| Basic Information | |
|---|---|
| Family ID | F031801 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 181 |
| Average Sequence Length | 44 residues |
| Representative Sequence | IGVDFHLREVRGALEDILRLGSANIPDLWLSDEEMLEKGLVES |
| Number of Associated Samples | 139 |
| Number of Associated Scaffolds | 181 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.55 % |
| % of genes near scaffold ends (potentially truncated) | 98.34 % |
| % of genes from short scaffolds (< 2000 bps) | 88.95 % |
| Associated GOLD sequencing projects | 128 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (97.790 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (26.519 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.624 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.276 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 55.81% β-sheet: 0.00% Coil/Unstructured: 44.19% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 181 Family Scaffolds |
|---|---|---|
| PF14257 | DUF4349 | 10.50 |
| PF03544 | TonB_C | 4.42 |
| PF01145 | Band_7 | 3.31 |
| PF04748 | Polysacc_deac_2 | 3.31 |
| PF06877 | RraB | 2.76 |
| PF01541 | GIY-YIG | 2.21 |
| PF13620 | CarboxypepD_reg | 1.66 |
| PF05569 | Peptidase_M56 | 1.66 |
| PF01841 | Transglut_core | 1.10 |
| PF11706 | zf-CGNR | 1.10 |
| PF07007 | LprI | 1.10 |
| PF02867 | Ribonuc_red_lgC | 0.55 |
| PF01370 | Epimerase | 0.55 |
| PF03683 | UPF0175 | 0.55 |
| PF00487 | FA_desaturase | 0.55 |
| PF13358 | DDE_3 | 0.55 |
| PF13229 | Beta_helix | 0.55 |
| PF03965 | Penicillinase_R | 0.55 |
| PF00872 | Transposase_mut | 0.55 |
| PF05163 | DinB | 0.55 |
| PF12796 | Ank_2 | 0.55 |
| PF03572 | Peptidase_S41 | 0.55 |
| PF07609 | DUF1572 | 0.55 |
| PF08486 | SpoIID | 0.55 |
| PF07228 | SpoIIE | 0.55 |
| PF06764 | DUF1223 | 0.55 |
| PF14833 | NAD_binding_11 | 0.55 |
| PF13847 | Methyltransf_31 | 0.55 |
| PF14294 | DUF4372 | 0.55 |
| COG ID | Name | Functional Category | % Frequency in 181 Family Scaffolds |
|---|---|---|---|
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 4.42 |
| COG2861 | Uncharacterized conserved protein YibQ, putative polysaccharide deacetylase 2 family | Carbohydrate transport and metabolism [G] | 3.31 |
| COG3076 | Regulator of RNase E activity RraB | Translation, ribosomal structure and biogenesis [J] | 2.76 |
| COG3755 | Uncharacterized conserved protein YecT, DUF1311 family | Function unknown [S] | 1.10 |
| COG0209 | Ribonucleotide reductase alpha subunit | Nucleotide transport and metabolism [F] | 0.55 |
| COG0793 | C-terminal processing protease CtpA/Prc, contains a PDZ domain | Posttranslational modification, protein turnover, chaperones [O] | 0.55 |
| COG1398 | Fatty-acid desaturase | Lipid transport and metabolism [I] | 0.55 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.55 |
| COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.55 |
| COG2385 | Peptidoglycan hydrolase (amidase) enhancer domain SpoIID | Cell wall/membrane/envelope biogenesis [M] | 0.55 |
| COG2886 | Predicted antitoxin, contains HTH domain | General function prediction only [R] | 0.55 |
| COG3239 | Fatty acid desaturase | Lipid transport and metabolism [I] | 0.55 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.55 |
| COG3682 | Transcriptional regulator, CopY/TcrY family | Transcription [K] | 0.55 |
| COG5429 | Uncharacterized conserved protein, DUF1223 domain | Function unknown [S] | 0.55 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.79 % |
| Unclassified | root | N/A | 2.21 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001089|JGI12683J13190_1003727 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1918 | Open in IMG/M |
| 3300002914|JGI25617J43924_10112117 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 967 | Open in IMG/M |
| 3300003218|JGI26339J46600_10031392 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1494 | Open in IMG/M |
| 3300004092|Ga0062389_104572986 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
| 3300004152|Ga0062386_100179507 | All Organisms → cellular organisms → Bacteria | 1661 | Open in IMG/M |
| 3300004635|Ga0062388_102416418 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
| 3300005334|Ga0068869_100276377 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1349 | Open in IMG/M |
| 3300005537|Ga0070730_10115667 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1842 | Open in IMG/M |
| 3300005610|Ga0070763_10123513 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1329 | Open in IMG/M |
| 3300005842|Ga0068858_101203184 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 745 | Open in IMG/M |
| 3300006031|Ga0066651_10439030 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 693 | Open in IMG/M |
| 3300006046|Ga0066652_101633964 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 591 | Open in IMG/M |
| 3300006797|Ga0066659_10002067 | All Organisms → cellular organisms → Bacteria | 9078 | Open in IMG/M |
| 3300007258|Ga0099793_10071548 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1569 | Open in IMG/M |
| 3300007258|Ga0099793_10253696 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 849 | Open in IMG/M |
| 3300007258|Ga0099793_10300170 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 780 | Open in IMG/M |
| 3300007265|Ga0099794_10022464 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2876 | Open in IMG/M |
| 3300007265|Ga0099794_10279132 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 864 | Open in IMG/M |
| 3300009088|Ga0099830_10306826 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1268 | Open in IMG/M |
| 3300009088|Ga0099830_11040670 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 678 | Open in IMG/M |
| 3300009137|Ga0066709_101206704 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1113 | Open in IMG/M |
| 3300009520|Ga0116214_1405444 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
| 3300009764|Ga0116134_1053004 | Not Available | 1545 | Open in IMG/M |
| 3300009792|Ga0126374_10163750 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1365 | Open in IMG/M |
| 3300010046|Ga0126384_11291359 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 676 | Open in IMG/M |
| 3300010047|Ga0126382_11336845 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 650 | Open in IMG/M |
| 3300010048|Ga0126373_10100552 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2673 | Open in IMG/M |
| 3300010048|Ga0126373_11640920 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 707 | Open in IMG/M |
| 3300010320|Ga0134109_10225384 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 699 | Open in IMG/M |
| 3300010341|Ga0074045_10199941 | All Organisms → cellular organisms → Bacteria | 1339 | Open in IMG/M |
| 3300010343|Ga0074044_10393552 | All Organisms → cellular organisms → Bacteria | 908 | Open in IMG/M |
| 3300010343|Ga0074044_10900885 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 578 | Open in IMG/M |
| 3300010361|Ga0126378_10747297 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1089 | Open in IMG/M |
| 3300010364|Ga0134066_10003522 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2753 | Open in IMG/M |
| 3300010366|Ga0126379_11542659 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 770 | Open in IMG/M |
| 3300010376|Ga0126381_100896942 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1276 | Open in IMG/M |
| 3300011270|Ga0137391_10641032 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 887 | Open in IMG/M |
| 3300011271|Ga0137393_10642801 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 909 | Open in IMG/M |
| 3300011271|Ga0137393_11049102 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 693 | Open in IMG/M |
| 3300012096|Ga0137389_10248719 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1494 | Open in IMG/M |
| 3300012096|Ga0137389_10625909 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 925 | Open in IMG/M |
| 3300012096|Ga0137389_10783193 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 819 | Open in IMG/M |
| 3300012200|Ga0137382_10178781 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1451 | Open in IMG/M |
| 3300012202|Ga0137363_10141547 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1880 | Open in IMG/M |
| 3300012202|Ga0137363_10618822 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 915 | Open in IMG/M |
| 3300012202|Ga0137363_10668589 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 878 | Open in IMG/M |
| 3300012205|Ga0137362_10461612 | Not Available | 1099 | Open in IMG/M |
| 3300012205|Ga0137362_11456545 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 571 | Open in IMG/M |
| 3300012209|Ga0137379_10165389 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2124 | Open in IMG/M |
| 3300012211|Ga0137377_10183660 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2008 | Open in IMG/M |
| 3300012211|Ga0137377_10612348 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1026 | Open in IMG/M |
| 3300012357|Ga0137384_11187033 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 607 | Open in IMG/M |
| 3300012362|Ga0137361_10034616 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4041 | Open in IMG/M |
| 3300012363|Ga0137390_10561894 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1111 | Open in IMG/M |
| 3300012363|Ga0137390_10754842 | All Organisms → cellular organisms → Bacteria | 933 | Open in IMG/M |
| 3300012582|Ga0137358_11032190 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 530 | Open in IMG/M |
| 3300012923|Ga0137359_10570671 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 994 | Open in IMG/M |
| 3300012925|Ga0137419_10125818 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1817 | Open in IMG/M |
| 3300012925|Ga0137419_11763650 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
| 3300012927|Ga0137416_11528177 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 607 | Open in IMG/M |
| 3300012929|Ga0137404_10685978 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 926 | Open in IMG/M |
| 3300012930|Ga0137407_10459229 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1186 | Open in IMG/M |
| 3300012930|Ga0137407_11718036 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 598 | Open in IMG/M |
| 3300012931|Ga0153915_10502998 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1385 | Open in IMG/M |
| 3300012971|Ga0126369_12235819 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 634 | Open in IMG/M |
| 3300012984|Ga0164309_11320283 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 611 | Open in IMG/M |
| 3300014150|Ga0134081_10241352 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 628 | Open in IMG/M |
| 3300015054|Ga0137420_1185181 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1342 | Open in IMG/M |
| 3300015241|Ga0137418_10209155 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1681 | Open in IMG/M |
| 3300016294|Ga0182041_11115638 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 717 | Open in IMG/M |
| 3300016371|Ga0182034_10158604 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1708 | Open in IMG/M |
| 3300016404|Ga0182037_10274271 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1344 | Open in IMG/M |
| 3300017822|Ga0187802_10045727 | All Organisms → cellular organisms → Bacteria | 1592 | Open in IMG/M |
| 3300017822|Ga0187802_10428155 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
| 3300017955|Ga0187817_10464370 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 808 | Open in IMG/M |
| 3300017972|Ga0187781_10004281 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 10657 | Open in IMG/M |
| 3300017974|Ga0187777_10620026 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 763 | Open in IMG/M |
| 3300017974|Ga0187777_11432743 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
| 3300017993|Ga0187823_10339338 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 532 | Open in IMG/M |
| 3300017995|Ga0187816_10057706 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1631 | Open in IMG/M |
| 3300018018|Ga0187886_1365449 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
| 3300018030|Ga0187869_10487123 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 586 | Open in IMG/M |
| 3300018058|Ga0187766_10306506 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1030 | Open in IMG/M |
| 3300018088|Ga0187771_10265737 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1433 | Open in IMG/M |
| 3300018090|Ga0187770_11708833 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
| 3300020199|Ga0179592_10185782 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 945 | Open in IMG/M |
| 3300020580|Ga0210403_10030166 | All Organisms → cellular organisms → Bacteria | 4331 | Open in IMG/M |
| 3300020580|Ga0210403_10188639 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1691 | Open in IMG/M |
| 3300020580|Ga0210403_11325165 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300020581|Ga0210399_10128783 | All Organisms → cellular organisms → Bacteria | 2083 | Open in IMG/M |
| 3300020581|Ga0210399_10857535 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 739 | Open in IMG/M |
| 3300020581|Ga0210399_11157833 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 616 | Open in IMG/M |
| 3300020583|Ga0210401_10209628 | All Organisms → cellular organisms → Bacteria | 1806 | Open in IMG/M |
| 3300020583|Ga0210401_10535169 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1034 | Open in IMG/M |
| 3300021046|Ga0215015_10407199 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
| 3300021086|Ga0179596_10468212 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 638 | Open in IMG/M |
| 3300021088|Ga0210404_10403522 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 764 | Open in IMG/M |
| 3300021168|Ga0210406_10997904 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 623 | Open in IMG/M |
| 3300021405|Ga0210387_10603206 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 975 | Open in IMG/M |
| 3300021405|Ga0210387_11693287 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 536 | Open in IMG/M |
| 3300021406|Ga0210386_10563101 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 985 | Open in IMG/M |
| 3300021420|Ga0210394_11437651 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 585 | Open in IMG/M |
| 3300021433|Ga0210391_10130274 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1980 | Open in IMG/M |
| 3300021433|Ga0210391_10548268 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 908 | Open in IMG/M |
| 3300021477|Ga0210398_11003789 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 666 | Open in IMG/M |
| 3300021478|Ga0210402_10258425 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1609 | Open in IMG/M |
| 3300021478|Ga0210402_10295286 | All Organisms → cellular organisms → Bacteria | 1499 | Open in IMG/M |
| 3300021479|Ga0210410_10244799 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1608 | Open in IMG/M |
| 3300021559|Ga0210409_10261057 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1567 | Open in IMG/M |
| 3300021559|Ga0210409_10799046 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 816 | Open in IMG/M |
| 3300021560|Ga0126371_10964764 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 995 | Open in IMG/M |
| 3300021560|Ga0126371_11508866 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 800 | Open in IMG/M |
| 3300024181|Ga0247693_1031289 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 735 | Open in IMG/M |
| 3300025459|Ga0208689_1002123 | All Organisms → cellular organisms → Bacteria | 9626 | Open in IMG/M |
| 3300025480|Ga0208688_1027795 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1379 | Open in IMG/M |
| 3300025915|Ga0207693_10249723 | All Organisms → cellular organisms → Bacteria | 1392 | Open in IMG/M |
| 3300025939|Ga0207665_10352732 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1111 | Open in IMG/M |
| 3300026281|Ga0209863_10078298 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 975 | Open in IMG/M |
| 3300026306|Ga0209468_1000126 | All Organisms → cellular organisms → Bacteria | 36619 | Open in IMG/M |
| 3300026316|Ga0209155_1001230 | All Organisms → cellular organisms → Bacteria | 12171 | Open in IMG/M |
| 3300026499|Ga0257181_1081076 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 563 | Open in IMG/M |
| 3300026528|Ga0209378_1144348 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 968 | Open in IMG/M |
| 3300026529|Ga0209806_1053977 | Not Available | 1874 | Open in IMG/M |
| 3300026530|Ga0209807_1334798 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
| 3300026551|Ga0209648_10045159 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3797 | Open in IMG/M |
| 3300026551|Ga0209648_10156757 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1790 | Open in IMG/M |
| 3300026551|Ga0209648_10688083 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 558 | Open in IMG/M |
| 3300026557|Ga0179587_10595555 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 727 | Open in IMG/M |
| 3300026845|Ga0207760_111197 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 742 | Open in IMG/M |
| 3300026854|Ga0207727_123450 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 545 | Open in IMG/M |
| 3300027381|Ga0208983_1062343 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 712 | Open in IMG/M |
| 3300027432|Ga0209421_1010498 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1743 | Open in IMG/M |
| 3300027568|Ga0208042_1176702 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
| 3300027583|Ga0209527_1017429 | Not Available | 1571 | Open in IMG/M |
| 3300027591|Ga0209733_1165570 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 530 | Open in IMG/M |
| 3300027643|Ga0209076_1073888 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 970 | Open in IMG/M |
| 3300027645|Ga0209117_1068317 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1016 | Open in IMG/M |
| 3300027667|Ga0209009_1169555 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophobacteraceae → unclassified Syntrophobacteraceae → Syntrophobacteraceae bacterium | 555 | Open in IMG/M |
| 3300027671|Ga0209588_1193585 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 635 | Open in IMG/M |
| 3300027787|Ga0209074_10284440 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 655 | Open in IMG/M |
| 3300027862|Ga0209701_10167267 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1332 | Open in IMG/M |
| 3300027862|Ga0209701_10194587 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1212 | Open in IMG/M |
| 3300027862|Ga0209701_10660223 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 545 | Open in IMG/M |
| 3300027875|Ga0209283_10038956 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2991 | Open in IMG/M |
| 3300027875|Ga0209283_10314930 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1031 | Open in IMG/M |
| 3300027875|Ga0209283_10398784 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 897 | Open in IMG/M |
| 3300027911|Ga0209698_11316597 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
| 3300028016|Ga0265354_1000061 | All Organisms → cellular organisms → Bacteria | 17996 | Open in IMG/M |
| 3300028047|Ga0209526_10239651 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1244 | Open in IMG/M |
| 3300028536|Ga0137415_10732209 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 800 | Open in IMG/M |
| 3300028906|Ga0308309_11327041 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300030776|Ga0075396_1801863 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1112 | Open in IMG/M |
| 3300030991|Ga0073994_10038708 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 765 | Open in IMG/M |
| 3300030991|Ga0073994_10039315 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 797 | Open in IMG/M |
| 3300030991|Ga0073994_10069125 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
| 3300030991|Ga0073994_10083621 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 561 | Open in IMG/M |
| 3300031057|Ga0170834_107865652 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6734 | Open in IMG/M |
| 3300031545|Ga0318541_10456082 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 715 | Open in IMG/M |
| 3300031668|Ga0318542_10222931 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 954 | Open in IMG/M |
| 3300031668|Ga0318542_10500354 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 632 | Open in IMG/M |
| 3300031682|Ga0318560_10250673 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 951 | Open in IMG/M |
| 3300031736|Ga0318501_10449033 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 700 | Open in IMG/M |
| 3300031744|Ga0306918_10950063 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 669 | Open in IMG/M |
| 3300031753|Ga0307477_10335326 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1041 | Open in IMG/M |
| 3300031754|Ga0307475_11129715 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 612 | Open in IMG/M |
| 3300031912|Ga0306921_11030963 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 926 | Open in IMG/M |
| 3300031912|Ga0306921_12063891 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 605 | Open in IMG/M |
| 3300031942|Ga0310916_10001850 | All Organisms → cellular organisms → Bacteria | 12701 | Open in IMG/M |
| 3300031942|Ga0310916_10999275 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 698 | Open in IMG/M |
| 3300031954|Ga0306926_10186849 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2571 | Open in IMG/M |
| 3300031981|Ga0318531_10389988 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 630 | Open in IMG/M |
| 3300032035|Ga0310911_10728301 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 574 | Open in IMG/M |
| 3300032180|Ga0307471_100660288 | All Organisms → cellular organisms → Bacteria | 1208 | Open in IMG/M |
| 3300032180|Ga0307471_100672949 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1198 | Open in IMG/M |
| 3300032782|Ga0335082_10829989 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 786 | Open in IMG/M |
| 3300032782|Ga0335082_10977794 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 710 | Open in IMG/M |
| 3300032783|Ga0335079_11176910 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 772 | Open in IMG/M |
| 3300032897|Ga0335071_10039606 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4665 | Open in IMG/M |
| 3300032954|Ga0335083_10331154 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1325 | Open in IMG/M |
| 3300033290|Ga0318519_10946908 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
| 3300033405|Ga0326727_10588790 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 931 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 26.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 21.55% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.08% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.87% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.31% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.76% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.76% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.76% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.21% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.21% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.66% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.66% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.66% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.10% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.10% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.10% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.10% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.10% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.10% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.55% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.55% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.55% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.55% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.55% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.55% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.55% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.55% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.55% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.55% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.55% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001089 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300003218 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018018 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_150 | Environmental | Open in IMG/M |
| 3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024181 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK34 | Environmental | Open in IMG/M |
| 3300025459 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025480 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026281 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes) | Environmental | Open in IMG/M |
| 3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
| 3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
| 3300026499 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-B | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026845 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 24 (SPAdes) | Environmental | Open in IMG/M |
| 3300026854 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 48 (SPAdes) | Environmental | Open in IMG/M |
| 3300027381 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027432 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027568 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027583 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Host-Associated | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030776 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA10 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12683J13190_10037271 | 3300001089 | Forest Soil | ERIGVDFHLREVRGALEDILRLGSANIPDLWLSDEEMLEKGLVES* |
| JGI25617J43924_101121173 | 3300002914 | Grasslands Soil | LIELLERIGVDFHLREVRGALEDILRLGSANIPDLWLSDEEMLEKGLVET* |
| JGI26339J46600_100313921 | 3300003218 | Bog Forest Soil | DFRLREVRGALEDILRLGSANIPDLWLSDEEMLEKGLVET* |
| Ga0062389_1045729862 | 3300004092 | Bog Forest Soil | IDLLERVGVDFHLREVRGALEDILRLGSANIPDLWLSDDDMLEKGLVQS* |
| Ga0062386_1001795073 | 3300004152 | Bog Forest Soil | IDLLGKIGVDFRLREVRGALEDILRLGSANIPDLWLSDEEMLERGLVET* |
| Ga0062388_1024164181 | 3300004635 | Bog Forest Soil | GVDFHLREVRGALEDILRLGSANIPDLWLSDDDMLEKGLVQS* |
| Ga0068869_1002763772 | 3300005334 | Miscanthus Rhizosphere | FRSSEVRGALEDILRLGSANIPDLWLSDEEMLRKGLVEG* |
| Ga0070730_101156671 | 3300005537 | Surface Soil | FHLREVRGALEDILRLGSANIPDLWLSDEEILEKGLVES* |
| Ga0070763_101235131 | 3300005610 | Soil | EVRGALEDILRLGSANIPDLWLSDEELLAKGLVES* |
| Ga0068858_1012031841 | 3300005842 | Switchgrass Rhizosphere | LERIGVDFRLREVRGALEDILRLGSANIPDLWLSDDEMLERGLVEG* |
| Ga0066651_104390301 | 3300006031 | Soil | IGVDFRLGDVRGALEDILRLGSANIPDLWLSDEEMLEKGLVES* |
| Ga0066652_1016339641 | 3300006046 | Soil | EVRGALEDILRLGSANFPDLWLSDEEMLEKGLVES* |
| Ga0066659_100020671 | 3300006797 | Soil | RALIELLERIGVDFHLREVRGALEDILRLGSANLPDLWLSDEEMLEKGLVEW* |
| Ga0099793_100715481 | 3300007258 | Vadose Zone Soil | KPVPAEGAQALIELLERIGVDFHLREVRGALEDILRLGSANIPDLWLSDEEMLEKGLVES |
| Ga0099793_102536961 | 3300007258 | Vadose Zone Soil | GGGFILKKERGALEDILRLGSANIPDLWLSDEELLAKGLVES* |
| Ga0099793_103001702 | 3300007258 | Vadose Zone Soil | EGAQALIELLERIGVDFHLREVRGALEDILRLGSANIPDLWLSDEEMLEKGLVES* |
| Ga0099794_100224641 | 3300007265 | Vadose Zone Soil | QQLIELLERIGVDFHLREVRGALEDILRLGSANIPDLWLSDEEMLEKGLVES* |
| Ga0099794_102791321 | 3300007265 | Vadose Zone Soil | QQLIELLERIGVDFHLREVRGALEDILRLGSANIPDLWLSDEEMMEKGLVES* |
| Ga0099830_103068261 | 3300009088 | Vadose Zone Soil | LLERIGVDFHLREVRGALEDILRLGSANIPDLWLSDEEMLEKGLVES* |
| Ga0099830_110406701 | 3300009088 | Vadose Zone Soil | LERIGVDFHLREVRGALEDILRLGSANIPDLWLSDEEMLEKGLVES* |
| Ga0066709_1012067043 | 3300009137 | Grasslands Soil | EAVGAQALIELLERIGVDFHLREVRGALEDILRLGSANIPGLWLTDEEILERGLVES* |
| Ga0116214_14054442 | 3300009520 | Peatlands Soil | DFRLREVRGALEDILRLGSANIPDLWLSDEEILEKGLVET* |
| Ga0116134_10530042 | 3300009764 | Peatland | SLIDLLGKIGVDFRLREVRGALEDILRLGSANIPDLWLSDEEMLEKGLVET* |
| Ga0126374_101637504 | 3300009792 | Tropical Forest Soil | DFRLREVRGALEDILRLGSANIPDLWLSDEELLEKGLVEG* |
| Ga0126384_112913591 | 3300010046 | Tropical Forest Soil | ELLERIGVDFHLREVRGALEDILRLGSANIPDLWLSDEEMLEKGLVEG* |
| Ga0126382_113368451 | 3300010047 | Tropical Forest Soil | RIGVDFHLREVRGALEDILRLGSANIPDLWLSDEEILEKGLIESA* |
| Ga0126373_101005524 | 3300010048 | Tropical Forest Soil | LIELLEQIGVDFHLREVRGALEDILRLGSANIPDLWLTDEEILEKGLVEG* |
| Ga0126373_116409202 | 3300010048 | Tropical Forest Soil | LIELLEQIGVDFHLREVRGALEDILRLGSANIPDLWLTDEEVLEKGLVEG* |
| Ga0134109_102253841 | 3300010320 | Grasslands Soil | LIELLERIGVDFHLREVRGALEDILRLGSANFPDLWLSDEEMLEKGLVES* |
| Ga0074045_101999414 | 3300010341 | Bog Forest Soil | DFRLREVRGALEDILRLGSANIPDLWLSDEEMLERGLVETY* |
| Ga0074044_103935522 | 3300010343 | Bog Forest Soil | GVDFGLAEVRGALEDILRLGSANIPDLWLSDEEMLEKGLVEG* |
| Ga0074044_109008851 | 3300010343 | Bog Forest Soil | LREVRGALEDILRLGSANIPDLWLSDDEMLERGLVEG* |
| Ga0126378_107472973 | 3300010361 | Tropical Forest Soil | ALLELLERIGVDFHLREVRGALEDILRLGSANIPDLWLTDEEILEKGLGES* |
| Ga0134066_100035225 | 3300010364 | Grasslands Soil | QALIELLERIGVDFHLREVRGALKDILRLGSANIPGLWLTDEEILEKGLVES* |
| Ga0126379_115426592 | 3300010366 | Tropical Forest Soil | LEKVGVDFHLREVRGALEDILRLGSANIPDLWLSDEELIESGMVQT* |
| Ga0126381_1008969423 | 3300010376 | Tropical Forest Soil | LERIGVDFHLREVRGALEDILRLGSANIPDLWLTDEEILEKGLVES* |
| Ga0137391_106410321 | 3300011270 | Vadose Zone Soil | LLERIGVDFHLREVRGALEDILRLGSANIPDLWLSDEEMLEKGLVET* |
| Ga0137393_106428012 | 3300011271 | Vadose Zone Soil | VDFHLAEVRGALEDILRLGSANIPDLWLSDEEMLEKGLVEG* |
| Ga0137393_110491021 | 3300011271 | Vadose Zone Soil | LAEVRGALEDILRLGSANIPDLWLSDEEMLEKGLVES* |
| Ga0137389_102487193 | 3300012096 | Vadose Zone Soil | GVDFHLAEVRGALEDILRLGSANIPDLWLSDEEMLEKGLVEG* |
| Ga0137389_106259093 | 3300012096 | Vadose Zone Soil | EVRGALEDILRLGSANIPALWLSDEEMLEKGLVEE* |
| Ga0137389_107831931 | 3300012096 | Vadose Zone Soil | ERIGVDFRLAEVRGALEDILRLGSANIPDLWLSDEEMLEKGLVEQ* |
| Ga0137382_101787811 | 3300012200 | Vadose Zone Soil | FHLREVRGALEDILRLGSANIPDLWLSDEEMLEKGLVEG* |
| Ga0137363_101415473 | 3300012202 | Vadose Zone Soil | EVRGALEDILRLGSANIPDLWLSDEELLEKGLVES* |
| Ga0137363_106188222 | 3300012202 | Vadose Zone Soil | LAEVRGALEDILRLGSANIPDLWLSDEEMLEKGLVEG* |
| Ga0137363_106685891 | 3300012202 | Vadose Zone Soil | RLREVRGALEDILRLGSANIPDLWLSDEELLAKGLVES* |
| Ga0137362_104616122 | 3300012205 | Vadose Zone Soil | EVRGALEDILRLGSANIPDLWLSDEEMLEKGLVEG* |
| Ga0137362_114565452 | 3300012205 | Vadose Zone Soil | AEVRGALEDILRLGSANIPDLWLSDEEMLEKGLVEG* |
| Ga0137379_101653895 | 3300012209 | Vadose Zone Soil | ELLERIGVDFSLSEVRGAMEDILRLGSANIPDLWLSDEEMLEKGLVES* |
| Ga0137377_101836601 | 3300012211 | Vadose Zone Soil | QALIELLERIGVDFHLREVRGALEDILRLGSANIPDLWLSDEEMLEKGLVEG* |
| Ga0137377_106123483 | 3300012211 | Vadose Zone Soil | QALIELLERIGVDFHLREVRGALEDILRLGSANIPDLWLSEDRTGEQVD* |
| Ga0137384_111870331 | 3300012357 | Vadose Zone Soil | IELLERIGVNFHLHEVRGALQDIFRLGSANIPDLWLSDEEILEKGLVEQ* |
| Ga0137361_100346161 | 3300012362 | Vadose Zone Soil | VRGAMEDILRLGSANIPDLWLSDEEILEKGLVES* |
| Ga0137390_105618941 | 3300012363 | Vadose Zone Soil | QALIELLERIGVDFHLREVRGALEDILRLGSANIPDLWLSDEEMVEKGLVEG* |
| Ga0137390_107548422 | 3300012363 | Vadose Zone Soil | GVDFRLSEVRGALEDILRLGSANIPDLWLSDEEMLEKGLVES* |
| Ga0137358_110321901 | 3300012582 | Vadose Zone Soil | MLERVGVDFRLREVRGALEDILRLGSANIPDLWLSDEELLAKGLVES* |
| Ga0137359_105706711 | 3300012923 | Vadose Zone Soil | PALAEGAQALIELLERIGVDFHLREVRGALEDILRLGSANIPDLWLSDEEMLEKGLVES* |
| Ga0137419_101258183 | 3300012925 | Vadose Zone Soil | SAEGAQALIELLERIGVDFHLREVRGALEDILRLGSANIPDLWLSDEEMLEKGLVES* |
| Ga0137419_117636501 | 3300012925 | Vadose Zone Soil | LERIGVDFRLCEVRGALEDILRLGSANIPDLWRSDEEMLEKGLVEG* |
| Ga0137416_115281771 | 3300012927 | Vadose Zone Soil | DFHLREVRGALEDILRLGSANIPDLWLSDEEMLEKGLVEQ* |
| Ga0137404_106859781 | 3300012929 | Vadose Zone Soil | HLREVRGALEDILRLGSANIPDLWLSDEELLAKGLVES* |
| Ga0137407_104592291 | 3300012930 | Vadose Zone Soil | RIGVDFHLAEVRGALEDILRLGSANIPDLWLSDEEMLEKGLVEG* |
| Ga0137407_117180362 | 3300012930 | Vadose Zone Soil | LERIGVNFQLAEVRGALEDILRLGSANIPDLWLSDEEMLEKGLVEG* |
| Ga0153915_105029981 | 3300012931 | Freshwater Wetlands | VDFRHLEVRGALEDILRLGSANIPDLWLSDEELLAKGLVES* |
| Ga0126369_122358191 | 3300012971 | Tropical Forest Soil | VRGALDDILRLGSANIPDLWLSDDELLARGLIEA* |
| Ga0164309_113202832 | 3300012984 | Soil | VRGALEDILRLGSANIPDLWLSDEEMLEKGLVES* |
| Ga0134081_102413522 | 3300014150 | Grasslands Soil | VLAEGARALIELLEGIGLDFHLREVRGALEDILRLGSANIPDLWLSDEEMFEKGLVEW* |
| Ga0137420_11851815 | 3300015054 | Vadose Zone Soil | ELLERIGVDFHLAEVRGALEDILRLGSANIPDLWLSDEEILEKGLVES* |
| Ga0137418_102091552 | 3300015241 | Vadose Zone Soil | FRIGEVRGALEDSLRLGSANIRGRWLSDEEMLEKGLVEG* |
| Ga0182041_111156382 | 3300016294 | Soil | LREVRGALEDILRLGSANIPDLWLSDEEMLEKGLVDV |
| Ga0182034_101586041 | 3300016371 | Soil | ALIDLLEKVGVDFHLREVRGALEDILRLGSANIPDLWLSDEELIESGMVQT |
| Ga0182037_102742714 | 3300016404 | Soil | GAQALIDLLEKVGVDFHLREVRGALEDILRLGSANIPDLWLSDEELIESGMVQT |
| Ga0187802_100457272 | 3300017822 | Freshwater Sediment | MLAEGAQALIDLLEKVGVDFHLREVRGALEDILRLGSANIPDLWLSDEELVENGMIQT |
| Ga0187802_104281551 | 3300017822 | Freshwater Sediment | EGAQALIDLLEKVGVDFHLREVRGALEDILRLGSANIPDLWLSDEELIENGMIQT |
| Ga0187817_104643702 | 3300017955 | Freshwater Sediment | IGVDFRLREVRGALEDILRLGSANIPDLWLSDDEMLERGLVEG |
| Ga0187781_100042811 | 3300017972 | Tropical Peatland | LREVRGALEDILRLGSANIPDLWLSDDELLEKGLVET |
| Ga0187777_106200261 | 3300017974 | Tropical Peatland | IGVDFRLREVRGALEDILRLGSANIPDLWLSDEELLEKGMIQT |
| Ga0187777_114327431 | 3300017974 | Tropical Peatland | LEKIGVDFRLREVRGALEDILRLGSANIPDLWLSDEELLEKGMIQT |
| Ga0187823_103393381 | 3300017993 | Freshwater Sediment | ARAEVRGALEDILRLGSANIPDLWLSDEEMLEKGLVEG |
| Ga0187816_100577062 | 3300017995 | Freshwater Sediment | DLLEKIGVDFRLREVRGALEDILRLGSANIPDLWLSDEEMLEKGLIDT |
| Ga0187886_13654492 | 3300018018 | Peatland | LLGKIGVDFRLREVRGALEDILRLGSANIPDLWLSDEEMLEKGLVET |
| Ga0187869_104871232 | 3300018030 | Peatland | VDFQLREVRGALEDILRLGSANIPDLWLSDEEMLEKGLVET |
| Ga0187766_103065061 | 3300018058 | Tropical Peatland | LEKIGVDFRLREVRGALEDILRLGSANIPDLWLSDEEMLQKGLIDI |
| Ga0187771_102657371 | 3300018088 | Tropical Peatland | LREVRGALEDVLRLGSANIPDLWLSDEELIESGMVQT |
| Ga0187770_117088332 | 3300018090 | Tropical Peatland | LGKIGVDFRLREVRGALEDILRLGSANIPDLWLSDEEMLERGLVET |
| Ga0179592_101857821 | 3300020199 | Vadose Zone Soil | IDMLEKVGVDFRLREVRGALEDILRLGSANIPDLWLSDEELLAKGLVES |
| Ga0210403_100301661 | 3300020580 | Soil | EFGRKEVRGALEDILRLGSANIPDLWLSDEEMLEKGLVES |
| Ga0210403_101886393 | 3300020580 | Soil | LSEVRGALEDILRLGSANIPDLWLSDEEMLEKGLVEG |
| Ga0210403_113251651 | 3300020580 | Soil | HLAEVRGALEDILRLGSANIPDLWLSDEEMLEKGLVEG |
| Ga0210399_101287833 | 3300020581 | Soil | LIDLLERIGVDFQLREVRGALEDILRLGSANIPDLWLSDEEMLERGLVET |
| Ga0210399_108575352 | 3300020581 | Soil | IGVNFERAEVRGALEDILRLGSANIPDLWLSDEEMLEKGLVEG |
| Ga0210399_111578332 | 3300020581 | Soil | IELLERIGVDFGRKEVRGALQDILRLGSANIPDLWLSDEEMLEKGLVES |
| Ga0210401_102096283 | 3300020583 | Soil | KEVRGALEDILRLGSANIPDLWLSDEEMLEKGLVES |
| Ga0210401_105351691 | 3300020583 | Soil | RKEVRGALEDILRLGSANIPDLWLSDEEMLEKGLVES |
| Ga0215015_104071992 | 3300021046 | Soil | LLERIGVDFHLREVRGALEDILRLGSANIPGLWLTDEEILEKGLVEN |
| Ga0179596_104682122 | 3300021086 | Vadose Zone Soil | VDFHLREVRGALEDILRLGSANIPDLWLSDEEMLEKGLVEG |
| Ga0210404_104035222 | 3300021088 | Soil | ALIELLERIGVDFHLREVRGALEDILRLGSANIPDLWLSDEEMLEKGLVES |
| Ga0210406_109979042 | 3300021168 | Soil | REKVGVDFRLREVRGALEDILRLGSANIPDLWLSDEELLAKGLVES |
| Ga0210387_106032062 | 3300021405 | Soil | DFRLREVRGALEDILRLGSANIPDLWLSDEELLAKGLVES |
| Ga0210387_116932872 | 3300021405 | Soil | REVRGALEDILRLGSANIPDLWLSDEELLAKGLAES |
| Ga0210386_105631011 | 3300021406 | Soil | MLEKVGVDFRLREVRGALEDILRLGSANIPDLWLSDEELLAKGLAES |
| Ga0210394_114376512 | 3300021420 | Soil | DMLEKVGVDFRLREVRGALEDILRLGSANIPDLWLSDDELLAKGLAES |
| Ga0210391_101302741 | 3300021433 | Soil | EVRGALEDILRLGSANIPDLWLSDEELLAKGLVES |
| Ga0210391_105482682 | 3300021433 | Soil | VGVDFRLREVRGALEDILRLGSANIPDLWLSDEELRAKGLAES |
| Ga0210398_110037892 | 3300021477 | Soil | KEVRGALEDILRLGSANIPDLWLSDEEMLEKGLVEG |
| Ga0210402_102584253 | 3300021478 | Soil | EVRGALEDILRLGSANIPDLWLSDEEMLEKGLVEG |
| Ga0210402_102952861 | 3300021478 | Soil | EVRGALEDILRLGSANIPDLWLSDEELLAKGLAES |
| Ga0210410_102447991 | 3300021479 | Soil | IGVDFHLREVRGALEDILRLGSANIPDLWLSDEEMLEKGLVES |
| Ga0210409_102610571 | 3300021559 | Soil | DMLEKVGVDFRLREVRGALEDILRLGSANIPDLWLSDEELLAKGLVES |
| Ga0210409_107990461 | 3300021559 | Soil | MLEKVGVDFRLREVRGALEDILRLGSANIPDLWLSDEELLEKGLVES |
| Ga0126371_109647641 | 3300021560 | Tropical Forest Soil | VGVDFHLREVRGALEDILRLGSANIPDLWLSDEELIESGMVQT |
| Ga0126371_115088662 | 3300021560 | Tropical Forest Soil | REVRGALEDILRLGSANIPDLWLSDEELLENGMIQT |
| Ga0247693_10312891 | 3300024181 | Soil | LERVGVDFRLREVRGALEDILRLGSANIPDLWLSDEELLAKGLVES |
| Ga0208689_100212312 | 3300025459 | Peatland | QLREVRGALEDILRLGSANIPDLWLSDEEMLERGLVET |
| Ga0208688_10277953 | 3300025480 | Peatland | GVDFQLREVRGALEDILRLGSANIPDLWLSDEEMLERGLVET |
| Ga0207693_102497232 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | DFRLREVRGALEDILRLGSANIPDLWLSDDEMLERGLVEG |
| Ga0207665_103527321 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | LREVRGALEDILRLGSANIPDLWLSDEELLAKGLVES |
| Ga0209863_100782982 | 3300026281 | Prmafrost Soil | DFRLREVRGALEDILRLGSANIPDLWLSDDEMLEKGMIEG |
| Ga0209468_100012634 | 3300026306 | Soil | LLERIGVDFRLGDVRGALEDILRLGSANIPDLWLSDEEMLEKGLVES |
| Ga0209155_10012301 | 3300026316 | Soil | AEGARALIELLEGIGLDFHLREVRGALEDILRLGSANIPDLWLSDEEMFEKGLVEW |
| Ga0257181_10810761 | 3300026499 | Soil | RIGVDFHLREVRGALEDILRLGSANIPDLWLSDEEMLEKGLVES |
| Ga0209378_11443482 | 3300026528 | Soil | DFRLDDARGALEDILRLGSANIPDLWLSDEEMLEKGLVES |
| Ga0209806_10539771 | 3300026529 | Soil | GDVRGALEDILRLGSANIPDLWLSDEEMLEKGLVES |
| Ga0209807_13347981 | 3300026530 | Soil | IGVDFRLDDARGALEDILRLGSANIPDLWLSDEEMLEKGLVES |
| Ga0209648_100451591 | 3300026551 | Grasslands Soil | IGVDFRLSEVRGALEDILRLGSANIPDLWLSDEEMLEKGLVES |
| Ga0209648_101567574 | 3300026551 | Grasslands Soil | IGVDFRLSEVRGALEDILRLGSANIPDLWLSDEEMLEKGLVEG |
| Ga0209648_106880832 | 3300026551 | Grasslands Soil | LIDMLERVGVDFRLREVRGALEDILRLGSANIPDLWLSDEELLAKGLVES |
| Ga0179587_105955551 | 3300026557 | Vadose Zone Soil | ERVGVDFRLREVRGALEDILRLGSANIPDLWLSDEELLAKGLVES |
| Ga0207760_1111971 | 3300026845 | Tropical Forest Soil | EKVGVDFRLREVRGALEDILRLGSANIPDLWLSDEELLEKGMIQT |
| Ga0207727_1234501 | 3300026854 | Tropical Forest Soil | GVDFRLHEVRGALEDILRLGSANIPDLWLSDEELLEKGMIQT |
| Ga0208983_10623432 | 3300027381 | Forest Soil | GVDFHLAEVRGALEDILRLGSANIPDLWLSDEEMLEKGLVEG |
| Ga0209421_10104981 | 3300027432 | Forest Soil | DRIGVDFRLREVRGALEDILRLGSANIPDLWLSDEEMLEKGMIET |
| Ga0208042_11767022 | 3300027568 | Peatlands Soil | GKIGVDFRLREVRGALEDILRLGSANIPDLWLSDEEMLEKGLVET |
| Ga0209527_10174291 | 3300027583 | Forest Soil | AQALIELLERIGVDFHLREVRGALEDILRLGSANIPDLWLSDEEMLEKGLVES |
| Ga0209733_11655701 | 3300027591 | Forest Soil | FHLKEVRGALEDILRLGSANIPDLWLSDEEMLEKGLVES |
| Ga0209076_10738882 | 3300027643 | Vadose Zone Soil | LAEGAHALIELLERIGVDFHLREVRGALEDILRLGSANIPDLWLSDEEMLEKGLVES |
| Ga0209117_10683171 | 3300027645 | Forest Soil | PVPAEGAQALIELLERIGVDFHLREVRGALEDILRLGSANIPDLWLSDEEMLEKGLVES |
| Ga0209009_11695551 | 3300027667 | Forest Soil | ALIELLERIGVDFHLREVRGALEDILRLGSANIPDLWLSDEEMLEKGLVEG |
| Ga0209588_11935851 | 3300027671 | Vadose Zone Soil | AQQLIELLERIGVDFHLREVRGALEDILRLGSANIPDLWLSDEEMMEKGLVES |
| Ga0209074_102844402 | 3300027787 | Agricultural Soil | AQELIELLERIGVDFHLREVRGALEDILRLGSANIPDLWLSDEEMLEKGLVKS |
| Ga0209701_101672671 | 3300027862 | Vadose Zone Soil | LIELLERVGVDFHLAEVRGALEDILRLGSANIPDLWLSDEEMLEKGLVEG |
| Ga0209701_101945872 | 3300027862 | Vadose Zone Soil | LERIGVDFHLAEVRGALEDILRLGSANIPDLWLSDEEMIEKGLVES |
| Ga0209701_106602231 | 3300027862 | Vadose Zone Soil | ERIGVDFHLAEVRGALEDILRLGSANIPDLWLSDEEMLEKGLVEG |
| Ga0209283_100389561 | 3300027875 | Vadose Zone Soil | IELLERIGVDFHLREVRGALEDILRLGSANIPDLWLSDEEMVEKGLVEG |
| Ga0209283_103149302 | 3300027875 | Vadose Zone Soil | EGAQQLIELLERIGVDFHLREVRGALEDILRLGSANIPDLWLSDEEMLEKGLVES |
| Ga0209283_103987842 | 3300027875 | Vadose Zone Soil | VDFRLSEVRGALEDILRLGSANIPDLWLSDEEMLEKGLVES |
| Ga0209698_113165971 | 3300027911 | Watersheds | DLLERIGLDFRLREVRGALEDILRLGSANIPDLWLSDEEMVEKGLVES |
| Ga0265354_10000611 | 3300028016 | Rhizosphere | GVDFHLKEVRGALEDILRLGSANIPDLWLSDEEMLEKGLVEG |
| Ga0209526_102396511 | 3300028047 | Forest Soil | LAEGAQALIELLERIGVDFHLREVRGALQDILRLGSANIPDLWLSDEEMLEKGLVES |
| Ga0137415_107322091 | 3300028536 | Vadose Zone Soil | FHLREVRGALEDILRLGSANIPDLWLSDEEMLEKGLVES |
| Ga0308309_113270411 | 3300028906 | Soil | LREVRGALEDILRLGSANIPDLWLSDEEMLERGLVET |
| Ga0075396_18018632 | 3300030776 | Soil | IELLERIGVEFGRKEVRGALEDILRLGSANIPDLWLSDEEMLEKGLVES |
| Ga0073994_100387081 | 3300030991 | Soil | LERIGVDFHLREVRGALEDILRLGSANIPDLWLSDEEMLEKGLVES |
| Ga0073994_100393151 | 3300030991 | Soil | AEGAQALIELLERIGVDFHLREVRGALEDILRLGSANIPDLWLSDEEMLEKGLVES |
| Ga0073994_100691251 | 3300030991 | Soil | VDFHLREVRGALEDILRLGSANIPDLWLSDEEMLEKGLVES |
| Ga0073994_100836211 | 3300030991 | Soil | VDFHLREVRGALEDILRLGSANIPDLWLSDEEMLEKGLVEQ |
| Ga0170834_1078656529 | 3300031057 | Forest Soil | LLEKVGVDFRLREVRGALEDILRLGSANIPDLWLSDEELLAKGLAES |
| Ga0318541_104560821 | 3300031545 | Soil | VDFRLREVRGALEDILRLGSANIPDLWLSDEELLESGMVQT |
| Ga0318542_102229312 | 3300031668 | Soil | IEAVGAEALLELLERIGVDFHLREVRGALEDILRLGSANIPDLWLTDEEILEKGLGES |
| Ga0318542_105003541 | 3300031668 | Soil | DLLEKVGVDFRLREVRGALEDILRLGSANIPDLWLSDEELLEKGMIQT |
| Ga0318560_102506732 | 3300031682 | Soil | DFRLREVRGALEDILRLGSANIPDLWLSDEELLEKGMIQT |
| Ga0318501_104490331 | 3300031736 | Soil | LLEKIGVDFRLREVRGALEDILRLGSANIPDLWLSDEELLENGMIQT |
| Ga0306918_109500631 | 3300031744 | Soil | EVRGALEDILRLGSANIPDLWLSDEEMLEKGLVEK |
| Ga0307477_103353262 | 3300031753 | Hardwood Forest Soil | RLREVRGALEDILRLGSANIPDLWLSDEELLEKGMIQT |
| Ga0307475_111297153 | 3300031754 | Hardwood Forest Soil | VDFRLREVRGALEDILRLGSANIPDLWLSDEELLAKGLVES |
| Ga0306921_110309632 | 3300031912 | Soil | EVRGALEDILRLGSANIPDLWLSDEELLEKGMIQT |
| Ga0306921_120638911 | 3300031912 | Soil | DMLEKIGVDFRLHEVRGALEDILRLGSANIPDLWLSDEELLEKGMIQT |
| Ga0310916_100018501 | 3300031942 | Soil | ALLELLERIGVDFHLREVRGALEDILRLGSANIPDLWLTDEEILEKGLGES |
| Ga0310916_109992751 | 3300031942 | Soil | EVRGALEDILRLGSANIPDLWLSDEELVENGMIQT |
| Ga0306926_101868491 | 3300031954 | Soil | FHLREVRGALEDILRLGSANIPDLWLSDEELIESGMVQT |
| Ga0318531_103899881 | 3300031981 | Soil | RLREVRGALEDILRLGSANIPDLWLSDEELLENGMIQT |
| Ga0310911_107283012 | 3300032035 | Soil | ERIGVDFRLREVRGALEDILRLGSANIPDLWLSDDEMLERGLVEG |
| Ga0307471_1006602882 | 3300032180 | Hardwood Forest Soil | LSEVRGALEDILRLGSANIPDLWLSDEEMLEKGLVES |
| Ga0307471_1006729492 | 3300032180 | Hardwood Forest Soil | EKVGVDFRLREVRGALEDILRLGSANIPDLWLSDEELLAKGLVES |
| Ga0335082_108299891 | 3300032782 | Soil | AQALIDLLEKVGVDFRLREVRGALEDILRLGSANIPDLWLSDEEMLEKGLIDV |
| Ga0335082_109777941 | 3300032782 | Soil | VDFRLREVRGALEDILRLGSANIPDLWLSDEELLEKGLAEN |
| Ga0335079_111769102 | 3300032783 | Soil | REVRGALEDILRLGSANIPDLWLSDEELLEKGMVQT |
| Ga0335071_100396066 | 3300032897 | Soil | VDFRLREVRGALEDILRLGSANIPDLWLSDEELVEKGMIQT |
| Ga0335083_103311541 | 3300032954 | Soil | LLERIGVDFRLREVRGALEDILRLGSANIPDLWLSDEEILEKGLVET |
| Ga0318519_109469081 | 3300033290 | Soil | GVDFRLREVRGALEDILRLGSANIPDLWLSDEELLENGMIQT |
| Ga0326727_105887902 | 3300033405 | Peat Soil | KVGVDFRLREVRGALEDILRLGSANIPDLWLSDEEMLEKGLVET |
| ⦗Top⦘ |