 3300004267 | Tropical Forest Soil | MTMQSDNKGDSLTDNLWAEMSLMMVLVVIVLALAWRYVW* |
| Ga0066395_110016431 | 3300004633 | Tropical Forest Soil | MTMRSDNKGDSLTDNLWAEMSLMMVLVVIVLALAWRYVW* |
| Ga0066388_1000572043 | 3300005332 | Tropical Forest Soil | MTMQIDNKGESLKANLWAEMSLMMAVVVVLLAVFWQFLS* |
| Ga0066388_1006883712 | 3300005332 | Tropical Forest Soil | MTMQSNNKGDSLTDNLWAEMSLMMVLVVIVLALAWRYVW* |
| Ga0066388_1012057222 | 3300005332 | Tropical Forest Soil | MTMQIDNKGDSLTDNLWAEMSLMTAVVVILLAILWQFLW* |
| Ga0066388_1017216552 | 3300005332 | Tropical Forest Soil | MTMQIDNKGDSLTDNLWAEMSLMTAAVVILLAILWQFLW* |
| Ga0066388_1069995783 | 3300005332 | Tropical Forest Soil | EVMTMQSDNKGDSLTDNLWAEMSLMMVLVVIVLALTWRYVW* |
| Ga0066388_1080603241 | 3300005332 | Tropical Forest Soil | EVMTMQSDNKGDSLTDNLWAEMSLMMVLVVIVLALAWRYVW* |
| Ga0066388_1084863911 | 3300005332 | Tropical Forest Soil | VTMQIDNKGDSLTDNLWAEMSLMTALVVILLAILWQFLW* |
| Ga0008090_101674584 | 3300005363 | Tropical Rainforest Soil | MAMRGDNKGDSLTDNLWAEMSLMMVLVVIVLALAWRYVW* |
| Ga0008090_154585422 | 3300005363 | Tropical Rainforest Soil | MTMQSENKGDSLTDNLWAEMSLMMVLVVIVLALAWQYIW* |
| Ga0066905_1000187572 | 3300005713 | Tropical Forest Soil | MTHNKDQSLTDNLWAEVSLMTAVIVIVMALTWQYVW* |
| Ga0066905_1001786292 | 3300005713 | Tropical Forest Soil | MTMHGNKDHSLTENLWAELSLTTVVVVILIALAWRYVW* |
| Ga0066905_1006460814 | 3300005713 | Tropical Forest Soil | MTMHDNKDHSLTENLWAELSLMTVVVVILIALAWRYVW* |
| Ga0066905_1006894392 | 3300005713 | Tropical Forest Soil | MTMQIDNKSHSLTDNLWAEMSLMTALVVILLAISWQFL* |
| Ga0066905_1008220851 | 3300005713 | Tropical Forest Soil | SDNKGDSLTDNLWAEMSLMMVLVVIVLALAWRYVW* |
| Ga0066905_1009577531 | 3300005713 | Tropical Forest Soil | MTMHDNKDHSLTDNLWAEMSLMMVLVVIVLALAWRYVW* |
| Ga0066903_1002403922 | 3300005764 | Tropical Forest Soil | MQIDNKNDSLNGNLWSEMSLMTALVVVVLAILWQFL* |
| Ga0066903_1003099323 | 3300005764 | Tropical Forest Soil | MQIDNKNDTLNGNLWAEMSLMTAVVVILLTILWQFL* |
| Ga0066903_1008688684 | 3300005764 | Tropical Forest Soil | MTMQIDNKGDSLNDNLWAEMSLMTALVVILLAILWPFL* |
| Ga0066903_1012298445 | 3300005764 | Tropical Forest Soil | MTMQSHHKGHSLTDNLWAEMSLMTAVIVIVMVLAWQYVW* |
| Ga0066903_1013285712 | 3300005764 | Tropical Forest Soil | MQIDNKDHSLTDNLWAEMSLMMVVVAIILALTWRYVW* |
| Ga0066903_1014190923 | 3300005764 | Tropical Forest Soil | MQSDNKGDSLTDNLWAEMSLMMVLIVIVLALAWRYVW* |
| Ga0066903_1016672391 | 3300005764 | Tropical Forest Soil | MIMHDNKDHSLTENLWAELSLVTVVVVILIALAWRYVW* |
| Ga0066903_1019065931 | 3300005764 | Tropical Forest Soil | VMTMQIDNKGESLNANLWAEMSLMMALVVVLLAVFWQFLW* |
| Ga0066903_1025449262 | 3300005764 | Tropical Forest Soil | MTMQSDSEGHSPTDNLWAELSLMLAVIVIVMALGWRYVW* |
| Ga0066903_1029813272 | 3300005764 | Tropical Forest Soil | MQSDNKGDSLTDNLWAEMSLMMVLVVIVLALAWRYVW* |
| Ga0066903_1038004012 | 3300005764 | Tropical Forest Soil | MQIDNKSDSLSNNLWAEMTLMTALVVILLGILWQFL* |
| Ga0066903_1041924412 | 3300005764 | Tropical Forest Soil | MTLQSDNKSHSLIDNLWAELGLMTVVIVIVIALAWRYVW* |
| Ga0066903_1051196311 | 3300005764 | Tropical Forest Soil | MPSDNKGDSLTGNLWAEMSLMMVLVAIVLALAWRYVW* |
| Ga0066903_1071659921 | 3300005764 | Tropical Forest Soil | QSDNRGDSLTDNLWAEMSLMMVLVVIVLALAWRYVW* |
| Ga0066903_1076047243 | 3300005764 | Tropical Forest Soil | MQIDNKGDSLTDNLWAEMSLMTAVVVILLAILWQFLW* |
| Ga0066665_109809152 | 3300006796 | Soil | MTMQSNNKGDSLTDNLWAEMSLMMVVVVIVLALAWRYVW* |
| Ga0075433_108348061 | 3300006852 | Populus Rhizosphere | MTMQSDNRGDSLTDNLWAEMSLMMVSVVIVLALAWRYVW* |
| Ga0075433_111192513 | 3300006852 | Populus Rhizosphere | MQSNNKGDSLTDNLWAEMSLMMVLVVIVLALAWRYVW* |
| Ga0126374_109307782 | 3300009792 | Tropical Forest Soil | MTMQSDNRGDSLTDNLWAEMSFMMVLVVIVLALAWRYVW* |
| Ga0126380_106391861 | 3300010043 | Tropical Forest Soil | MQIDNKSDSLSDNLWEEMTLMTAVVVILLGILWQFL* |
| Ga0126380_116160151 | 3300010043 | Tropical Forest Soil | EVMTMQIDNKSHSLTDNLWAEMSLMTALVVILLAISWQFL* |
| Ga0126384_100996713 | 3300010046 | Tropical Forest Soil | MQSDNKGNSLTDNLWAEMSLMMVLVVIVLTLAWRYVW* |
| Ga0126384_106397313 | 3300010046 | Tropical Forest Soil | MTMQIDNKSHSLTDNLWAEMSLMTALVVILLAVLWQFL* |
| Ga0126382_100227906 | 3300010047 | Tropical Forest Soil | MHENKDHSLTDNLWAEMSLMMVLVVIVLALAWRYV* |
| Ga0126382_109911923 | 3300010047 | Tropical Forest Soil | MTMQSDNKGDSLTDNLWAEMSLMMVLIVIVLALAWRYVW* |
| Ga0126373_121413561 | 3300010048 | Tropical Forest Soil | MTMQIDNKGESLNANLWAEMSLMMALVVVLLAVFWQFL* |
| Ga0126373_127913161 | 3300010048 | Tropical Forest Soil | MEVMTMQIDNKGESLNANLWAEMSLMMALVVVLLAVFWQFL* |
| Ga0126376_126240081 | 3300010359 | Tropical Forest Soil | MQIDNKDHSLTDNLWAEMSLMMVVVVIILAITWRYVW* |
| Ga0126372_120055481 | 3300010360 | Tropical Forest Soil | MTMQSDNKGDSLTDNLWAEMSLMMVLVVIVLALAWR |
| Ga0126378_103881591 | 3300010361 | Tropical Forest Soil | MQSDNKGDSLTDNLWAEMSLMMVLVVIVLTLAWRYVW* |
| Ga0126378_114774952 | 3300010361 | Tropical Forest Soil | MHENKDHSLTDNLWAEMSLMMVLVVIVLALAWAYVW* |
| Ga0126379_101975115 | 3300010366 | Tropical Forest Soil | MTMQIDNKGESLNANLWAEMSLMMALVVVLLAVFW |
| Ga0126379_105013212 | 3300010366 | Tropical Forest Soil | MQSDNKGDSLTDNLWAEMNLMMVLVVIVLALAWRYVW* |
| Ga0126379_112447443 | 3300010366 | Tropical Forest Soil | GLCVGEVMTMQIDNKNDTLNGNLWAEMSLMTAVVVILLAILWQFLW* |
| Ga0126381_1010897933 | 3300010376 | Tropical Forest Soil | MQSENKGDSLTDNLWAEMSLMMVLVVIVLALAWQYIW* |
| Ga0126381_1029330241 | 3300010376 | Tropical Forest Soil | MHDNKDHSLTDNLWAEMSLMMVLVVIVLALAWRYVW* |
| Ga0126381_1046250802 | 3300010376 | Tropical Forest Soil | MQIDNKNDTLNGNLWAEMSLMTAVVVILLAILWQFLW* |
| Ga0126383_126374401 | 3300010398 | Tropical Forest Soil | RLGQSFVIDNKGDSLTDNLWAEMNLMMVLVVIVLALAWRYVW* |
| Ga0126383_129534452 | 3300010398 | Tropical Forest Soil | MTMQIDNKSDSLSNNLWAEMTLMTALVVILLGILRQFL* |
| Ga0126383_130002823 | 3300010398 | Tropical Forest Soil | VMTMQSDNKGDSLTDNLWAEMSLMMVLAVFVLALAWRYVW* |
| Ga0126383_132237212 | 3300010398 | Tropical Forest Soil | MEVMTMQIDDKGESLNANLWAEMSLMMALVVVLLAVFWQFL* |
| Ga0124850_10221752 | 3300010863 | Tropical Forest Soil | MHSDNRGDSLTDNLWAEMSLMMVLVVIVLALAWRYVW* |
| Ga0124850_10341594 | 3300010863 | Tropical Forest Soil | VGLASSREVMTMHSDNRGDSLTDNLWAEMSLMMVLVVIVLALAWRYVW* |
| Ga0124850_10597081 | 3300010863 | Tropical Forest Soil | MTMQIDNKGDSLTDNLWAEMSLMTALVVILLAILWQFLW* |
| Ga0124844_10356282 | 3300010868 | Tropical Forest Soil | MTMHDNKAHSLTENLWAELSLMTVVVVILIALAWRYVW* |
| Ga0137365_104085993 | 3300012201 | Vadose Zone Soil | MTMRSDNKDNSLTDNLWAEMSLMMVLAVIVLGLAWRYVW* |
| Ga0137374_106831212 | 3300012204 | Vadose Zone Soil | MTHNKDHGLTDNLWAELSLMTAVIVIVMALTWQYVW* |
| Ga0137362_106156712 | 3300012205 | Vadose Zone Soil | MQSNNKGDSLTDNLWAEMSLMMVVVVIVLALAWRYVW* |
| Ga0126369_101064664 | 3300012971 | Tropical Forest Soil | MTMQIDNKGDSLTDNLWAEMSLMTALVVILLAILWQFL* |
| Ga0126369_105288832 | 3300012971 | Tropical Forest Soil | MRGDNKGDSLTDNLWAEMSLMMVLVVIVLALAWRYVW* |
| Ga0126369_112871673 | 3300012971 | Tropical Forest Soil | MTMQIDNKGDSLTDNLWAEMSLMTALVVILLGILWQFL* |
| Ga0126369_126399051 | 3300012971 | Tropical Forest Soil | MQIDNKGDSLNDNLWAEMGLMTALVVILLTILWQFLW* |
| Ga0126369_128418661 | 3300012971 | Tropical Forest Soil | SDNKGDSLTDNLWAEMSLMMVLVVIVLALACRYVW* |
| Ga0126369_133153702 | 3300012971 | Tropical Forest Soil | MTMQSDNKGDSLTDNLWAEMSLMMVLVVIVLGLAWRYVW* |
| Ga0182036_107414274 | 3300016270 | Soil | SLTMQSDHKGDSLTDNLWAEMSLMMVLVVIVLALAWRYVW |
| Ga0182041_107456542 | 3300016294 | Soil | MTMQSNDQGDSLTDNLWAEMSLMMVLVVIVLALAWRYVW |
| Ga0182032_100676722 | 3300016357 | Soil | MQIDNKGDTLNGNLWAEMSLMTAVVVILLTILWQYL |
| Ga0182032_103511921 | 3300016357 | Soil | VEVMTMQIGESLNANLWAEMSLMMALVVVLLAVFWQFL |
| Ga0182032_107248151 | 3300016357 | Soil | MHDNKDHSLTDNLWAEMSLMMVLVLIVLALAWRYVW |
| Ga0182034_112017473 | 3300016371 | Soil | ASSREVMTMQSDNRGDSLTDNLWAEMSLMMVLVVILLALAWRYVW |
| Ga0182040_113121823 | 3300016387 | Soil | SSREVMTMQSDNRGDSLTDNLWAEMSLMMVLVVILLALAWRYVW |
| Ga0182037_113900041 | 3300016404 | Soil | MTMQSDNKGDSLTDNLWAEMSLMMVLVVILLALAWRYVW |
| Ga0182039_122779823 | 3300016422 | Soil | EVMTMQIDNKGESLNANLWAEMSLMMALVVVLLAVFWQFL |
| Ga0126371_102126162 | 3300021560 | Tropical Forest Soil | MTLQSDNKSHSLIDNLWAELGLMTVVIVIVIALAWRYVW |
| Ga0126371_103250582 | 3300021560 | Tropical Forest Soil | MRGDNKGDSLTDNLWAEMSLMMVLVVIVLALAWRYVW |
| Ga0126371_104892052 | 3300021560 | Tropical Forest Soil | MQIDNKGDSLTDNLWAEMSLMTALVVILLAILWQFL |
| Ga0126371_109432482 | 3300021560 | Tropical Forest Soil | MTMQSENKGDSLTDNLWAEMSLMMVLVVIVLALAWQYIW |
| Ga0126371_113466434 | 3300021560 | Tropical Forest Soil | VGEVMTMQIDNKNDTLNGNLWAEMSLMTAVVVILLTILWQFL |
| Ga0209622_10312692 | 3300027502 | Forest Soil | MRSNNKGDSLIDNLWAEMSLMMVLVVIVLALAWRYV |
| Ga0209684_10138585 | 3300027527 | Tropical Forest Soil | MTMQSHHKGHSLTDNLWAEMSLMMVLVVIVLALAWRYVW |
| Ga0209465_101129301 | 3300027874 | Tropical Forest Soil | MQSDNRGDSLTDNLWAEMSLMMVLVVIVLALAWRYVW |
| Ga0318516_100524784 | 3300031543 | Soil | MTMHDNKDHSLTDNLWAEMSLMMVLVVIVLALAWRYVW |
| Ga0318516_100982984 | 3300031543 | Soil | MTMHDNKDHSLTENLWAELSLMTVVVVILIALAWRYVW |
| Ga0318516_106616991 | 3300031543 | Soil | MTMHDNKDLSLTENLWAELSLMTVVVVILIALAWRYVW |
| Ga0318516_106689932 | 3300031543 | Soil | MQSDNKGDSLTDNLWAEMSLMMVLVVIVLTLAWRYVW |
| Ga0318534_102824092 | 3300031544 | Soil | MHDNKDHSLTDNLWAEMSLMMVLVVIVLALAWRYVW |
| Ga0318534_105146962 | 3300031544 | Soil | MTMQSDNKGDSLTDNLWAEMSLMMVLVVIVLTLAWRYVW |
| Ga0318541_100519673 | 3300031545 | Soil | MTMQSDNKGDSLTDNLWAEMSLMMVLVVIVLALAWRYVW |
| Ga0318541_107994472 | 3300031545 | Soil | MIMQIDNKDNSLNDNLWAEMSLMTALVVILLAILWQFLW |
| Ga0318538_101982751 | 3300031546 | Soil | MQIYNKGDSLNDNLWAEMSLMTAVVVIVLAILWQFLW |
| Ga0318573_105543512 | 3300031564 | Soil | MTMQIDNKGDSLTDNLWAEMSLMTAVVVILLAILWQFLW |
| Ga0318515_104735263 | 3300031572 | Soil | TMHDNKDLSLTENLWAELSLMTVVVVILIALAWRYVW |
| Ga0310915_100524723 | 3300031573 | Soil | MTMQIDNKGDGLTDNLWAEMSLMMVLVVIVLALAWRYVW |
| Ga0310915_101385535 | 3300031573 | Soil | MQSDHKGDSLTDNLWAEMSLMMVLVVIVLALAWRYVW |
| Ga0310915_101577742 | 3300031573 | Soil | MQSNNKGDSLTDNLWAEMSLMMVLVVIVLALTWQYVW |
| Ga0310915_101603263 | 3300031573 | Soil | MTMQIDNKADSLNDNLWAEMSLMTALGVIVLAILWQFL |
| Ga0310915_104731701 | 3300031573 | Soil | MTMQIDNKGDSLNDNLWAEMSLMTAVVVIVLAILWQFLW |
| Ga0310915_105111951 | 3300031573 | Soil | MQIDNKGESLNANLWAEMSLMTALVVILLAVFWQFL |
| Ga0310915_105848392 | 3300031573 | Soil | MQSDNKGDSLTDNLWAEMSLMMVLVVIVLALTWRYVW |
| Ga0310915_107089891 | 3300031573 | Soil | GAGLSMEVMTMQIDNKGESLNANLWAEMSLMMALVVVLLAVFWQFL |
| Ga0310915_107704782 | 3300031573 | Soil | MQSDNRGDSLTDNLWAEMSLMMVLLVIVLALAWRYVW |
| Ga0310915_110273081 | 3300031573 | Soil | VGGPEGEVMTMQINNHKSDSLPDNLWAELSLMMALVVILLAIAWQFL |
| Ga0318561_100809371 | 3300031679 | Soil | MQSDNRGDSLTDNLWAEMSLMMVLVVILLALAWRYVW |
| Ga0318560_106602781 | 3300031682 | Soil | GEVMAMQIYNKGDSLNDNLWAEMSLMTAGVVIVLAILWQFL |
| Ga0318496_107725202 | 3300031713 | Soil | PMTMHDNKDHSLTENLWAELSLMTVVVVILIALAWRYVW |
| Ga0306917_114522251 | 3300031719 | Soil | MQIDNKGESLNANLWAEMSLMTALVVILLAVFWQF |
| Ga0307469_103232763 | 3300031720 | Hardwood Forest Soil | MTTQIDNKNDSLNDNLWAEMTLMTAVVVILLAILWQFLW |
| Ga0318501_101543942 | 3300031736 | Soil | MTMQIDNKGDSLTDSLWAEMSLMTALVVILLAILWQF |
| Ga0318501_108688221 | 3300031736 | Soil | MQIDNKGDGLTDNLWAEMSLMMVLVVIVLALAWRYVW |
| Ga0306918_100956711 | 3300031744 | Soil | MTMQIDNKGDSLTDNLWAEMSLMTALVVILLAILWQFLW |
| Ga0306918_101942372 | 3300031744 | Soil | MAMQIDNKGDSLNDNLWAEMSLMTAVVVILLAILWQFLW |
| Ga0306918_111279271 | 3300031744 | Soil | VRSNNKGDSLTDNLWAEMSLMMVLVVIVLALTWQYVW |
| Ga0318537_103039622 | 3300031763 | Soil | CRGMAMQIDNKGDSLNDNLWAEMSLMTAVVVILLAILWQFLW |
| Ga0318509_100915952 | 3300031768 | Soil | MQSDNKGDSLTDNLWAEMNLMMVLVVIVLALAWRYVW |
| Ga0318521_102956451 | 3300031770 | Soil | PEGRSSPMTMHDNKDHSLTENLWAELSLMTVVVVILIALAWRYVW |
| Ga0318543_105654022 | 3300031777 | Soil | MTMQIDNKGDSLKDNLWAEMSLMTALVVILLAVFWQFL |
| Ga0318498_100715914 | 3300031778 | Soil | MQSDNKGDSLTDDLWAEMNLMMVLVVIVLALAWRYVW |
| Ga0318498_103161752 | 3300031778 | Soil | MTMQSDNKGDSLTDNLWAEMSLMMVLVVIVLALAWQYVW |
| Ga0318568_109178751 | 3300031819 | Soil | MQSDNRGDSLTDNLWAEMSLMMVLVVILLALAWRYV |
| Ga0318499_101420361 | 3300031832 | Soil | GLASSREVMTMQSDNRGDSLTDNLWVEMSLMMVLVVIVLALAWRYVW |
| Ga0310917_104983514 | 3300031833 | Soil | EVMTMQSDNRGDSLTDNLWAEMSLMMVLVVIVLALAWRYVW |
| Ga0318511_101978453 | 3300031845 | Soil | GALKPEGRSLTMQSDHKGDSLTDNLWAEMSLMMVLVVIVLALAWRYVW |
| Ga0318511_102316231 | 3300031845 | Soil | TMQSDNRGDSLTDNLWAEMSLMMVLVVILLALAWRYVW |
| Ga0318527_100140413 | 3300031859 | Soil | MTMHDNKDHSLTDNLWAEMSLMMVLVVIVLALAWRYVR |
| Ga0318527_103306081 | 3300031859 | Soil | GLASSREVMTMQSDNRGDSLTDNLWAEMSLMMVLVVIVLALAWRYVW |
| Ga0306919_100143485 | 3300031879 | Soil | MQIDNKGDSLTDNLWAEMSLMTAVVVILLAILWQFLW |
| Ga0306919_100739895 | 3300031879 | Soil | MQSDNKGDSLTDNLWAELSLMMVLVVIVLALAWQYVW |
| Ga0306919_101706723 | 3300031879 | Soil | MTMQIDNKGDSLTDSLWAEMSLMTALVVILLAILWQFLW |
| Ga0306919_107071391 | 3300031879 | Soil | MTMQINNHKSDSLPDNLWAELSLMMALVVILLAIAWQFL |
| Ga0306925_101304083 | 3300031890 | Soil | MAMQIDNKGDSLNDNLWAEMSLMTALVVILLAILWQFLW |
| Ga0306925_101339802 | 3300031890 | Soil | MQIDNTSDSLSDNLWAEMTLMTALVVILLGILWQFL |
| Ga0306925_105986542 | 3300031890 | Soil | MTMQIDNKADSLNDNLWAEMSLMTALVVIVLAILWQFL |
| Ga0306923_101406573 | 3300031910 | Soil | MQINNHKSDSLPDNLWAELSLMMALVVILLAIAWQFL |
| Ga0310916_115579412 | 3300031942 | Soil | MTMQIGESLNANLWAEMSLMMALVVVLLAVFWQFL |
| Ga0310913_104669161 | 3300031945 | Soil | MTMQINNHKSDSLTDNLWAELSLMMALVVILLAIAWQFL |
| Ga0310913_107860784 | 3300031945 | Soil | EVMTMQSDNRGDSVTDNLWAEMSLMVVLVVIVLALAWRYVW |
| Ga0310913_108209752 | 3300031945 | Soil | MTMQIDNKGDSLTDNLWAEMSLMTALVVILRAILWQFLW |
| Ga0310910_100724981 | 3300031946 | Soil | SREVMTMQSDNRGDSLTDNLWAEMSLMMVLVVILLALAWRYVW |
| Ga0310910_100785034 | 3300031946 | Soil | MQIDNKGDSLNDNLWAEMSLMTAVVVIVLAILWQFLW |
| Ga0310909_105960562 | 3300031947 | Soil | VMTMQIDNKGESLNANLWAEMSLMTALVVILLAVFWQFL |
| Ga0310909_106827432 | 3300031947 | Soil | MQIDNKGDNLADNLWAEMSLMAVLVVILLAILWQFLW |
| Ga0306926_104906672 | 3300031954 | Soil | MTVRSNNKGDSLTDNLWAEMSLMMVLVVIVLALTWQYVW |
| Ga0306926_109542882 | 3300031954 | Soil | MQIDNKADSLNDNLWAEMSLMTALVVIVLAILWQFL |
| Ga0318531_104015581 | 3300031981 | Soil | MTMHDNKDLSLTENLWAELSLMTVVVVILIALAWRY |
| Ga0306922_101665792 | 3300032001 | Soil | MQIDNKSDSLSDNLWEEMTLMTAVVVILLGILRQFL |
| Ga0306922_110591103 | 3300032001 | Soil | MTMQSDNKGDSLTDDLWAEMNLMMVLVVIVLALAWRYVW |
| Ga0306922_111111683 | 3300032001 | Soil | MTMHDNKDHSLTENLWAELSLMTVVVVILIALAWRYV |
| Ga0318569_104080231 | 3300032010 | Soil | MTMHDNKDHSLTDNLWAEMSLMMVLVVIVLALALGSEPG |
| Ga0318506_102587282 | 3300032052 | Soil | MTMHDNKDLSLTENLWAELSLMSVVVVILIALAWRYVW |
| Ga0318505_102399461 | 3300032060 | Soil | MQSDNRGDSLTDNLWAEMSLMMVLVVIVLALAWRYV |
| Ga0318510_103317651 | 3300032064 | Soil | GRSSPMTMHDNKDLSLTENLWAELSLMTVVVVILIALAWRYVW |
| Ga0306924_115021341 | 3300032076 | Soil | QIYNKGDSLNDNLWAEMSLMTAVVVIVLAILWQFLW |
| Ga0318518_101047542 | 3300032090 | Soil | MQIDNKGDSLNDNLWAEMSLMTAVVVILLAILWQFLW |
| Ga0306920_1003923593 | 3300032261 | Soil | MHIDNKDHSLTDNLWAEMSLMMVLVVIILAITWRYVW |
| Ga0306920_1006132403 | 3300032261 | Soil | MTMQIDNKNDTLNGNLWAEMSLMTAVVVILLTILWQFL |
| Ga0306920_1011363672 | 3300032261 | Soil | MQIDNKGDSLNDNLLAEMCWMTAVVAILLAILWQFLW |
| Ga0306920_1030938842 | 3300032261 | Soil | MTMHDNKDHSLTDNLWAEMSLMMVLVLIVLALAWRYVW |
| Ga0306920_1038878281 | 3300032261 | Soil | EVMTMQSDNKGDSLTDDLWAEMNLMMVLVVIVLALAWRYVW |
| Ga0310914_116574131 | 3300033289 | Soil | MEVMTMQIDNKGDTLNGNLWAEMSLMTAVVVILLWQFL |
| ⦗Top⦘ |