| Basic Information | |
|---|---|
| Family ID | F031799 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 181 |
| Average Sequence Length | 43 residues |
| Representative Sequence | VDPVVNGQLPSAKPSKGAEPEPTGINFVDLLIKKKDEEEPPW |
| Number of Associated Samples | 160 |
| Number of Associated Scaffolds | 181 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.26 % |
| % of genes near scaffold ends (potentially truncated) | 92.27 % |
| % of genes from short scaffolds (< 2000 bps) | 85.64 % |
| Associated GOLD sequencing projects | 152 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.32 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (97.790 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (20.442 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.204 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.304 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 17.14% β-sheet: 0.00% Coil/Unstructured: 82.86% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.32 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 181 Family Scaffolds |
|---|---|---|
| PF13401 | AAA_22 | 80.66 |
| PF13481 | AAA_25 | 12.71 |
| PF09299 | Mu-transpos_C | 1.10 |
| PF01609 | DDE_Tnp_1 | 0.55 |
| PF03699 | UPF0182 | 0.55 |
| PF13683 | rve_3 | 0.55 |
| PF13555 | AAA_29 | 0.55 |
| COG ID | Name | Functional Category | % Frequency in 181 Family Scaffolds |
|---|---|---|---|
| COG1615 | Uncharacterized membrane protein, UPF0182 family | Function unknown [S] | 0.55 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.55 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.55 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.55 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.55 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.55 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.55 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.79 % |
| Unclassified | root | N/A | 2.21 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000710|JGI12294J11894_104224 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300002347|JGIcombinedJ26865_1022929 | All Organisms → cellular organisms → Bacteria | 1005 | Open in IMG/M |
| 3300004479|Ga0062595_102239778 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300005167|Ga0066672_10756763 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300005184|Ga0066671_10988407 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300005529|Ga0070741_11563454 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300005538|Ga0070731_10334474 | All Organisms → cellular organisms → Bacteria | 1006 | Open in IMG/M |
| 3300005554|Ga0066661_10513037 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300005559|Ga0066700_10831979 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300005576|Ga0066708_10223000 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1190 | Open in IMG/M |
| 3300005598|Ga0066706_11003231 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300005764|Ga0066903_106823507 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300005841|Ga0068863_101180852 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
| 3300005921|Ga0070766_10256107 | All Organisms → cellular organisms → Bacteria | 1112 | Open in IMG/M |
| 3300005994|Ga0066789_10085703 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 1359 | Open in IMG/M |
| 3300006162|Ga0075030_101616107 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300006797|Ga0066659_10288428 | All Organisms → cellular organisms → Bacteria | 1247 | Open in IMG/M |
| 3300006797|Ga0066659_10564899 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
| 3300006853|Ga0075420_100833951 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300006871|Ga0075434_102050329 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300007258|Ga0099793_10365923 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300009012|Ga0066710_103654841 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300009012|Ga0066710_103898562 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300009089|Ga0099828_10904743 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
| 3300009090|Ga0099827_10042919 | All Organisms → cellular organisms → Bacteria | 3357 | Open in IMG/M |
| 3300009137|Ga0066709_103827668 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300009665|Ga0116135_1204362 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300009792|Ga0126374_11794172 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300010043|Ga0126380_10550727 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
| 3300010046|Ga0126384_10166015 | All Organisms → cellular organisms → Bacteria | 1715 | Open in IMG/M |
| 3300010048|Ga0126373_12328770 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300010329|Ga0134111_10561741 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300010333|Ga0134080_10178511 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
| 3300010366|Ga0126379_11203224 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
| 3300010376|Ga0126381_102540325 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300010379|Ga0136449_100604450 | All Organisms → cellular organisms → Bacteria | 1868 | Open in IMG/M |
| 3300010398|Ga0126383_10106926 | All Organisms → cellular organisms → Bacteria | 2515 | Open in IMG/M |
| 3300010398|Ga0126383_12746970 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300010937|Ga0137776_1049403 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300011271|Ga0137393_10733247 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300012200|Ga0137382_10054963 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2500 | Open in IMG/M |
| 3300012205|Ga0137362_11210915 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300012210|Ga0137378_11411438 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300012211|Ga0137377_11389901 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300012349|Ga0137387_11288387 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
| 3300012355|Ga0137369_10567435 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300012356|Ga0137371_11295047 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300012532|Ga0137373_10471617 | All Organisms → cellular organisms → Bacteria | 963 | Open in IMG/M |
| 3300012925|Ga0137419_10833565 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
| 3300012984|Ga0164309_10754473 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300014489|Ga0182018_10040824 | All Organisms → cellular organisms → Bacteria | 2888 | Open in IMG/M |
| 3300014489|Ga0182018_10250601 | All Organisms → cellular organisms → Bacteria | 975 | Open in IMG/M |
| 3300014496|Ga0182011_10606480 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300014498|Ga0182019_10419905 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
| 3300014657|Ga0181522_10218160 | All Organisms → cellular organisms → Bacteria | 1124 | Open in IMG/M |
| 3300014839|Ga0182027_10583136 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1205 | Open in IMG/M |
| 3300015241|Ga0137418_10108999 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium GJ-E10 | 2483 | Open in IMG/M |
| 3300015264|Ga0137403_10343504 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1381 | Open in IMG/M |
| 3300015264|Ga0137403_11074112 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300015265|Ga0182005_1132037 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300015373|Ga0132257_104086579 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300016294|Ga0182041_10125986 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium GJ-E10 | 1933 | Open in IMG/M |
| 3300016294|Ga0182041_12343065 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300016341|Ga0182035_10257071 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1413 | Open in IMG/M |
| 3300016341|Ga0182035_11971732 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300016357|Ga0182032_10210347 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1487 | Open in IMG/M |
| 3300016357|Ga0182032_12015708 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300016445|Ga0182038_11265256 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300017823|Ga0187818_10209982 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
| 3300017932|Ga0187814_10308618 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300017946|Ga0187879_10764102 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300017948|Ga0187847_10557683 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 638 | Open in IMG/M |
| 3300017948|Ga0187847_10567253 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300017966|Ga0187776_10767204 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300017966|Ga0187776_11489758 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300017975|Ga0187782_10981892 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300017988|Ga0181520_11055334 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300017999|Ga0187767_10145807 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300018028|Ga0184608_10047724 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium GJ-E10 | 1677 | Open in IMG/M |
| 3300018037|Ga0187883_10752741 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300018038|Ga0187855_10546220 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300018040|Ga0187862_10416447 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
| 3300018042|Ga0187871_10185153 | All Organisms → cellular organisms → Bacteria | 1167 | Open in IMG/M |
| 3300018058|Ga0187766_11162200 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300018062|Ga0187784_10884913 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300018088|Ga0187771_10223907 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1565 | Open in IMG/M |
| 3300019888|Ga0193751_1181754 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300020581|Ga0210399_11337063 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300020582|Ga0210395_10829240 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300021168|Ga0210406_10865791 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300021170|Ga0210400_10087611 | All Organisms → cellular organisms → Bacteria | 2453 | Open in IMG/M |
| 3300021406|Ga0210386_11371003 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300021560|Ga0126371_10448741 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1435 | Open in IMG/M |
| 3300022881|Ga0224545_1000271 | All Organisms → cellular organisms → Bacteria | 11034 | Open in IMG/M |
| 3300025906|Ga0207699_10227403 | All Organisms → cellular organisms → Bacteria | 1276 | Open in IMG/M |
| 3300025906|Ga0207699_10294851 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1131 | Open in IMG/M |
| 3300025928|Ga0207700_10089058 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2431 | Open in IMG/M |
| 3300026066|Ga0208290_1041145 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300026271|Ga0209880_1085990 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300026291|Ga0209890_10158485 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300026309|Ga0209055_1081934 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1330 | Open in IMG/M |
| 3300026309|Ga0209055_1295325 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300026315|Ga0209686_1133826 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300026317|Ga0209154_1178748 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
| 3300026551|Ga0209648_10419415 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
| 3300026879|Ga0207763_1025872 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300026909|Ga0207858_1010494 | All Organisms → cellular organisms → Bacteria | 917 | Open in IMG/M |
| 3300027050|Ga0209325_1018312 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
| 3300027439|Ga0209332_1089210 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300027562|Ga0209735_1124036 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300027643|Ga0209076_1218067 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300027846|Ga0209180_10123218 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1487 | Open in IMG/M |
| 3300027911|Ga0209698_10138784 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2002 | Open in IMG/M |
| 3300027911|Ga0209698_11053010 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300027911|Ga0209698_11119968 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300028015|Ga0265353_1026408 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300028740|Ga0302294_10006449 | All Organisms → cellular organisms → Bacteria | 2868 | Open in IMG/M |
| 3300028792|Ga0307504_10025195 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1523 | Open in IMG/M |
| 3300029636|Ga0222749_10552016 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300029999|Ga0311339_10182979 | All Organisms → cellular organisms → Bacteria | 2401 | Open in IMG/M |
| 3300029999|Ga0311339_10577353 | All Organisms → cellular organisms → Bacteria | 1125 | Open in IMG/M |
| 3300030014|Ga0302175_10084421 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300030019|Ga0311348_10460119 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
| 3300030048|Ga0302273_1200149 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300030737|Ga0302310_10477364 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300030862|Ga0265753_1100222 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300031028|Ga0302180_10322776 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
| 3300031199|Ga0307495_10122826 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300031561|Ga0318528_10217631 | All Organisms → cellular organisms → Bacteria | 1023 | Open in IMG/M |
| 3300031640|Ga0318555_10747640 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300031679|Ga0318561_10446359 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300031719|Ga0306917_10145873 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1751 | Open in IMG/M |
| 3300031744|Ga0306918_10766494 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300031753|Ga0307477_10075248 | All Organisms → cellular organisms → Bacteria | 2336 | Open in IMG/M |
| 3300031765|Ga0318554_10866702 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300031769|Ga0318526_10117889 | All Organisms → cellular organisms → Bacteria | 1069 | Open in IMG/M |
| 3300031770|Ga0318521_10481025 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300031778|Ga0318498_10496518 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300031779|Ga0318566_10208234 | All Organisms → cellular organisms → Bacteria | 971 | Open in IMG/M |
| 3300031792|Ga0318529_10435061 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300031795|Ga0318557_10176586 | All Organisms → cellular organisms → Bacteria | 972 | Open in IMG/M |
| 3300031805|Ga0318497_10317127 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
| 3300031823|Ga0307478_11705462 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300031890|Ga0306925_10130722 | All Organisms → cellular organisms → Bacteria | 2693 | Open in IMG/M |
| 3300031902|Ga0302322_102665386 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300031912|Ga0306921_12324404 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300031942|Ga0310916_10104800 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2277 | Open in IMG/M |
| 3300031942|Ga0310916_10129875 | All Organisms → cellular organisms → Bacteria | 2059 | Open in IMG/M |
| 3300031945|Ga0310913_10196843 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1406 | Open in IMG/M |
| 3300031946|Ga0310910_11271251 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300031947|Ga0310909_10388212 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1172 | Open in IMG/M |
| 3300031947|Ga0310909_10635139 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
| 3300031959|Ga0318530_10017117 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium GJ-E10 | 2438 | Open in IMG/M |
| 3300031962|Ga0307479_10079522 | All Organisms → cellular organisms → Bacteria | 3173 | Open in IMG/M |
| 3300032039|Ga0318559_10430278 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300032041|Ga0318549_10566357 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300032042|Ga0318545_10061404 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1284 | Open in IMG/M |
| 3300032043|Ga0318556_10384336 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300032044|Ga0318558_10027828 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2360 | Open in IMG/M |
| 3300032060|Ga0318505_10149019 | All Organisms → cellular organisms → Bacteria | 1083 | Open in IMG/M |
| 3300032063|Ga0318504_10179671 | All Organisms → cellular organisms → Bacteria | 983 | Open in IMG/M |
| 3300032063|Ga0318504_10384158 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300032067|Ga0318524_10754491 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300032089|Ga0318525_10019894 | All Organisms → cellular organisms → Bacteria | 3175 | Open in IMG/M |
| 3300032089|Ga0318525_10725656 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300032094|Ga0318540_10324082 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300032160|Ga0311301_11784488 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300032205|Ga0307472_102093435 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300032783|Ga0335079_12055623 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300032805|Ga0335078_12452043 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300032828|Ga0335080_11084838 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
| 3300032897|Ga0335071_10128759 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium | 2481 | Open in IMG/M |
| 3300032897|Ga0335071_10171698 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2121 | Open in IMG/M |
| 3300033416|Ga0316622_101648342 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300033561|Ga0371490_1015550 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2674 | Open in IMG/M |
| 3300033755|Ga0371489_0422053 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300034161|Ga0370513_188040 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 20.44% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.08% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.97% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 3.87% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.31% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.31% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.21% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.21% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.21% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.21% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 2.21% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.21% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 1.66% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.66% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.66% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.66% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.10% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.10% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.10% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.10% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.10% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.10% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 1.10% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.10% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.10% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.10% |
| Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 0.55% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.55% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.55% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.55% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.55% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.55% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.55% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.55% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.55% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.55% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.55% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000710 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 67 | Environmental | Open in IMG/M |
| 3300002347 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 deep-072012 (NGEE Surface samples 415 (1, 2, 3 deep-072012) AP id is 1030520, ASSEMBLY_DATE=20131219) | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010937 | Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014496 | Permafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaG | Environmental | Open in IMG/M |
| 3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300014839 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017988 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaG | Environmental | Open in IMG/M |
| 3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022881 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 20-24 | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026066 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026271 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191 (SPAdes) | Environmental | Open in IMG/M |
| 3300026291 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026879 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 50 (SPAdes) | Environmental | Open in IMG/M |
| 3300026909 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 23 (SPAdes) | Environmental | Open in IMG/M |
| 3300027050 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027439 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027562 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028015 | Soil microbial communities from Maridalen valley, Oslo, Norway - NSE6 | Environmental | Open in IMG/M |
| 3300028740 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N2_3 | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029954 | I_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030014 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N3_3 | Environmental | Open in IMG/M |
| 3300030019 | II_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300030048 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N1_3 | Environmental | Open in IMG/M |
| 3300030737 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300030862 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031199 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_S | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300033416 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033561 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB28FN SIP fraction | Environmental | Open in IMG/M |
| 3300033755 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB26FY SIP fraction | Environmental | Open in IMG/M |
| 3300034161 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_18 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12294J11894_1042241 | 3300000710 | Tropical Forest Soil | VNGQLPSVKRTASAEPEPTGINFVELLKQKQEKE* |
| JGIcombinedJ26865_10229291 | 3300002347 | Arctic Peat Soil | PQGTARLVDPVINAQLPSPKRPAPAEPAPTGINFVELLQRKKDEKE* |
| Ga0062595_1022397782 | 3300004479 | Soil | FEGKSQGVARLVDPVVNGQIPSPKPAPSASPEPTGINFVELLRDQKSEDEESVPW* |
| Ga0066672_107567631 | 3300005167 | Soil | VDPVVNAQLPSAKRSAPAEPEPTGINFVELLKKKKDEKE* |
| Ga0066671_109884072 | 3300005184 | Soil | KSQGVARLVDPVVNGQLPSLKPVPPASPEPTGINFVELLHDQKDDDEEDSVPW* |
| Ga0070741_115634541 | 3300005529 | Surface Soil | DAVVNGQLPSTKPAKAAEPEPTGINFVDLLIKKKDEEEPPW* |
| Ga0070731_103344742 | 3300005538 | Surface Soil | YFQGKSEGTARLVDAVVNGQLHSTKPAKAAEPEPTGINFVDLLVKKKDEEEPPW* |
| Ga0066661_105130372 | 3300005554 | Soil | VVNGQLPSVKPAAAPAPESTGINFVELLKQKSDGKDQE* |
| Ga0066700_108319792 | 3300005559 | Soil | VDPVVNGQLPSVKPAAAPAPESTGINFVELLKQKSDGKDQE* |
| Ga0066708_102230003 | 3300005576 | Soil | EGNLQGVARPVDPVVNAQLPSSKPVTAPRPEPTGINFVELLNQTKDAKE* |
| Ga0066706_110032311 | 3300005598 | Soil | ARPVDPVVNGQLPFVKRAASAEPESTGINFVELLKQKPEKE* |
| Ga0066903_1068235071 | 3300005764 | Tropical Forest Soil | PVINAGLPSVKRSATEKPEPTGINFVELLNRKKDEQE* |
| Ga0068863_1011808522 | 3300005841 | Switchgrass Rhizosphere | FQGKPEGTARLVDAVVNGQLPSTKPAKAADPEPTGINFVDLLVKKKDEEEPPW* |
| Ga0070766_102561073 | 3300005921 | Soil | EATARPVDPVVNGQLPSVQPAASPEPEPTGINFVELLKQKNDDGKDQE* |
| Ga0066789_100857033 | 3300005994 | Soil | PVFNAGLPPVKRSTTTAPEPTGINFVELLNRKKEQE* |
| Ga0075030_1016161071 | 3300006162 | Watersheds | TARLVDPVVNAGLPPVKRAAAAEAEPTGINFVELLNRKKQEEE* |
| Ga0066659_102884284 | 3300006797 | Soil | DPVVNGQLPSAKPTASPEPSPTGINFVEQLHREKG* |
| Ga0066659_105648991 | 3300006797 | Soil | GTARLVDPVVNAQLSSAKSSRAEPEPTGINYVDLLIKKKVEER* |
| Ga0075420_1008339512 | 3300006853 | Populus Rhizosphere | VDAVVNGLLPSVKPAAPPAPDPTGINFIELLKDKAEGKKDQQE* |
| Ga0075434_1020503291 | 3300006871 | Populus Rhizosphere | ARLVDAVVNGRLPSTKPAKAAEPEPTGINFVDLLVKKKDEEEPPW* |
| Ga0099793_103659231 | 3300007258 | Vadose Zone Soil | VNGQLAPVKPTPSSEPEPTGINFIELLKRKNDDAKDGQE* |
| Ga0066710_1036548412 | 3300009012 | Grasslands Soil | SHGTARLVDPVVNAQLPSAKPSKAAEPEPTGINFVELLKKKQEEE |
| Ga0066710_1038985621 | 3300009012 | Grasslands Soil | GTARLVDPVINAQLPAAKRPAPAEPAPTGINFVALLQRKKDEKK |
| Ga0099828_109047431 | 3300009089 | Vadose Zone Soil | SQLPSVKSATSPEPEPTGINFVELLKQKSEDGKDEE* |
| Ga0099827_100429193 | 3300009090 | Vadose Zone Soil | VVNSQLPSVKLAASPEPEPTGINFVELLKQKNDDGKDEE* |
| Ga0066709_1038276681 | 3300009137 | Grasslands Soil | AAARPVDPVINGQLPSAKPTPSSEPEPTGINFVELLKKKNDDDKDDEE* |
| Ga0116135_12043622 | 3300009665 | Peatland | NAGLPPVKRATAAEPEPTGINFVELLNRKKEEEE* |
| Ga0116134_11357311 | 3300009764 | Peatland | TARLVDPVINAQLPSAKPAAMPQPEPTGINFVELLQKKHPDEDQE* |
| Ga0126374_117941721 | 3300009792 | Tropical Forest Soil | GQPQATARLVDPVVNAQLPSAKSFQAEPEPTGINFVDLLVKKRSEEEPPW* |
| Ga0126380_105507272 | 3300010043 | Tropical Forest Soil | VVNAQLPSTKSSKAEPEPTGINFVDLLIKKKDEEEPPW* |
| Ga0126384_101660151 | 3300010046 | Tropical Forest Soil | PVVNGKVPSAKPFKAAEPEPTGINFVDLLVKKKSEEEPPW* |
| Ga0126373_123287701 | 3300010048 | Tropical Forest Soil | QGQPQGRARLVDPVVNAQLPSAKPPKLAEPEPTGINFVELLNKKKEEE* |
| Ga0134111_105617412 | 3300010329 | Grasslands Soil | ARLVDPVVNGQLPSAKPAKAAEAEPTGINFVDLLIKKKDEEEPPW* |
| Ga0134080_101785112 | 3300010333 | Grasslands Soil | VDPVVNGQLPSVKPAVSPEPEPTGINFVELLKQKNEDGKDEE* |
| Ga0126379_112032241 | 3300010366 | Tropical Forest Soil | SEGTARLVDAVVNGQLPSTKPAKAADPEPTGINFVDLLVKKKDEEEPPW* |
| Ga0126381_1025403252 | 3300010376 | Tropical Forest Soil | YFQGKPEGTARLVDPVLNAQLPSTKSPKPEPEPTGINFVDLLIQKKGEEK* |
| Ga0136449_1006044502 | 3300010379 | Peatlands Soil | VAEIYFQGQLAGTARLVDPVVNGQLPSAKAFKVESQRTGINFVDLLIKKKDGEEPPW* |
| Ga0126383_101069263 | 3300010398 | Tropical Forest Soil | LVDPVVNAQLPSAKPSQTAEPKPTRINFVELLKKKTEEE* |
| Ga0126383_127469701 | 3300010398 | Tropical Forest Soil | VVNGQLPSAKPAKTAAPEPTGINFVDLLIKKKDEEEPPW* |
| Ga0137776_10494032 | 3300010937 | Sediment | IYFQGKSEGTARLVDAVVNGQLPSSKPAKAADPEPTGINFVDLLVKKKGEEEPPW* |
| Ga0137393_107332472 | 3300011271 | Vadose Zone Soil | NSQLPSVKSATSPEPEPTGINFVELLKQKNEDGKDEE* |
| Ga0137382_100549631 | 3300012200 | Vadose Zone Soil | TARPVDPVVNGQLPSVKRTASAEPEPTGINFVELLKQKQEKE* |
| Ga0137362_112109152 | 3300012205 | Vadose Zone Soil | VDPVVNGQLPSLKPVPPASPEPTGINFVELLHDQKDDEEDSAPW* |
| Ga0137378_114114382 | 3300012210 | Vadose Zone Soil | LVDPVFNAGLPPVKRAATAEPAPTGINYVELLNGKKKEKE* |
| Ga0137377_113899012 | 3300012211 | Vadose Zone Soil | PSAKPAAAPEPEPTGINFVELLKRKKDDGSGDKE* |
| Ga0137387_112883872 | 3300012349 | Vadose Zone Soil | VVNGPLPFVKWTASSEPEPPGINFVELLKQKQETIPR* |
| Ga0137369_105674351 | 3300012355 | Vadose Zone Soil | PVDPVVNGQLPSVKPAASPEPEPTGINFVELLKQKPEKE* |
| Ga0137371_112950471 | 3300012356 | Vadose Zone Soil | KLEATARPVDPVVNGQLPSVKPAVSPEPEPTGINFVELLKQKNKDGKDEE* |
| Ga0137373_104716171 | 3300012532 | Vadose Zone Soil | PVVNAPLPSAKRSAPAEPEPTGINFVELLKKKKDEKK* |
| Ga0137419_108335651 | 3300012925 | Vadose Zone Soil | TARLVDPVINAQLPSAKRPAKAEPEPTGINFVELLQQKKNEKE* |
| Ga0164309_107544731 | 3300012984 | Soil | VARLIDPVVNGQIPSPKPAPSASPEPTGINFVELLRDQKSEDEESVPW* |
| Ga0182018_100408242 | 3300014489 | Palsa | VINGQLPSVKRTASAEPEPTGINFVELLKQNQKKE* |
| Ga0182018_102506012 | 3300014489 | Palsa | VDPVINAGLPPVKRATTAEPEPTGINFVELVNRKKEEEE* |
| Ga0182011_106064801 | 3300014496 | Fen | GTARLVDPVINAQLPSPKRTAKAEPEPTGINFVELLQRKKNQDEKE* |
| Ga0182019_104199051 | 3300014498 | Fen | INAQLPSPKRPAKVEPEPTGINFVELLQRKKNEDEKE* |
| Ga0181522_102181601 | 3300014657 | Bog | QAIARLVDPVVNAQLPSAKPAPAAQPEPTGINFVELLKKKKDEEE* |
| Ga0182027_105831363 | 3300014839 | Fen | QGVARWVDPVVNAQTRPPQPATPNAPQPTGINYVELLKKKKDQEE* |
| Ga0137418_101089993 | 3300015241 | Vadose Zone Soil | PVDPVVNGQLPSVKPTAPAQPEPTGINFVELLKRKKDDGKDNEE* |
| Ga0137403_103435041 | 3300015264 | Vadose Zone Soil | PVVNGQLPSAKPAAAPEPEPTGINFVELLKRKKDDGSDDKE* |
| Ga0137403_110741121 | 3300015264 | Vadose Zone Soil | ATARPVDPVVNGQLPSVKPAASPEPEPTGINFVELLKQKNDDGKDEE* |
| Ga0182005_11320372 | 3300015265 | Rhizosphere | RLVDPVVNAQLPSAKSSKTEPEPTGINFVDLLIKKKDEEEPPW* |
| Ga0132257_1040865791 | 3300015373 | Arabidopsis Rhizosphere | LQATARPVDPVVNGQLPSVKPAASPEPEPTGINFVELLKQKSDDGKDEE* |
| Ga0182041_101259861 | 3300016294 | Soil | QGKSEGTARLVDAVVNGQLPSTKPAKPADPEPTGINFVDLLVKKKDEEEPPW |
| Ga0182041_123430652 | 3300016294 | Soil | FFQGKSEGTARLVDAVVNGQLPSTKPAKAADPEPTGINFVDLLVKKKDEEEPPW |
| Ga0182035_102570711 | 3300016341 | Soil | LVDPVVNGQLPSTKSSKAEPEPTGINFVDLLIKKKDEEK |
| Ga0182035_119717322 | 3300016341 | Soil | SEGTARLVDAVVNGQLPSTKPAKAADPEPTGINFVDLLVKKKDEEEPPW |
| Ga0182032_102103473 | 3300016357 | Soil | HGTARLVDAVVNAQLPSRKSSPAAEPAPTGINFVDLLIKKKKDEEEPPW |
| Ga0182032_120157081 | 3300016357 | Soil | FQGQMQGVARLVDPVVNAQLPSTKSSKAQAVPTGINFVDLLIKKKDAEEPPW |
| Ga0182038_112652562 | 3300016445 | Soil | QMQGVARLVDPVVNAQLPSTKSSKAQAEPTGINFVDLLIKKKDEEEPPW |
| Ga0187818_102099822 | 3300017823 | Freshwater Sediment | LVDPVVNGQLPSARPSKAAESQPTGINFVDLLLKKKDEEEPPW |
| Ga0187814_103086182 | 3300017932 | Freshwater Sediment | PVVNAQLPSAKPSKAVEPEPTGINFVELLKKKQEEK |
| Ga0187879_107641022 | 3300017946 | Peatland | LVDPVVNGQLPSLKPVPPAAPEPTGINFVELLHGQKNDEEDSAPW |
| Ga0187847_105576832 | 3300017948 | Peatland | MARLVDPVVNDQLPSSKPVTPVSPEPTGINFVELLKQKKDEQE |
| Ga0187847_105672532 | 3300017948 | Peatland | MARPVDPVVNGQLPSVKPAASPEPEPTGINFVELLKQKDDDGEDDE |
| Ga0187776_107672042 | 3300017966 | Tropical Peatland | AQLPSTKSSKAEPEPTGINFVDLLIKKKDEEEPPW |
| Ga0187776_114897581 | 3300017966 | Tropical Peatland | VVNAQLPSVKSSKAEPEPTGINFVDLLIKKKDEEEPPW |
| Ga0187782_109818921 | 3300017975 | Tropical Peatland | ARLVDPIVNGQLPSTKSCKGEPEPTGINFVDLLIQKKSEEK |
| Ga0181520_110553342 | 3300017988 | Bog | ARLVDPVINAGVPPVKRSTTAEPESTGINFVELVNRKKEEEE |
| Ga0187767_101458072 | 3300017999 | Tropical Peatland | AARPVDPVVNAQLPSARPSPADEPEPTGINFVDLLIQKKNEEEPPW |
| Ga0184608_100477241 | 3300018028 | Groundwater Sediment | PVINGQLPSVKPTPSPEPAPTGINFVELLQRKKDEKE |
| Ga0187883_107527411 | 3300018037 | Peatland | SQGLARLVDPVVNGQLPSLKPVPPAAPEPTGINFVELLHGQKNDEEDSAPW |
| Ga0187855_105462202 | 3300018038 | Peatland | RPVDPVVNGQLPSVKPAASPEPEPTGINFVELLKQKDDDGEDEE |
| Ga0187862_104164471 | 3300018040 | Peatland | DPVINAGLPPVKRATAAEPEPTGINFVELLNQKKEEKE |
| Ga0187871_101851533 | 3300018042 | Peatland | GTARLVDPVINAQLPSAKRPAKAEPESTGINFVELLQRKKNQDEEE |
| Ga0187766_111622002 | 3300018058 | Tropical Peatland | VDPVENAQLRSAKPSPAAKPEPTGINFVDLLVKKKNEEEPPW |
| Ga0187784_108849131 | 3300018062 | Tropical Peatland | NAQLPSTKSSPAEPGPTGINFVDLLIQKKDEEEPPW |
| Ga0187771_102239072 | 3300018088 | Tropical Peatland | VVNGQLPSTKRAKAAETEPTGINLVDLLVKKKDEEEPPW |
| Ga0193751_11817541 | 3300019888 | Soil | TSARPVDPVVNGQLPSLKRTASAELEPTGINFVELLKQKQEKE |
| Ga0210399_113370631 | 3300020581 | Soil | TTARPVDPVVNGQLPSVKPAASPEPEPTGINFVELLKQKSDDGKDEE |
| Ga0210395_108292402 | 3300020582 | Soil | PVLNAGLPPVKRATTAEPEPTGINFVELLNRKKEGKE |
| Ga0210406_108657912 | 3300021168 | Soil | PGDPVVNGQLPSVKRTASVEPEPTGINFVELLKQKQEKE |
| Ga0210400_100876114 | 3300021170 | Soil | ARLVDPVVNGQLPSIKPSKAAEPEPTGINFVDLLIKKKDEEEPPW |
| Ga0210393_109571021 | 3300021401 | Soil | MARVVDPVINAQLGSAKPEPKPAPAPTGINFIELLEQRKDPHQQKE |
| Ga0210386_113710031 | 3300021406 | Soil | ARPVDPVVNGQLPSVKPTPSAQPQPTGINSVELLKQKQEKE |
| Ga0126371_104487411 | 3300021560 | Tropical Forest Soil | GSARLVDPVVNGQLPSAKPAEAAAPEPTGINFVDLLIKKKDEEEPPW |
| Ga0224545_10002716 | 3300022881 | Soil | VINGQLPSVKRTASAEPEPTGINFVELLKQNQKKE |
| Ga0207699_102274033 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MHSWLVVNAQLSSTKSSKAEPEPTGINYVDLLIKKKGEEG |
| Ga0207699_102948511 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | VDPIVNGQLPSAKPSKAGECEPTGINFVDLLIKRKDEEEPPW |
| Ga0207700_100890581 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | TAPRPVDPVVNAQLPSSKPVTAPRPEPTGINFVELLNQTKDAKE |
| Ga0208290_10411451 | 3300026066 | Natural And Restored Wetlands | LVDAVVNGQLPSTKPAKAADPEPTGINFVDLLVKKKSEEEPPW |
| Ga0209880_10859902 | 3300026271 | Soil | RLVDPVINAQLPSPKRPAPAEPAPTGINFVELLQRKKDEKE |
| Ga0209890_101584852 | 3300026291 | Soil | PVFNAGLPPVKRSTTTAPEPTGINFVELLNRKKEQE |
| Ga0209055_10819343 | 3300026309 | Soil | VVNGQLPSVKPAAAPAPESTGINFVELLKQKSDGKDQE |
| Ga0209055_12953252 | 3300026309 | Soil | KLETTARPVDPVVNGQLPSVKRTASAEPEPTGINFVELLKQKQEKE |
| Ga0209686_11338261 | 3300026315 | Soil | RPVDPVVNGQLPSVKRTASAEPEPTGINFVELLKQKQEKE |
| Ga0209154_11787482 | 3300026317 | Soil | QLETTARPVDPVVNGQLPSVKRTASAEPEPTGINFVELLKQKQEKE |
| Ga0209648_104194152 | 3300026551 | Grasslands Soil | VVNSQLPSVKSATSPEPEPTGINFVELLKQKNEDGKDEE |
| Ga0207763_10258722 | 3300026879 | Tropical Forest Soil | TARPVDPVVNGQLPSVKRTASAEPEPTGINFVELLKQKQEKE |
| Ga0207858_10104942 | 3300026909 | Tropical Forest Soil | DPVVNGQLPSVKRTASAEPEPTGINFVELLKQKQEKE |
| Ga0209325_10183122 | 3300027050 | Forest Soil | ARLVDPVVNGQLPSAKPITTPVPEPTGINFVELLKANEDDDGN |
| Ga0209332_10892102 | 3300027439 | Forest Soil | ARLVDPVVNAGLPPVKRSAAAEPEPTGINFVELLNQKKEEEE |
| Ga0209735_11240362 | 3300027562 | Forest Soil | DPVVNGQLPFVKRTASAEPEATGINFVELLKQKQEKE |
| Ga0209076_12180671 | 3300027643 | Vadose Zone Soil | VNGQLAPVKPTPSSEPEPTGINFVELLKRKNDDAKDGQE |
| Ga0209180_101232183 | 3300027846 | Vadose Zone Soil | VDPVINGQLPSVKPTPSTEPAPTGINFVELLKQQNDDGKDEE |
| Ga0209698_101387841 | 3300027911 | Watersheds | ATARLVDPVVNAGLPPVKRAAAAEAEPTGINFVELLNRKKQEEE |
| Ga0209698_110530102 | 3300027911 | Watersheds | TARLVDPVVNGQLPSAKPSKATESEPTGINFVDLLVKKKDEEEPPW |
| Ga0209698_111199681 | 3300027911 | Watersheds | NGQLPSAKPSKGVEPEPTGINFVDLLIRKKDEEEPPW |
| Ga0265353_10264081 | 3300028015 | Soil | VDPVVNGQLPAVKRTATVEPKPTGINFVELLKQKQEKE |
| Ga0302294_100064494 | 3300028740 | Fen | PVINAQLPSPKRPAKAEPAPTGINFVELLQRKKDEKE |
| Ga0307504_100251951 | 3300028792 | Soil | KLEATARPVDPVVNGQLPSGKPTASPEPEPTGINFVELLKRKNDDGKDDQE |
| Ga0222749_105520162 | 3300029636 | Soil | VDPVVNGQLPSVKRPASAEPEPTGINFVELLKQKQEKE |
| Ga0311331_106337521 | 3300029954 | Bog | KLQGTARLVDPVFNAGLPPVKRATTAEPAPTGINYVELLNGKKKEKE |
| Ga0311339_101829791 | 3300029999 | Palsa | DAVVNGQLPSVKPMAPAPPEPTGINFVELLQQKNQDRKDDQE |
| Ga0311339_105773533 | 3300029999 | Palsa | RLVDPVVNGQLPSLKPVPPAAPEPTGINFVELLHDRNDDEEDSVPW |
| Ga0302175_100844211 | 3300030014 | Fen | VDPVINAQLPSPKRPAKAEPAPTGINFVELLQRKKDEKE |
| Ga0311348_104601191 | 3300030019 | Fen | QGTARLVDPVINAQLPSAKRSAPAEPEPTGINFVELLQQKKDRKE |
| Ga0302273_12001492 | 3300030048 | Bog | INAQLPSPKRPAKAEPAPTGINFVELLQRKKDEKE |
| Ga0302310_104773642 | 3300030737 | Palsa | TSARPVDPVVNGQLPSVKPTASAAPQPTGINFVELLKQKQEKE |
| Ga0265753_11002222 | 3300030862 | Soil | PVDPVVNGQLPSVKRTVSAAPEPTGINFVELLKQKQEKE |
| Ga0302180_103227762 | 3300031028 | Palsa | LPSVKPMAPAPPEPTGINFVELLQQKNQDRKDDQE |
| Ga0307495_101228261 | 3300031199 | Soil | NGQLPSVKPAASPEPKPTGINFVELLKQKSDDGKDEE |
| Ga0318528_102176313 | 3300031561 | Soil | PVINARLPAVKRPTAAQPEPTGINFVELLQRKKEEQE |
| Ga0318555_107476401 | 3300031640 | Soil | IYFQGKAEGPARLVDPVVNGQLPSAKPSKGAEPEPTGINFVDLLIKKKDEEEPPW |
| Ga0318561_104463591 | 3300031679 | Soil | AQGVARLVDPVVNGQLPSDKPSKAAEPEPTGINFVDLLIKKKDDEEPPW |
| Ga0306917_101458731 | 3300031719 | Soil | QLPSVKPSPAADPEPTGINFVDLLIKKKDEEEPPW |
| Ga0306918_102891541 | 3300031744 | Soil | MNAKLPAAKRAPSPDPEPTGINFVELLQQKKEPDKEE |
| Ga0306918_107664941 | 3300031744 | Soil | QSQGAARLVDPVVNAQRPSSQPSPARAPEPTGINFVELLKKKKDEEE |
| Ga0307477_100752484 | 3300031753 | Hardwood Forest Soil | GQLPSVKPSPAADPEPTGINFVDLLIKKKDEEEPPW |
| Ga0318554_108667021 | 3300031765 | Soil | RLVDPVVNAQLPSVKPSPAADPEPTGINFVDLLLQKKDEEEPPW |
| Ga0318526_101178893 | 3300031769 | Soil | GKSEGTARLVDAVVNGQLPSTKPAKPADPEPTGINFVDLLVKKKDEEEPPW |
| Ga0318521_104810252 | 3300031770 | Soil | VVNGRLPFLRRTASTQPEPTGINFVELLKQKSEKE |
| Ga0318498_104965182 | 3300031778 | Soil | AQLPSVKPSPAADPEPTGINFVDLLIKKKDEEEPPW |
| Ga0318566_102082341 | 3300031779 | Soil | YFQGQLEGTARLVDPVVNGQLPSAKPAKAAESQPTGINFVDLLIQKKDEEEPPW |
| Ga0318529_104350611 | 3300031792 | Soil | VFFQGKSEGTARLVDAVVNGQLPSTKPAKPADPEPTGINFVDLLVKKKDEEEPPW |
| Ga0318557_101765861 | 3300031795 | Soil | LVDAVVNGQLPSTKPAKPADPEPTGINFVDLLVKKKDEEEPPW |
| Ga0318497_103171271 | 3300031805 | Soil | VDPVVNGQLPSAKPSKGAEPEPTGINFVDLLIKKKDEEEPPW |
| Ga0307478_117054622 | 3300031823 | Hardwood Forest Soil | VDPVVNGQLPSVKPTPSAQPQPTGINFVELLKQKQEKE |
| Ga0306925_101307221 | 3300031890 | Soil | VNAQLPSVKPSPAADPEPTGINFVDLLIKKKDEEEPPW |
| Ga0302322_1026653861 | 3300031902 | Fen | INGQLPSTKRSSAAEPEPTGINFVELLKKKKDEEQ |
| Ga0306921_123244041 | 3300031912 | Soil | FQGQSQGVARLVDPVVNGQLPSPKAATPAAPQPTGINFVELLHRKKDEEEPPW |
| Ga0310916_101048001 | 3300031942 | Soil | VNGQLPSTRSAKAADPEPTGINFVDLLVKKKDEEEPPW |
| Ga0310916_101298753 | 3300031942 | Soil | ARLVDPVVNAQLPSVKPSPAADPEPTGINFVDLLIKKKDEEEPPW |
| Ga0310913_101968433 | 3300031945 | Soil | KSEGTARLVDAVVNGQLPSTKPAKPADPEPTGINFVDLLVKKKDEEEPPW |
| Ga0310910_112712512 | 3300031946 | Soil | PAVVEIYFQGKSEGTARLADAVVNGQLPSTKPTKTVEPEPTGINFVDLLVKKKSEEDPPW |
| Ga0310909_103882123 | 3300031947 | Soil | VDPVVNAQLPSAKPPQPEEPEPTGINFVELLNKKK |
| Ga0310909_106351391 | 3300031947 | Soil | LVDPVVNAQLPSVKPSPAADPEPTGINFVDLLIKKKDEEEPPW |
| Ga0318530_100171173 | 3300031959 | Soil | FQGQLEGTARLVDPVVNGQLPSAKPAKAAESQPTGINFVDLLIQKKDEEEPPW |
| Ga0307479_100795224 | 3300031962 | Hardwood Forest Soil | LQATARPVDPVVNGQLPSVKPAASPEPEPTGINFVELLKQKSDDGKDEE |
| Ga0318559_104302782 | 3300032039 | Soil | VNGQLPSTKPAKAADPEPTGINFVDLLVKKKDEEEPPW |
| Ga0318549_105663572 | 3300032041 | Soil | MVEIYFQGQLEGTARLVDPVVNGQLPSAKPAKAAESQPTGINFVDLLIQKKDEEEPPW |
| Ga0318545_100614043 | 3300032042 | Soil | GVARLVDPVVNAQLPSVKPSPAADPEPTGINFVDLLIKKKDEEEPPW |
| Ga0318556_103843361 | 3300032043 | Soil | AEGPARLVDPVVNGQLPSAKPSKGAEPEPTGINFVDLLIKKKDEEEPPW |
| Ga0318558_100278281 | 3300032044 | Soil | DPVVNGQLPSAKPSKGAEPEPTGINFVDLLIKKKDEEEPPW |
| Ga0318505_101490191 | 3300032060 | Soil | QGVARLVDPVVNGQLPSPKSSPAAAEPTSINFVELLLQKKDGEEPPW |
| Ga0318504_101796712 | 3300032063 | Soil | PVVNAQLPLVKPSPAADPEPTGINFVDLLIKKKDEEEPPW |
| Ga0318504_103841582 | 3300032063 | Soil | KPEGTARLVDPVVNGQLPSTKSSKAEPEPTGINFVDLLIKKKDEEK |
| Ga0318524_107544912 | 3300032067 | Soil | VNGQLPRAKPASTPPPAPTGINFVELLKANKNDGED |
| Ga0318525_100198944 | 3300032089 | Soil | TARLVDPVVNAQLPSAKSSKAEPQPTGINFVDLLIKKKDEEEPPW |
| Ga0318525_107256561 | 3300032089 | Soil | AARLVDPVVNAQRPSSQPSPARAPEPTGINFVELLKKKKDEEE |
| Ga0318540_103240821 | 3300032094 | Soil | AVVNGQLPSTKPVKAADPEPTGINFVDLLVKKKDEEEPPW |
| Ga0311301_117844881 | 3300032160 | Peatlands Soil | TARLVDPVVNAGLPPVKRSAAAEPEPTGINFVELLNRKKEEEE |
| Ga0307472_1020934351 | 3300032205 | Hardwood Forest Soil | EATARPVDPVVNGQSPSVKPAASPEPEPTGINFVELLKQKSDDGKDEE |
| Ga0335079_120556231 | 3300032783 | Soil | PVVNGQLPSVKPSKAAESQPTGINFVDLLIKKKDEEEPPW |
| Ga0335078_124520432 | 3300032805 | Soil | VNGQLPSAKPAKAADPEPTGINFVDLLVKKKDEEEPPW |
| Ga0335080_110848382 | 3300032828 | Soil | VVNGQLPSAKPAKAADPEPTGINFVDLLVKKKDEEEPPW |
| Ga0335071_101287591 | 3300032897 | Soil | TAVVEIYFQGKAEGTAHLVDPVVNSQLPSAKPSKAAEPEATGINFVDLLIKKKDEEEPPW |
| Ga0335071_101716983 | 3300032897 | Soil | DPDLVEIFFHGKSEGTARLVDAVVNGQLPSTKPAKAADPEPTGINFVDLLVKKKDEEEPP |
| Ga0316622_1016483422 | 3300033416 | Soil | DPVVNAQLPSAKSSKAEPQPTGINFVDLLIKKKDEEEPPW |
| Ga0371490_10155501 | 3300033561 | Peat Soil | VVNAQLPSAKPPRAAEPQPTGINFVELLKKKKEEE |
| Ga0371489_0422053_495_608 | 3300033755 | Peat Soil | DPVVNAQLPSAKPPRAAEPQPTGINFVELLKKKKEEE |
| Ga0370513_188040_3_110 | 3300034161 | Untreated Peat Soil | INAQLPSAKRSAPAEPEPTGINFVELLQQKKDRKE |
| ⦗Top⦘ |