Metagenome / Metatranscriptome Family F031640

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F031640
Family Type	Metagenome / Metatranscriptome
Number of Sequences	182
Average Sequence Length	38 residues
Representative Sequence	LFKTLKRALEGRRFAWDKLERTAAVKYVPSENRDSVNVP
Number of Associated Samples	156
Number of Associated Scaffolds	182

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	1.10 %
% of genes near scaffold ends (potentially truncated)	98.35 %
% of genes from short scaffolds (< 2000 bps)	93.96 %
Associated GOLD sequencing projects	149
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.23

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (70.879 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (10.989 % of family members)
Environment Ontology (ENVO)	Unclassified (20.330 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (46.703 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 26.87% β-sheet: 0.00% Coil/Unstructured: 73.13%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.23
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.23
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 182 Family Scaffolds
PF01212	Beta_elim_lyase	21.98
PF00756	Esterase	15.38
PF00171	Aldedh	9.34
PF02823	ATP-synt_DE_N	4.95
PF00561	Abhydrolase_1	2.75
PF02922	CBM_48	2.20
PF01182	Glucosamine_iso	2.20
PF07238	PilZ	1.10
PF07883	Cupin_2	1.10
PF08338	DUF1731	1.10
PF00440	TetR_N	1.10
PF00006	ATP-synt_ab	0.55
PF00999	Na_H_Exchanger	0.55
PF13641	Glyco_tranf_2_3	0.55
PF08681	DUF1778	0.55
PF13692	Glyco_trans_1_4	0.55
PF04932	Wzy_C	0.55
PF04226	Transgly_assoc	0.55
PF09976	TPR_21	0.55
PF11645	PDDEXK_5	0.55
PF00583	Acetyltransf_1	0.55
PF00534	Glycos_transf_1	0.55
PF04299	FMN_bind_2	0.55
PF05635	23S_rRNA_IVP	0.55

COG ID	Name	Functional Category	% Frequency in 182 Family Scaffolds
COG1167	DNA-binding transcriptional regulator, MocR family, contains an aminotransferase domain	Transcription [K]	43.96
COG0520	Selenocysteine lyase/Cysteine desulfurase	Amino acid transport and metabolism [E]	21.98
COG2873	O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent	Amino acid transport and metabolism [E]	21.98
COG3033	Tryptophanase	Amino acid transport and metabolism [E]	21.98
COG2008	Threonine aldolase	Amino acid transport and metabolism [E]	21.98
COG1982	Arginine/lysine/ornithine decarboxylase	Amino acid transport and metabolism [E]	21.98
COG1921	Seryl-tRNA(Sec) selenium transferase	Translation, ribosomal structure and biogenesis [J]	21.98
COG1104	Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family	Amino acid transport and metabolism [E]	21.98
COG1003	Glycine cleavage system protein P (pyridoxal-binding), C-terminal domain	Amino acid transport and metabolism [E]	21.98
COG0626	Cystathionine beta-lyase/cystathionine gamma-synthase	Amino acid transport and metabolism [E]	21.98
COG0436	Aspartate/methionine/tyrosine aminotransferase	Amino acid transport and metabolism [E]	21.98
COG0399	dTDP-4-amino-4,6-dideoxygalactose transaminase	Cell wall/membrane/envelope biogenesis [M]	21.98
COG0156	7-keto-8-aminopelargonate synthetase or related enzyme	Coenzyme transport and metabolism [H]	21.98
COG0112	Glycine/serine hydroxymethyltransferase	Amino acid transport and metabolism [E]	21.98
COG0076	Glutamate or tyrosine decarboxylase or a related PLP-dependent protein	Amino acid transport and metabolism [E]	21.98
COG0075	Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG	Amino acid transport and metabolism [E]	21.98
COG4992	Acetylornithine/succinyldiaminopimelate/putrescine aminotransferase	Amino acid transport and metabolism [E]	21.98
COG4230	Delta 1-pyrroline-5-carboxylate dehydrogenase	Amino acid transport and metabolism [E]	9.34
COG1012	Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase	Lipid transport and metabolism [I]	9.34
COG0014	Gamma-glutamyl phosphate reductase	Amino acid transport and metabolism [E]	9.34
COG0355	FoF1-type ATP synthase, epsilon subunit	Energy production and conversion [C]	4.95
COG0363	6-phosphogluconolactonase/Glucosamine-6-phosphate isomerase/deaminase	Carbohydrate transport and metabolism [G]	2.20
COG1090	NAD dependent epimerase/dehydratase family enzyme	General function prediction only [R]	1.10
COG3004	Na+/H+ antiporter NhaA	Energy production and conversion [C]	0.55
COG2261	Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family	General function prediction only [R]	0.55
COG3263	NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains	Energy production and conversion [C]	0.55
COG3307	O-antigen ligase	Cell wall/membrane/envelope biogenesis [M]	0.55
COG0475	Kef-type K+ transport system, membrane component KefB	Inorganic ion transport and metabolism [P]	0.55
COG4453	Uncharacterized conserved protein, DUF1778 family	Function unknown [S]	0.55
COG4651	Predicted Kef-type K+ transport protein, K+/H+ antiporter domain	Inorganic ion transport and metabolism [P]	0.55
COG0025	NhaP-type Na+/H+ or K+/H+ antiporter	Inorganic ion transport and metabolism [P]	0.55

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	72.53 %
Unclassified	root	N/A	27.47 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	72.53 %
Unclassified	root	N/A	27.47 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	70.88 %
Unclassified	root	N/A	27.47 %
Archaea	superkingdom	All Organisms → cellular organisms → Archaea	1.65 %

Name	Rank	Taxonomy	Distribution
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	39.01 %
Unclassified	root	N/A	27.47 %
DPANN group	clade	All Organisms → cellular organisms → Archaea → DPANN group	1.65 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	1.10 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	27.47 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	21.43 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	12.09 %
Candidatus Woesearchaeota	phylum	All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota	1.65 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.55 %
unclassified Proteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria	0.55 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	27.47 %
Acidobacteriales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales	21.43 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	12.09 %
Candidatus Woesearchaeota archaeon	species	All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon	1.65 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	0.55 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.55 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	27.47 %
Acidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	20.33 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	12.09 %
Candidatus Woesearchaeota archaeon	species	All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon	1.65 %
unclassified Terriglobales	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales	1.10 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	0.55 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.55 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	27.47 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	12.09 %
Candidatus Koribacter	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter	3.30 %
Candidatus Woesearchaeota archaeon	species	All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon	1.65 %
Terriglobales bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium	1.10 %
unclassified Acidobacteriaceae	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae	0.55 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	0.55 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.55 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	27.47 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	12.09 %
Candidatus Koribacter versatilis	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis	2.75 %
Candidatus Woesearchaeota archaeon	species	All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon	1.65 %
Terriglobales bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium	1.10 %
Acidobacteriaceae bacterium KBS 83	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83	0.55 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	0.55 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.55 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	27.47 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	12.09 %
Candidatus Woesearchaeota archaeon	species	All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon	1.65 %
Terriglobales bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium	1.10 %
Candidatus Koribacter versatilis Ellin345	isolate	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis → Candidatus Koribacter versatilis Ellin345	0.55 %
Acidobacteriaceae bacterium KBS 83	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83	0.55 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	0.55 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.55 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000156\|NODE_c0563714	All Organisms → cellular organisms → Bacteria	1334	Open in IMG/M
3300001527\|A3513AW1_1067754	Not Available	501	Open in IMG/M
3300001546\|JGI12659J15293_10110454	Not Available	597	Open in IMG/M
3300002245\|JGIcombinedJ26739_100607949	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	970	Open in IMG/M
3300002245\|JGIcombinedJ26739_101418563	All Organisms → cellular organisms → Bacteria	588	Open in IMG/M
3300004080\|Ga0062385_10876339	All Organisms → cellular organisms → Bacteria	594	Open in IMG/M
3300004080\|Ga0062385_11246003	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	510	Open in IMG/M
3300005177\|Ga0066690_11057404	All Organisms → cellular organisms → Bacteria	506	Open in IMG/M
3300005181\|Ga0066678_10411701	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	897	Open in IMG/M
3300005435\|Ga0070714_102180992	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	539	Open in IMG/M
3300005445\|Ga0070708_101161470	All Organisms → cellular organisms → Bacteria	723	Open in IMG/M
3300005526\|Ga0073909_10693070	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	510	Open in IMG/M
3300005533\|Ga0070734_10496158	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	696	Open in IMG/M
3300005538\|Ga0070731_10101867	All Organisms → cellular organisms → Bacteria	1902	Open in IMG/M
3300005540\|Ga0066697_10795849	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	514	Open in IMG/M
3300005542\|Ga0070732_10371277	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter	862	Open in IMG/M
3300005547\|Ga0070693_100826271	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	689	Open in IMG/M
3300005547\|Ga0070693_101194186	All Organisms → cellular organisms → Bacteria	584	Open in IMG/M
3300005587\|Ga0066654_10250899	All Organisms → cellular organisms → Bacteria	933	Open in IMG/M
3300005591\|Ga0070761_10959204	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	542	Open in IMG/M
3300005602\|Ga0070762_10251769	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	1098	Open in IMG/M
3300005610\|Ga0070763_10493480	All Organisms → cellular organisms → Bacteria	699	Open in IMG/M
3300005712\|Ga0070764_10518656	All Organisms → cellular organisms → Bacteria	718	Open in IMG/M
3300005834\|Ga0068851_10097179	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	1558	Open in IMG/M
3300005899\|Ga0075271_10052390	All Organisms → cellular organisms → Bacteria → Acidobacteria	740	Open in IMG/M
3300005921\|Ga0070766_10263496	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	1097	Open in IMG/M
3300006050\|Ga0075028_100105670	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	1442	Open in IMG/M
3300006050\|Ga0075028_101037585	All Organisms → cellular organisms → Bacteria	512	Open in IMG/M
3300006052\|Ga0075029_100457912	All Organisms → cellular organisms → Bacteria	837	Open in IMG/M
3300006052\|Ga0075029_100495387	All Organisms → cellular organisms → Bacteria	806	Open in IMG/M
3300006052\|Ga0075029_100524839	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	784	Open in IMG/M
3300006052\|Ga0075029_101314973	All Organisms → cellular organisms → Bacteria	508	Open in IMG/M
3300006059\|Ga0075017_101036537	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	639	Open in IMG/M
3300006172\|Ga0075018_10168608	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	1021	Open in IMG/M
3300006175\|Ga0070712_100874511	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	774	Open in IMG/M
3300006354\|Ga0075021_10489764	All Organisms → cellular organisms → Bacteria	778	Open in IMG/M
3300006755\|Ga0079222_12408904	All Organisms → cellular organisms → Bacteria	527	Open in IMG/M
3300006881\|Ga0068865_100202566	All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon	1541	Open in IMG/M
3300009038\|Ga0099829_11369622	All Organisms → cellular organisms → Bacteria	584	Open in IMG/M
3300009090\|Ga0099827_11296939	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	633	Open in IMG/M
3300009090\|Ga0099827_11513870	Not Available	584	Open in IMG/M
3300009090\|Ga0099827_11783035	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	536	Open in IMG/M
3300009174\|Ga0105241_10068214	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	2755	Open in IMG/M
3300009176\|Ga0105242_10757799	Not Available	956	Open in IMG/M
3300009518\|Ga0116128_1034577	All Organisms → cellular organisms → Bacteria	1658	Open in IMG/M
3300009520\|Ga0116214_1155205	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	853	Open in IMG/M
3300009522\|Ga0116218_1004822	All Organisms → cellular organisms → Bacteria	6461	Open in IMG/M
3300009615\|Ga0116103_1148553	Not Available	569	Open in IMG/M
3300009645\|Ga0116106_1135160	Not Available	791	Open in IMG/M
3300009645\|Ga0116106_1287343	Not Available	523	Open in IMG/M
3300009792\|Ga0126374_10149755	All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon	1412	Open in IMG/M
3300010048\|Ga0126373_11067629	Not Available	873	Open in IMG/M
3300010325\|Ga0134064_10452803	All Organisms → cellular organisms → Bacteria → Acidobacteria	523	Open in IMG/M
3300010358\|Ga0126370_11355578	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	669	Open in IMG/M
3300010361\|Ga0126378_12459634	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	595	Open in IMG/M
3300010375\|Ga0105239_11498643	All Organisms → cellular organisms → Bacteria → Acidobacteria	779	Open in IMG/M
3300010376\|Ga0126381_102402178	Not Available	756	Open in IMG/M
3300010376\|Ga0126381_104146045	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	563	Open in IMG/M
3300011120\|Ga0150983_15956579	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis → Candidatus Koribacter versatilis Ellin345	760	Open in IMG/M
3300011271\|Ga0137393_10760181	All Organisms → cellular organisms → Bacteria	829	Open in IMG/M
3300012208\|Ga0137376_11005284	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	714	Open in IMG/M
3300012208\|Ga0137376_11047346	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	698	Open in IMG/M
3300012211\|Ga0137377_11119223	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	717	Open in IMG/M
3300012350\|Ga0137372_10561900	All Organisms → cellular organisms → Bacteria	841	Open in IMG/M
3300012683\|Ga0137398_11069188	All Organisms → cellular organisms → Bacteria	557	Open in IMG/M
3300012917\|Ga0137395_10573448	All Organisms → cellular organisms → Bacteria	815	Open in IMG/M
3300012960\|Ga0164301_11618596	Not Available	538	Open in IMG/M
3300013307\|Ga0157372_11898676	Not Available	685	Open in IMG/M
3300014156\|Ga0181518_10466075	All Organisms → cellular organisms → Bacteria	602	Open in IMG/M
3300014159\|Ga0181530_10330403	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	792	Open in IMG/M
3300014159\|Ga0181530_10512755	All Organisms → cellular organisms → Bacteria	596	Open in IMG/M
3300014161\|Ga0181529_10714851	Not Available	516	Open in IMG/M
3300014169\|Ga0181531_10196372	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83	1225	Open in IMG/M
3300014325\|Ga0163163_10284044	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	1707	Open in IMG/M
3300014657\|Ga0181522_10879505	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	552	Open in IMG/M
3300014968\|Ga0157379_10310371	All Organisms → cellular organisms → Bacteria	1439	Open in IMG/M
3300014968\|Ga0157379_11341973	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	692	Open in IMG/M
3300015242\|Ga0137412_10964320	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	613	Open in IMG/M
3300015245\|Ga0137409_10156932	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	2078	Open in IMG/M
3300017822\|Ga0187802_10208693	Not Available	752	Open in IMG/M
3300017823\|Ga0187818_10442629	Not Available	580	Open in IMG/M
3300017928\|Ga0187806_1307188	Not Available	560	Open in IMG/M
3300017938\|Ga0187854_10179469	Not Available	946	Open in IMG/M
3300017943\|Ga0187819_10220178	Not Available	1116	Open in IMG/M
3300017948\|Ga0187847_10487372	Not Available	683	Open in IMG/M
3300017948\|Ga0187847_10565484	All Organisms → cellular organisms → Bacteria	634	Open in IMG/M
3300017955\|Ga0187817_10101542	All Organisms → cellular organisms → Bacteria	1810	Open in IMG/M
3300017970\|Ga0187783_11015583	Not Available	597	Open in IMG/M
3300017972\|Ga0187781_10252657	All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon	1248	Open in IMG/M
3300017975\|Ga0187782_10024201	All Organisms → cellular organisms → Bacteria → Acidobacteria	4424	Open in IMG/M
3300017975\|Ga0187782_10716088	Not Available	772	Open in IMG/M
3300017999\|Ga0187767_10161088	Not Available	680	Open in IMG/M
3300018006\|Ga0187804_10049173	Not Available	1646	Open in IMG/M
3300018007\|Ga0187805_10216688	All Organisms → cellular organisms → Bacteria	875	Open in IMG/M
3300018008\|Ga0187888_1100886	Not Available	1230	Open in IMG/M
3300018013\|Ga0187873_1398540	Not Available	501	Open in IMG/M
3300018024\|Ga0187881_10067586	All Organisms → cellular organisms → Bacteria	1679	Open in IMG/M
3300018034\|Ga0187863_10063622	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	2091	Open in IMG/M
3300018037\|Ga0187883_10485421	All Organisms → cellular organisms → Bacteria	636	Open in IMG/M
3300018042\|Ga0187871_10621486	Not Available	600	Open in IMG/M
3300018047\|Ga0187859_10765782	Not Available	552	Open in IMG/M
3300018062\|Ga0187784_11260317	All Organisms → cellular organisms → Bacteria	586	Open in IMG/M
3300018062\|Ga0187784_11520747	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	530	Open in IMG/M
3300018085\|Ga0187772_10068391	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	2226	Open in IMG/M
3300018086\|Ga0187769_10041491	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis	3168	Open in IMG/M
3300018433\|Ga0066667_10330724	All Organisms → cellular organisms → Bacteria	1201	Open in IMG/M
3300018433\|Ga0066667_11564524	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	585	Open in IMG/M
3300019284\|Ga0187797_1044300	All Organisms → cellular organisms → Bacteria	555	Open in IMG/M
3300021088\|Ga0210404_10005094	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	5295	Open in IMG/M
3300021170\|Ga0210400_10573990	Not Available	930	Open in IMG/M
3300021171\|Ga0210405_10265207	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium	1358	Open in IMG/M
3300021180\|Ga0210396_10548695	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium	1008	Open in IMG/M
3300021181\|Ga0210388_11040564	All Organisms → cellular organisms → Bacteria → Acidobacteria	700	Open in IMG/M
3300021358\|Ga0213873_10186478	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	638	Open in IMG/M
3300021402\|Ga0210385_10430176	Not Available	994	Open in IMG/M
3300021404\|Ga0210389_10643902	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	832	Open in IMG/M
3300021405\|Ga0210387_10232968	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis	1607	Open in IMG/M
3300021407\|Ga0210383_11675911	Not Available	521	Open in IMG/M
3300021420\|Ga0210394_10859981	All Organisms → cellular organisms → Bacteria	790	Open in IMG/M
3300021433\|Ga0210391_10620666	All Organisms → cellular organisms → Bacteria	848	Open in IMG/M
3300021433\|Ga0210391_10983696	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	657	Open in IMG/M
3300021478\|Ga0210402_10286572	All Organisms → cellular organisms → Bacteria → Acidobacteria	1524	Open in IMG/M
3300021478\|Ga0210402_11521389	All Organisms → cellular organisms → Bacteria → Acidobacteria	596	Open in IMG/M
3300021559\|Ga0210409_11636746	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	520	Open in IMG/M
3300021560\|Ga0126371_10821866	Not Available	1075	Open in IMG/M
3300021560\|Ga0126371_10853911	All Organisms → cellular organisms → Bacteria	1055	Open in IMG/M
3300021560\|Ga0126371_11676380	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	760	Open in IMG/M
3300022557\|Ga0212123_10120314	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	2090	Open in IMG/M
3300022557\|Ga0212123_10143261	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	1856	Open in IMG/M
3300025432\|Ga0208821_1044061	All Organisms → cellular organisms → Bacteria	835	Open in IMG/M
3300025576\|Ga0208820_1047167	Not Available	1224	Open in IMG/M
3300025898\|Ga0207692_11121365	Not Available	521	Open in IMG/M
3300025915\|Ga0207693_11035015	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	626	Open in IMG/M
3300025927\|Ga0207687_10051374	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	2874	Open in IMG/M
3300026034\|Ga0208773_1026445	All Organisms → cellular organisms → Bacteria → Acidobacteria	752	Open in IMG/M
3300026078\|Ga0207702_10212488	Not Available	1799	Open in IMG/M
3300026223\|Ga0209840_1029505	All Organisms → cellular organisms → Bacteria	1255	Open in IMG/M
3300026301\|Ga0209238_1004226	All Organisms → cellular organisms → Bacteria	5773	Open in IMG/M
3300026538\|Ga0209056_10679734	Not Available	520	Open in IMG/M
3300027505\|Ga0209218_1079961	Not Available	676	Open in IMG/M
3300027583\|Ga0209527_1144675	Not Available	527	Open in IMG/M
3300027616\|Ga0209106_1127636	All Organisms → cellular organisms → Bacteria	570	Open in IMG/M
3300027641\|Ga0208827_1035785	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis	1743	Open in IMG/M
3300027643\|Ga0209076_1041579	All Organisms → cellular organisms → Bacteria	1295	Open in IMG/M
3300027645\|Ga0209117_1181388	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	538	Open in IMG/M
3300027652\|Ga0209007_1034798	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	1291	Open in IMG/M
3300027692\|Ga0209530_1190321	All Organisms → cellular organisms → Bacteria	568	Open in IMG/M
3300027698\|Ga0209446_1044114	All Organisms → cellular organisms → Bacteria	1125	Open in IMG/M
3300027842\|Ga0209580_10259732	All Organisms → cellular organisms → Bacteria	864	Open in IMG/M
3300027857\|Ga0209166_10560749	Not Available	583	Open in IMG/M
3300027867\|Ga0209167_10145238	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	1241	Open in IMG/M
3300027867\|Ga0209167_10356240	All Organisms → cellular organisms → Bacteria	795	Open in IMG/M
3300027869\|Ga0209579_10118139	All Organisms → cellular organisms → Bacteria	1408	Open in IMG/M
3300027869\|Ga0209579_10268858	All Organisms → cellular organisms → Bacteria	917	Open in IMG/M
3300027882\|Ga0209590_11036692	All Organisms → cellular organisms → Bacteria	510	Open in IMG/M
3300027895\|Ga0209624_10138179	All Organisms → cellular organisms → Bacteria	1607	Open in IMG/M
3300027898\|Ga0209067_10287294	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	901	Open in IMG/M
3300027908\|Ga0209006_10431164	Not Available	1106	Open in IMG/M
3300027910\|Ga0209583_10513269	Not Available	595	Open in IMG/M
3300027911\|Ga0209698_10168117	All Organisms → cellular organisms → Bacteria	1789	Open in IMG/M
3300027911\|Ga0209698_10758809	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	735	Open in IMG/M
3300029915\|Ga0311358_10519682	Not Available	922	Open in IMG/M
3300029944\|Ga0311352_10348489	Not Available	1223	Open in IMG/M
3300030043\|Ga0302306_10420909	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	510	Open in IMG/M
3300030617\|Ga0311356_12006339	Not Available	511	Open in IMG/M
3300030838\|Ga0311335_10459553	All Organisms → cellular organisms → Bacteria	881	Open in IMG/M
3300030862\|Ga0265753_1010599	Not Available	1204	Open in IMG/M
3300031028\|Ga0302180_10172014	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1185	Open in IMG/M
3300031231\|Ga0170824_100990997	Not Available	512	Open in IMG/M
3300031249\|Ga0265339_10093713	All Organisms → cellular organisms → Bacteria	1571	Open in IMG/M
3300031708\|Ga0310686_113594797	Not Available	522	Open in IMG/M
3300031713\|Ga0318496_10612077	All Organisms → cellular organisms → Bacteria → Acidobacteria	602	Open in IMG/M
3300031715\|Ga0307476_10138330	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis	1743	Open in IMG/M
3300031718\|Ga0307474_11266232	All Organisms → cellular organisms → Bacteria → Acidobacteria	582	Open in IMG/M
3300031779\|Ga0318566_10149554	All Organisms → cellular organisms → Bacteria	1157	Open in IMG/M
3300031793\|Ga0318548_10394326	Not Available	679	Open in IMG/M
3300031845\|Ga0318511_10327029	Not Available	696	Open in IMG/M
3300032041\|Ga0318549_10050956	All Organisms → cellular organisms → Bacteria	1708	Open in IMG/M
3300032782\|Ga0335082_11309223	Not Available	593	Open in IMG/M
3300032898\|Ga0335072_11400740	Not Available	604	Open in IMG/M
3300032955\|Ga0335076_11219517	All Organisms → cellular organisms → Bacteria	636	Open in IMG/M
3300033983\|Ga0371488_0178227	Not Available	1089	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	92.31%
Host-Associated	Host-Associated	7.14%
Engineered	Engineered	0.55%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	66.48%
Aquatic	Environmental → Aquatic	25.82%
Plants	Host-Associated → Plants	7.14%
Solid Waste	Engineered → Solid Waste	0.55%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	62.64%
Freshwater	Environmental → Aquatic → Freshwater	17.58%
Sediment	Environmental → Aquatic → Sediment	7.14%
Rhizosphere	Host-Associated → Plants → Rhizosphere	4.95%
Peat	Environmental → Terrestrial → Peat	3.85%
Rhizoplane	Host-Associated → Plants → Rhizoplane	1.65%
Thermal Springs	Environmental → Aquatic → Thermal Springs	1.10%
Roots	Host-Associated → Plants → Roots	0.55%
Grass	Engineered → Solid Waste → Grass	0.55%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	40.66%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	17.58%
Loam	Environmental → Terrestrial → Soil → Loam	13.19%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	8.79%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	7.14%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	4.40%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	3.85%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	1.65%
Hot (42-90C)	Environmental → Aquatic → Thermal Springs → Hot (42-90C)	1.10%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.55%
Soil	Host-Associated → Plants → Rhizosphere → Soil	0.55%
Composting	Engineered → Solid Waste → Grass → Composting	0.55%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	22.53%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	12.64%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog	10.44%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	9.34%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	8.24%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	7.14%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	4.40%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	4.40%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	3.85%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	3.85%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	3.85%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	3.30%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	1.65%
Acidic	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic	1.10%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	0.55%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	0.55%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost	0.55%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.55%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	0.55%
Bioreactor	Engineered → Solid Waste → Grass → Composting → Bioreactor	0.55%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	10.99%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	8.24%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	7.14%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	6.59%
Peatland	Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland	5.49%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	5.49%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	4.95%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	4.95%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment	3.85%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog	3.30%
Peatland	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland	3.30%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	3.30%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	2.75%
Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil	2.75%
Palsa	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa	2.20%
Bog Forest Soil	Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil	1.65%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	1.65%
Peatlands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil	1.65%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	1.65%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	1.65%
Iron-Sulfur Acid Spring	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring	1.10%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	1.10%
Rice Paddy Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil	1.10%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	1.10%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.10%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	1.10%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.10%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	0.55%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	0.55%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost	0.55%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	0.55%
Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland	0.55%
Soil	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil	0.55%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil	0.55%
Fen	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen	0.55%
Bog	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog	0.55%
Peat Soil	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil	0.55%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.55%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	0.55%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	0.55%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.55%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere	0.55%
Sugar Cane Bagasse Incubating Bioreactor	Engineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor	0.55%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000156	Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobic	Engineered	Open in IMG/M
3300001527	Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-5cm-13A)- 1 week illumina	Environmental	Open in IMG/M
3300001546	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1	Environmental	Open in IMG/M
3300002245	Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)	Environmental	Open in IMG/M
3300004080	Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3	Environmental	Open in IMG/M
3300005177	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139	Environmental	Open in IMG/M
3300005181	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127	Environmental	Open in IMG/M
3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Environmental	Open in IMG/M
3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Environmental	Open in IMG/M
3300005526	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1	Environmental	Open in IMG/M
3300005533	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1	Environmental	Open in IMG/M
3300005538	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1	Environmental	Open in IMG/M
3300005540	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146	Environmental	Open in IMG/M
3300005542	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1	Environmental	Open in IMG/M
3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Environmental	Open in IMG/M
3300005587	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103	Environmental	Open in IMG/M
3300005591	Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1	Environmental	Open in IMG/M
3300005602	Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2	Environmental	Open in IMG/M
3300005610	Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3	Environmental	Open in IMG/M
3300005712	Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4	Environmental	Open in IMG/M
3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Host-Associated	Open in IMG/M
3300005899	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_302	Environmental	Open in IMG/M
3300005921	Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6	Environmental	Open in IMG/M
3300006050	Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014	Environmental	Open in IMG/M
3300006052	Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013	Environmental	Open in IMG/M
3300006059	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012	Environmental	Open in IMG/M
3300006172	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014	Environmental	Open in IMG/M
3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Environmental	Open in IMG/M
3300006354	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012	Environmental	Open in IMG/M
3300006755	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter	Environmental	Open in IMG/M
3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Host-Associated	Open in IMG/M
3300009038	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG	Environmental	Open in IMG/M
3300009090	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG	Environmental	Open in IMG/M
3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Host-Associated	Open in IMG/M
3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Host-Associated	Open in IMG/M
3300009518	Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150	Environmental	Open in IMG/M
3300009520	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG	Environmental	Open in IMG/M
3300009522	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG	Environmental	Open in IMG/M
3300009615	Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_100	Environmental	Open in IMG/M
3300009645	Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40	Environmental	Open in IMG/M
3300009792	Tropical forest soil microbial communities from Panama - MetaG Plot_12	Environmental	Open in IMG/M
3300010048	Tropical forest soil microbial communities from Panama - MetaG Plot_11	Environmental	Open in IMG/M
3300010325	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG	Environmental	Open in IMG/M
3300010358	Tropical forest soil microbial communities from Panama - MetaG Plot_3	Environmental	Open in IMG/M
3300010361	Tropical forest soil microbial communities from Panama - MetaG Plot_23	Environmental	Open in IMG/M
3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Host-Associated	Open in IMG/M
3300010376	Tropical forest soil microbial communities from Panama - MetaG Plot_28	Environmental	Open in IMG/M
3300011120	Combined assembly of Microbial Forest Soil metaT	Environmental	Open in IMG/M
3300011271	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG	Environmental	Open in IMG/M
3300012208	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG	Environmental	Open in IMG/M
3300012211	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG	Environmental	Open in IMG/M
3300012350	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG	Environmental	Open in IMG/M
3300012683	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG	Environmental	Open in IMG/M
3300012917	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG	Environmental	Open in IMG/M
3300012960	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG	Environmental	Open in IMG/M
3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Host-Associated	Open in IMG/M
3300014156	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG	Environmental	Open in IMG/M
3300014159	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG	Environmental	Open in IMG/M
3300014161	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaG	Environmental	Open in IMG/M
3300014169	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG	Environmental	Open in IMG/M
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated	Open in IMG/M
3300014657	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG	Environmental	Open in IMG/M
3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Host-Associated	Open in IMG/M
3300015242	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300015245	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300017822	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2	Environmental	Open in IMG/M
3300017823	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3	Environmental	Open in IMG/M
3300017928	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1	Environmental	Open in IMG/M
3300017938	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150	Environmental	Open in IMG/M
3300017943	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4	Environmental	Open in IMG/M
3300017948	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10	Environmental	Open in IMG/M
3300017955	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2	Environmental	Open in IMG/M
3300017970	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG	Environmental	Open in IMG/M
3300017972	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG	Environmental	Open in IMG/M
3300017975	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG	Environmental	Open in IMG/M
3300017999	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG	Environmental	Open in IMG/M
3300018006	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4	Environmental	Open in IMG/M
3300018007	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5	Environmental	Open in IMG/M
3300018008	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40	Environmental	Open in IMG/M
3300018013	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100	Environmental	Open in IMG/M
3300018024	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100	Environmental	Open in IMG/M
3300018034	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10	Environmental	Open in IMG/M
3300018037	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10	Environmental	Open in IMG/M
3300018042	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10	Environmental	Open in IMG/M
3300018047	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10	Environmental	Open in IMG/M
3300018062	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG	Environmental	Open in IMG/M
3300018085	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG	Environmental	Open in IMG/M
3300018086	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG	Environmental	Open in IMG/M
3300018433	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116	Environmental	Open in IMG/M
3300019284	Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300021088	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M	Environmental	Open in IMG/M
3300021170	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M	Environmental	Open in IMG/M
3300021171	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M	Environmental	Open in IMG/M
3300021180	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O	Environmental	Open in IMG/M
3300021181	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O	Environmental	Open in IMG/M
3300021358	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3	Host-Associated	Open in IMG/M
3300021402	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O	Environmental	Open in IMG/M
3300021404	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O	Environmental	Open in IMG/M
3300021405	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O	Environmental	Open in IMG/M
3300021407	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O	Environmental	Open in IMG/M
3300021420	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M	Environmental	Open in IMG/M
3300021433	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O	Environmental	Open in IMG/M
3300021478	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M	Environmental	Open in IMG/M
3300021559	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M	Environmental	Open in IMG/M
3300021560	Tropical forest soil microbial communities from Panama - MetaG Plot_4	Environmental	Open in IMG/M
3300022557	Paint Pots_combined assembly	Environmental	Open in IMG/M
3300025432	Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40 (SPAdes)	Environmental	Open in IMG/M
3300025576	Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 (SPAdes)	Environmental	Open in IMG/M
3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026034	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_302 (SPAdes)	Environmental	Open in IMG/M
3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026223	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190 (SPAdes)	Environmental	Open in IMG/M
3300026301	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes)	Environmental	Open in IMG/M
3300026538	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)	Environmental	Open in IMG/M
3300027505	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O3 (SPAdes)	Environmental	Open in IMG/M
3300027583	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes)	Environmental	Open in IMG/M
3300027616	Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M3 (SPAdes)	Environmental	Open in IMG/M
3300027641	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes)	Environmental	Open in IMG/M
3300027643	Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes)	Environmental	Open in IMG/M
3300027645	Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes)	Environmental	Open in IMG/M
3300027652	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes)	Environmental	Open in IMG/M
3300027692	Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 (SPAdes)	Environmental	Open in IMG/M
3300027698	Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes)	Environmental	Open in IMG/M
3300027842	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)	Environmental	Open in IMG/M
3300027857	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes)	Environmental	Open in IMG/M
3300027867	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)	Environmental	Open in IMG/M
3300027869	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)	Environmental	Open in IMG/M
3300027882	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)	Environmental	Open in IMG/M
3300027895	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)	Environmental	Open in IMG/M
3300027898	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes)	Environmental	Open in IMG/M
3300027908	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)	Environmental	Open in IMG/M
3300027910	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes)	Environmental	Open in IMG/M
3300027911	Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)	Environmental	Open in IMG/M
3300029915	III_Bog_E1 coassembly	Environmental	Open in IMG/M
3300029944	II_Palsa_E1 coassembly	Environmental	Open in IMG/M
3300030043	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_1	Environmental	Open in IMG/M
3300030617	II_Palsa_N2 coassembly	Environmental	Open in IMG/M
3300030838	I_Fen_N1 coassembly	Environmental	Open in IMG/M
3300030862	Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031028	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2	Environmental	Open in IMG/M
3300031231	Coassembly Site 11 (all samples) - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Host-Associated	Open in IMG/M
3300031708	FICUS49499 Metagenome Czech Republic combined assembly	Environmental	Open in IMG/M
3300031713	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22	Environmental	Open in IMG/M
3300031715	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05	Environmental	Open in IMG/M
3300031718	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05	Environmental	Open in IMG/M
3300031779	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22	Environmental	Open in IMG/M
3300031793	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21	Environmental	Open in IMG/M
3300031845	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18	Environmental	Open in IMG/M
3300032041	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22	Environmental	Open in IMG/M
3300032782	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1	Environmental	Open in IMG/M
3300032898	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1	Environmental	Open in IMG/M
3300032955	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5	Environmental	Open in IMG/M
3300033983	Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB23AN SIP fraction	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
NODE_05637141	3300000156	Sugar Cane Bagasse Incubating Bioreactor	TLKRALEGGRFAWDKLERTAAVRYQPSERRDSVNVP*
A3513AW1_10677542	3300001527	Permafrost	VLFKTIKRAATGEPFAWDKLERTAAVTYQESEDSVQVP*
JGI12659J15293_101104542	3300001546	Forest Soil	LFKTLKRALEGRKFAWDKLERTAAVKRVASEDRESVNVP*
JGIcombinedJ26739_1006079492	3300002245	Forest Soil	LKRALEGRKFAWDKLERTAAVKRVASEDRESVNVP*
JGIcombinedJ26739_1014185631	3300002245	Forest Soil	TVKRALGGQRFAWDKLERTAKMSFRTTESHDSVKVP*
Ga0062385_108763391	3300004080	Bog Forest Soil	LVLFRTLKRAIQGLPFAWDKLDRTAAVKYVPAERRDSVKV*
Ga0062385_112460031	3300004080	Bog Forest Soil	SLVLFRTLKRAIQGLPFAWDKLDRTAAVKYVPAERKDSVKV*
Ga0066690_110574041	3300005177	Soil	VLLKTLKRAIEGQRFAWDKLERTAAVRYTPAERRDSVKVP*
Ga0066678_104117012	3300005181	Soil	VVLLKTLKRAIEGQRFAWDKLERTAAMSYRPAESHDSVKVP*
Ga0070714_1021809922	3300005435	Agricultural Soil	LFKTLKRALEGRRFAWDKLERTAAVNYVPAENHNHVKVP*
Ga0070708_1011614702	3300005445	Corn, Switchgrass And Miscanthus Rhizosphere	FSVVLIKTLKRAIQGKLFAWDKLERTAAVNYMPAERRDSVNVP*
Ga0073909_106930702	3300005526	Surface Soil	TLKRALEGRKFAWDKLERTAAVKYVPAETHDSVNVH*
Ga0070734_104961583	3300005533	Surface Soil	LKRALEGRKFAWDKLERTAAVKYVPAETRDQVNVP*
Ga0070731_101018673	3300005538	Surface Soil	VKRAIEGQRFAWDKLERTASMSIKTPEPRESVKVP*
Ga0066697_107958492	3300005540	Soil	KTVKRAAEGEPFAWDKLERTAAVTYRESEDSVHVH*
Ga0070732_103712771	3300005542	Surface Soil	LFKTLNRALEGRKFAWDKLERTAAVRYVPAENHDQVNVP*
Ga0070693_1008262711	3300005547	Corn, Switchgrass And Miscanthus Rhizosphere	IVLFKTVIRAIKGEPFAWDKLERTAAVTFEEQEESVEVH*
Ga0070693_1011941862	3300005547	Corn, Switchgrass And Miscanthus Rhizosphere	VLLKTLKRALEGGRFAWDKLERTAAVRYQPSERRDSVNVP*
Ga0066654_102508992	3300005587	Soil	LVLFKTVKRALTGEPFSWDKLERTAAVTYEEAEDSIQVP*
Ga0070761_109592041	3300005591	Soil	VKRAIEGQRFAWDKLERTAKMSFRTTETHDSVKVP*
Ga0070762_102517691	3300005602	Soil	VLFKTLKRALEGRRFAWDKLERTAAVNYIPSENRDHVNVP*
Ga0070763_104934802	3300005610	Soil	KTLKRALEGRKFAWDKLERTAAVKYVPSENRDQVNVP*
Ga0070764_105186562	3300005712	Soil	VLFKTLKRALEGRKFAWDKLERTAAVKYVPSENRDQVNVP*
Ga0068851_100971792	3300005834	Corn Rhizosphere	KTLKRALEGQAFAWDKLERTAQVTQIPAEQESVKVP*
Ga0075271_100523902	3300005899	Rice Paddy Soil	IVLVRTLKRALEGRKFGWDKLERTATVRYEKHEEEPLLTKK*
Ga0070766_102634963	3300005921	Soil	VLFKTLKRALEGRRFAWDKLERTAAVNYVPTENRDSVNVP*
Ga0075028_1001056701	3300006050	Watersheds	IKTLKRAIAGRPFAWDKLERTAAVNYVPAERRDSVNVP*
Ga0075028_1010375851	3300006050	Watersheds	LKTLKRALEGGRFAWDKLERTAAVRYQPSERRDPVKLG*
Ga0075029_1004579121	3300006052	Watersheds	LVLLKTLKRAAEGRRFAWDKLERTAAMSYQPSETQESVKVP*
Ga0075029_1004953871	3300006052	Watersheds	IVLFKTLKRALEGRKFAWDKLERTAAVNYVPAENRDHVNVP*
Ga0075029_1005248391	3300006052	Watersheds	TLKRAIEGRPFAWDKLERTAAVTYAPAEKVEKQDSVKVP*
Ga0075029_1013149731	3300006052	Watersheds	LKRALEGRKFAWDKLERTAAVNYVPAESRDHVNVP*
Ga0075017_1010365372	3300006059	Watersheds	FRTLKRAIQGRPFAWDKLDRTAAVKYIPAERRDSVKV*
Ga0075018_101686082	3300006172	Watersheds	VVLIKTLKRAIAGRPFAWDKLERTAAVNYVPAERRDSVNVP*
Ga0070712_1008745111	3300006175	Corn, Switchgrass And Miscanthus Rhizosphere	TLKRAAEGQRFAWDKLERTAAMSYKPAETQESVKVP*
Ga0075021_104897641	3300006354	Watersheds	VLLKTLKRALEGGRFAWDKLERTAAVRYQPSERRDPVKLG*
Ga0079222_124089042	3300006755	Agricultural Soil	FKTVKRAIEGQRFAWDKLERTDAVSYQPVTREDSVKVQ*
Ga0068865_1002025662	3300006881	Miscanthus Rhizosphere	RAAEGRRFAWDKLERTAAMSYQPPAEDHESVKVP*
Ga0099829_113696221	3300009038	Vadose Zone Soil	TLKRAVQGKPFAWDKLERTAAVKYMPAERRDSVNVP*
Ga0099827_112969391	3300009090	Vadose Zone Soil	LKRAIEGQRFAWDKLERTAAVRFTPAERRDSVKVQ*
Ga0099827_115138701	3300009090	Vadose Zone Soil	KTLKRALEGRRFAWDKLERTAAVKYVPSENRDRVNVP*
Ga0099827_117830352	3300009090	Vadose Zone Soil	TLKRAIEGQRFAWDKLERTAKMSYQPAEQGETIKVP*
Ga0105241_100682142	3300009174	Corn Rhizosphere	VVLIKTLKRALEGQAFAWDKLERTAQVTQIPAEQESVKVP*
Ga0105242_107577992	3300009176	Miscanthus Rhizosphere	LVLLKTLKRAAEGRRFAWDKLERTAAMSYQPPAEDHESVKVP*
Ga0116128_10345771	3300009518	Peatland	RTVKRAIQGRPFAWDKLDRTAAVKYVPAERKDKDKDPVKV*
Ga0116214_11552051	3300009520	Peatlands Soil	TVKRAIEGQRFAWDKLERTAKMSFRTTESHDSVKVP*
Ga0116218_10048224	3300009522	Peatlands Soil	VLFKTLTRALEGRKFAWDKLERTAAVKYVPVENHDHVNVP*
Ga0116103_11485531	3300009615	Peatland	TLKRAIQGRPFAWDKLERTAAVKYVPAERRDSVKVS*
Ga0116106_11351602	3300009645	Peatland	FRTLKRAIQGRPFAWDKLDRTADVNYVPAERRDSVKV*
Ga0116106_12873432	3300009645	Peatland	VVLFKTLKRALEGRKFAWDKLERTAAVKRVASEDRESVNVP*
Ga0126374_101497552	3300009792	Tropical Forest Soil	LKRALEGQRFTWDKLERTAALSYHPVESHDSVKVP*
Ga0126373_110676291	3300010048	Tropical Forest Soil	KTVKRALEGEPFAWDKLERTAAVTYEESEDSVQVH*
Ga0134064_104528031	3300010325	Grasslands Soil	LFKTVKRAAEGEPFAWDKLERTAAVTYRESEDSVHVP*
Ga0126370_113555783	3300010358	Tropical Forest Soil	LKRALEGRKFAWDKLERTAAVKYVPAANHDQVKVP*
Ga0126378_124596342	3300010361	Tropical Forest Soil	FEGRPFAWDKLERTAAVSYTPAERVEKNDSVKVP*
Ga0105239_114986432	3300010375	Corn Rhizosphere	LKRAAEGERFAWDKLERTAAMSYQPPAEEHESVKVP*
Ga0126381_1024021782	3300010376	Tropical Forest Soil	TLKRALEGRKFAWDKLERTAAVNYVPAENHEHVHVP*
Ga0126381_1041460452	3300010376	Tropical Forest Soil	LFKTVKRALDGDPFAWDKLERTAAVTYEEAEDSVHVH*
Ga0150983_159565791	3300011120	Forest Soil	LKRAIQGKPFAWDKLDRTAAVKYVPAERRDSVKV*
Ga0137393_107601811	3300011271	Vadose Zone Soil	TLKRALEGRRFAWDKLERTAAVKYVSSENRDQVNVP*
Ga0137376_110052841	3300012208	Vadose Zone Soil	LLKTLKRAVQGRPFAWDKLERTAAVRYRPVESTDSVNVS*
Ga0137376_110473461	3300012208	Vadose Zone Soil	TLKRAIEGQRFAWDKLERTAKMSYRPAEQRESVKVP*
Ga0137377_111192232	3300012211	Vadose Zone Soil	LLKTLKRAIEGQRFAWDKLERTAKMSYRPAEQRESVKVP*
Ga0137372_105619002	3300012350	Vadose Zone Soil	FRTVRRAIDGKPFAWDKLERTAEVTYHESEDSVQVS*
Ga0137398_110691882	3300012683	Vadose Zone Soil	LFRTLKRAIQGRPFAWDKLDRTAAVNYVPAERRDSV
Ga0137395_105734482	3300012917	Vadose Zone Soil	LFKTLKRALEGRRFAWDKLERTAAVKYVPSENRDQVNVP*
Ga0164301_116185962	3300012960	Soil	VLFKTLKRAIEGRKFAWDKLERTAAVNYVPVKEDREKAHVP*
Ga0157372_118986761	3300013307	Corn Rhizosphere	KTLKRAIEGRPFAWDKLERTAAVSVRPSEQRESVKV*
Ga0181518_104660751	3300014156	Bog	TLKRAIQGRPFAWDKLDRTAAVKYVPAERRDSVKV*
Ga0181530_103304031	3300014159	Bog	LKRAIQGRPFAWDKLDRTAAVKYVPAERRDSVKV*
Ga0181530_105127551	3300014159	Bog	KRAIQGRPFAWDKLERTAAVRYVPAERRDSVKVS*
Ga0181529_107148512	3300014161	Bog	VLFKTLKRALEGRKFAWDKLERTAAVKRVASEDRESVNVP*
Ga0181531_101963723	3300014169	Bog	MVLFKTLKRALEGRKFAWDKLERTAAVNYVPAETRDSVNVR*
Ga0163163_102840443	3300014325	Switchgrass Rhizosphere	LKTLKRAAEGERFAWDKLERTAAMSYQPPAEEHESVKVP*
Ga0181522_108795052	3300014657	Bog	LFKTLKRALEGRRFAWDKLERTAAVKYVPSENRDSVNVP*
Ga0157379_103103712	3300014968	Switchgrass Rhizosphere	LKRAAEGRRFAWDKLERTAAMSYQPPAEDHESVKVP*
Ga0157379_113419732	3300014968	Switchgrass Rhizosphere	LKTLKRAAEGERFAWDKLERTAAMSYQPPAEEHESVKIP*
Ga0137412_109643202	3300015242	Vadose Zone Soil	LLKTLKRAAEGRPFAWDKLERTASMSYQPSENQESVKVP*
Ga0137409_101569323	3300015245	Vadose Zone Soil	LLKTLKRAAEGRPFAWDKLERTASMSYQPSEKEESVKVP*
Ga0187802_102086932	3300017822	Freshwater Sediment	LFKTLKRALEGRKFAWDKLERTAAVKYVPAETRDHVNVP
Ga0187818_104426291	3300017823	Freshwater Sediment	FKTLKRAIEGQRFAWDKLERTAAMSYRPAGSHDSVKVP
Ga0187806_13071881	3300017928	Freshwater Sediment	IVLFRTLKRAIQGRPFAWDKLDRTAAVKYIPAERRDSVKV
Ga0187854_101794691	3300017938	Peatland	TLKRAIQGRPFAWDKLDRTAAVKYVPTERRASVKV
Ga0187819_102201781	3300017943	Freshwater Sediment	VLFKTLKRALEGRKFAWDKLERTAAVKYVPAESREKVNVP
Ga0187847_104873721	3300017948	Peatland	KTVKRAISGQSFAWDKLERTAKMSVRGVEDPESMQTHP
Ga0187847_105654841	3300017948	Peatland	KTVKRAISGQSFAWDKLERTAKMSFRTTETHDSVKVP
Ga0187817_101015421	3300017955	Freshwater Sediment	TLKRAIEGRRFAWDKLERTAAMSFKTPETRESAKVH
Ga0187783_110155832	3300017970	Tropical Peatland	VLFKTLKRALEGRKFAWDKLERTAAVKYVPAENHEHVNVP
Ga0187781_102526571	3300017972	Tropical Peatland	TLKRAIEGQRFAWDKLERTAAVTYKTPQSRESVKVP
Ga0187782_100242016	3300017975	Tropical Peatland	RTLKRAIQGRPFAWDKLERTAAVKYVPAERRDSVKV
Ga0187782_107160882	3300017975	Tropical Peatland	LKRALEGRKFAWDKLERTAAVKYVPAENHEHVNVP
Ga0187767_101610882	3300017999	Tropical Peatland	VKRAIGGQPFAWDKLERTAAMSFKTPPARESAKVH
Ga0187804_100491733	3300018006	Freshwater Sediment	VKRAIEGQRFAWDKLERTAKMSFQTTESHDSVKVP
Ga0187805_102166881	3300018007	Freshwater Sediment	LKRAIEGQRFAWDKLERTAAMSYRPAGSHDSVKVP
Ga0187888_11008862	3300018008	Peatland	VLFRTLKRALEGRKFAWDKLERTAAVKRVASEDRESVNVP
Ga0187873_13985401	3300018013	Peatland	TLKRAIQGRPFAWDKLDRTAAVNYVPAERRDSVKV
Ga0187881_100675862	3300018024	Peatland	RTLKRAIQGRPFAWDKLDRTAAVKYVPAERKDKDKDKDPVKV
Ga0187863_100636221	3300018034	Peatland	FKTLKRALEGRKFAWDKLERTAAVNYVPAAETRDHVNVP
Ga0187883_104854211	3300018037	Peatland	VLFKTLKRALEGRRFAWDKLERTAAVRYVPSEHRDHVNVP
Ga0187871_106214862	3300018042	Peatland	VLFKTLKRALEGRKFAWDKLERTAAVNYVPAVEARDHVNVP
Ga0187859_107657822	3300018047	Peatland	RTVKRAIQGRPFAWDKLDRTAAVKYVPAERKDKDKDPVKV
Ga0187784_112603171	3300018062	Tropical Peatland	QANFKTLKRALEGRKFAWDKLERTAAVKLRPSEEREQVSVR
Ga0187784_115207471	3300018062	Tropical Peatland	FSVVLGKTLIRAIEGQRFAWDKLERTAAVSYQAADNQESVKVHE
Ga0187772_100683913	3300018085	Tropical Peatland	TLKRAIEGQRFAWDKLERTAAVSYQSAERRESVKVQE
Ga0187769_100414914	3300018086	Tropical Peatland	TLKRALEGRRFAWDKLERTAAVKYVPSEERDSVNVP
Ga0066667_103307244	3300018433	Grasslands Soil	LKTLKRALEGGRFAWDKLERTAAVRYQPSERRDSVNVP
Ga0066667_115645242	3300018433	Grasslands Soil	KTVKRALTGEPFSWDKLERTAAVTYEEAEDSIQVP
Ga0187797_10443002	3300019284	Peatland	VVLFRTLKRALEGRRFAWDKLERTAAVKYVPSEERDSVNVP
Ga0210404_100050941	3300021088	Soil	TLKRALEGRRFAWDKLERTAAMSYKPVEDHDSVKVP
Ga0210400_105739902	3300021170	Soil	RTLKRALEGRKFAWDKLERTAAVNYVPAETKDHVGVP
Ga0210405_102652073	3300021171	Soil	LRTLKRAAEGQRFAWDKLERTAAMSYKPAEAPESVKVP
Ga0210396_105486951	3300021180	Soil	LLRTLKRAAEGQRFAWDKLERTAAMSYKPAEAPESVKVP
Ga0210388_110405642	3300021181	Soil	TLKRALEGRKFAWDKLERTAAVKYVPSENRDQVNVP
Ga0213873_101864781	3300021358	Rhizosphere	LKRALEGRPFAWDKLERTAAVRYQPVTDDDSVRVP
Ga0210385_104301762	3300021402	Soil	TLKRALEGRKFAWDKLERTAAVNYVPAETKDHVGVP
Ga0210389_106439023	3300021404	Soil	LLRTLKRALEGRRFAWDKLERTAAMSYKPVEDHDSVKVP
Ga0210387_102329683	3300021405	Soil	LFRTLKRAIQGRPFAWDKLDRTAAVSYVPAERRDSVKV
Ga0210383_116759112	3300021407	Soil	KRALEGRKFAWDKLERTAAVNYVPAVEARDHVNVP
Ga0210394_108599811	3300021420	Soil	LFKTLKRALEGRKFAWDKLERTAAVKYVPSENRDQVNVP
Ga0210391_106206661	3300021433	Soil	VLFKTLKRALEGRKFAWDKLERTAAVKYVPSENRDQVNVP
Ga0210391_109836962	3300021433	Soil	VVLFKTLKRALEGRRFAWDKLERTAAVNYVPSENRDSVNVP
Ga0210402_102865724	3300021478	Soil	LLRTLKRAAEGQRFAWDKLERTAAMSYKPAEAPDSVKVP
Ga0210402_115213891	3300021478	Soil	LKRALEGRRFAWDKLERTAAVNYVPEETRDSVDVR
Ga0210409_116367462	3300021559	Soil	LKTLKRAAEGRPFAWDKLERTASMSYQPSEKEESVKVP
Ga0126371_108218662	3300021560	Tropical Forest Soil	LFKTLKRAIEGRKFAWDKLERTAAVNYVPAENHDHVNVP
Ga0126371_108539111	3300021560	Tropical Forest Soil	TLKRALEGRKFAWDKLERTAAVKYVPAETHDSVNVP
Ga0126371_116763801	3300021560	Tropical Forest Soil	TLKRAIEGRPFSWDKLERTAAVRYQPITTHDSLQVP
Ga0212123_101203143	3300022557	Iron-Sulfur Acid Spring	FKTLKRALEGRRFAWDKLERTAAVNYVPAEKRDHVNAP
Ga0212123_101432613	3300022557	Iron-Sulfur Acid Spring	LFKTLKRALEGRRFAWDKLERTAAVNYIPSENRDHVNVP
Ga0208821_10440611	3300025432	Peatland	RTLKRAIQGRPFAWDKLERTAAVRYVPAERRDSVKVS
Ga0208820_10471672	3300025576	Peatland	TVKRAIQGRPFAWDKLDRTAAVKYVPAERKDKDKDPVKV
Ga0207692_111213652	3300025898	Corn, Switchgrass And Miscanthus Rhizosphere	RSSDLRAIEGRPYAWDKLERTAAVRYEPVTREDSVQVP
Ga0207693_110350153	3300025915	Corn, Switchgrass And Miscanthus Rhizosphere	LKRAAEGQRFAWDKLERTAAMSYKPAETQESVKVP
Ga0207687_100513743	3300025927	Miscanthus Rhizosphere	KRAAEGRRFAWDKLERTAAMSYQPPAEDHESVKVP
Ga0208773_10264451	3300026034	Rice Paddy Soil	IVLVRTLKRALEGRKFGWDKLERTATVRYEKHEEEPLLTKK
Ga0207702_102124883	3300026078	Corn Rhizosphere	IVLFKTLKRALEGRKFAWDKLERTAAVKYVPAETRNHVNVP
Ga0209840_10295051	3300026223	Soil	TLKRAIQGRPFAWDKLERTAAVNYVPAERRDSVNVP
Ga0209238_10042261	3300026301	Grasslands Soil	LFKTVKRALTGEPFSWDKLERTAAVTYEEAEDSIQVP
Ga0209056_106797342	3300026538	Soil	FKTVKRAAEGEPFAWDKLERTAAVTYKESEDSVHVL
Ga0209218_10799612	3300027505	Forest Soil	LKRALEGRRFAWDKLERTAAVKYVPSENRDRVNVP
Ga0209527_11446751	3300027583	Forest Soil	LKRALEGRRFAWDKLERTAAVNYIPSENRDHVNVP
Ga0209106_11276361	3300027616	Forest Soil	KTLKRAIQGKPFAWDKLERTAAVNYVPADRRDSVNVP
Ga0208827_10357853	3300027641	Peatlands Soil	RTLKRALEGRRFAWDKLERTAAVKYVPAETREKVNVP
Ga0209076_10415792	3300027643	Vadose Zone Soil	SVVLLKTLKRAAEGQSFAWDKLERTVAMSYKPEETRESVKVP
Ga0209117_11813881	3300027645	Forest Soil	KTLKRALEGRRFAWDKLERTAAVKYVPSENKESVRVP
Ga0209007_10347981	3300027652	Forest Soil	LFKTLKRALEGRKFAWDKLERTAAVNYVPAETRDSVDVR
Ga0209530_11903211	3300027692	Forest Soil	FKTLKRALEGRKFAWDKLERTAAVNYVPAETRDSVNVR
Ga0209446_10441142	3300027698	Bog Forest Soil	VLFKTLKRALEGRKFAWDKLERTAAVNYVPAENRDHVNVP
Ga0209580_102597321	3300027842	Surface Soil	IVLFKTLNRALEGRKFAWDKLERTAAVRYVPAENHDQVNVP
Ga0209166_105607492	3300027857	Surface Soil	VLFKTLKRALEGRKFAWDKLERTAAVQYVPAEKHDHVNVP
Ga0209167_101452381	3300027867	Surface Soil	LKRALEGRKFAWDKLERTAAVNYVPAEARDSVHVR
Ga0209167_103562402	3300027867	Surface Soil	LKRALEGRRFAWDKLERTAAVKYVPSENRDSVNVP
Ga0209579_101181393	3300027869	Surface Soil	FKTLKRAIEGRKFAWDKLERTAAVNYVPAETRDHANVP
Ga0209579_102688582	3300027869	Surface Soil	FKTLKRALEGRKFAWDKLERTAAVNYVPAENREKVNVP
Ga0209590_110366923	3300027882	Vadose Zone Soil	LKRAIQGKPFAWDKLERTAAVNYMPAERRDSVNVP
Ga0209624_101381791	3300027895	Forest Soil	VLFKTLKRALEGRRFAWDKLERTAAVRYVPSENRNSVNVN
Ga0209067_102872941	3300027898	Watersheds	FKTLKRAMEGRKFAWDKLERTAAVSYMPAEQPESVKIP
Ga0209006_104311642	3300027908	Forest Soil	KTLKRALEGRKFAWDKLERTAAVNYVPAENHDQVNVP
Ga0209583_105132691	3300027910	Watersheds	FKTLKRAIKGQRFAWDKLERTAAVSYRPAEREDSVKVL
Ga0209698_101681173	3300027911	Watersheds	IVLFKTLKRALEGRKFAWDKLERTAAVNYVPAETHDSVNVR
Ga0209698_107588092	3300027911	Watersheds	LKTLKRAAEGRQFAWDKLERTAAMSYKPVETPESVKVP
Ga0311358_105196821	3300029915	Bog	VLFKTLKRALEGRKFAWDKLERTAAVKRVASEDRESVNVP
Ga0311352_103484891	3300029944	Palsa	VVLFKTLKRALEGRRFAWDKLERTAAVGYVPSENRDSVNVP
Ga0302306_104209091	3300030043	Palsa	TLKRALEGRRFAWDKLERTAAVKYVPSEDRESVNVP
Ga0311356_120063391	3300030617	Palsa	IVLFKTLKRALEGRKFAWDKLERTAAVKYAPAEIREKVNVP
Ga0311335_104595531	3300030838	Fen	VLIKTLKRAVQGRPFAWDKLERSADVNYVPAEKRDSVNVP
Ga0265753_10105993	3300030862	Soil	SVVLFKTVKRAIEGQRFAWDMLVGTAKMSFQTAESHESVKVP
Ga0302180_101720141	3300031028	Palsa	KTLKRALEGRKFAWDKLERTAAVKYAPAEIREKVNVP
Ga0170824_1009909971	3300031231	Forest Soil	IVLFKTLKRALEGRKFAWDKLERTAAVNYVPTEIRDHVNVP
Ga0265339_100937131	3300031249	Rhizosphere	RTLMRAVTGRPFAWDKLERTAAVKYVPGERRDSVKV
Ga0310686_1135947971	3300031708	Soil	TLKRALEGRKFAWDKLERTAAVNYVPTENRDQVNVP
Ga0318496_106120771	3300031713	Soil	FKTLKRALEGRKFAWDKLERTAAVNYVPAEAQDHANVR
Ga0307476_101383303	3300031715	Hardwood Forest Soil	LFKTLKRALEGRRFAWDKLERTAAVNYVPAENRDQVNVP
Ga0307474_112662322	3300031718	Hardwood Forest Soil	FRTLKRAIQGRPFAWDKLARTAAVSYVPAERRDSVKV
Ga0318566_101495542	3300031779	Soil	VLIKTLKRAAEGQKFAWDKLERTAAVKAPAERRESVKVP
Ga0318548_103943262	3300031793	Soil	LIKTLKRAAEGQKFAWDKLERTAAVKAPAERRESVKVP
Ga0318511_103270292	3300031845	Soil	TLKRAAEGQKFAWDKLERTAAVKAPAERRESVKVP
Ga0318549_100509561	3300032041	Soil	IKTLKRAAEGQKFAWDKLERTAAVKAPAERRESVKVP
Ga0335082_113092232	3300032782	Soil	KTLKRAIEGQRFAWDKLERTAAMSFMTPAAPPPQESTKVH
Ga0335072_114007401	3300032898	Soil	LFRTLKRAITGRPFAWDKLDRTAAVKYIPAERHDSVKV
Ga0335076_112195171	3300032955	Soil	KTLKRALEGRKFAWDKLERTAAVKYVPAENHDHANVR
Ga0371488_0178227_3_119	3300033983	Peat Soil	LFRTLKRAIQGRPFAWDKLDRTAAVKYIPAERRESVKV

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F031640

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences