| Basic Information | |
|---|---|
| Family ID | F031640 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 182 |
| Average Sequence Length | 38 residues |
| Representative Sequence | LFKTLKRALEGRRFAWDKLERTAAVKYVPSENRDSVNVP |
| Number of Associated Samples | 156 |
| Number of Associated Scaffolds | 182 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.10 % |
| % of genes near scaffold ends (potentially truncated) | 98.35 % |
| % of genes from short scaffolds (< 2000 bps) | 93.96 % |
| Associated GOLD sequencing projects | 149 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.23 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (70.879 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (10.989 % of family members) |
| Environment Ontology (ENVO) | Unclassified (20.330 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.703 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 26.87% β-sheet: 0.00% Coil/Unstructured: 73.13% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.23 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 182 Family Scaffolds |
|---|---|---|
| PF01212 | Beta_elim_lyase | 21.98 |
| PF00756 | Esterase | 15.38 |
| PF00171 | Aldedh | 9.34 |
| PF02823 | ATP-synt_DE_N | 4.95 |
| PF00561 | Abhydrolase_1 | 2.75 |
| PF02922 | CBM_48 | 2.20 |
| PF01182 | Glucosamine_iso | 2.20 |
| PF07238 | PilZ | 1.10 |
| PF07883 | Cupin_2 | 1.10 |
| PF08338 | DUF1731 | 1.10 |
| PF00440 | TetR_N | 1.10 |
| PF00006 | ATP-synt_ab | 0.55 |
| PF00999 | Na_H_Exchanger | 0.55 |
| PF13641 | Glyco_tranf_2_3 | 0.55 |
| PF08681 | DUF1778 | 0.55 |
| PF13692 | Glyco_trans_1_4 | 0.55 |
| PF04932 | Wzy_C | 0.55 |
| PF04226 | Transgly_assoc | 0.55 |
| PF09976 | TPR_21 | 0.55 |
| PF11645 | PDDEXK_5 | 0.55 |
| PF00583 | Acetyltransf_1 | 0.55 |
| PF00534 | Glycos_transf_1 | 0.55 |
| PF04299 | FMN_bind_2 | 0.55 |
| PF05635 | 23S_rRNA_IVP | 0.55 |
| COG ID | Name | Functional Category | % Frequency in 182 Family Scaffolds |
|---|---|---|---|
| COG1167 | DNA-binding transcriptional regulator, MocR family, contains an aminotransferase domain | Transcription [K] | 43.96 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 21.98 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 21.98 |
| COG3033 | Tryptophanase | Amino acid transport and metabolism [E] | 21.98 |
| COG2008 | Threonine aldolase | Amino acid transport and metabolism [E] | 21.98 |
| COG1982 | Arginine/lysine/ornithine decarboxylase | Amino acid transport and metabolism [E] | 21.98 |
| COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 21.98 |
| COG1104 | Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family | Amino acid transport and metabolism [E] | 21.98 |
| COG1003 | Glycine cleavage system protein P (pyridoxal-binding), C-terminal domain | Amino acid transport and metabolism [E] | 21.98 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 21.98 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 21.98 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 21.98 |
| COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 21.98 |
| COG0112 | Glycine/serine hydroxymethyltransferase | Amino acid transport and metabolism [E] | 21.98 |
| COG0076 | Glutamate or tyrosine decarboxylase or a related PLP-dependent protein | Amino acid transport and metabolism [E] | 21.98 |
| COG0075 | Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG | Amino acid transport and metabolism [E] | 21.98 |
| COG4992 | Acetylornithine/succinyldiaminopimelate/putrescine aminotransferase | Amino acid transport and metabolism [E] | 21.98 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 9.34 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 9.34 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 9.34 |
| COG0355 | FoF1-type ATP synthase, epsilon subunit | Energy production and conversion [C] | 4.95 |
| COG0363 | 6-phosphogluconolactonase/Glucosamine-6-phosphate isomerase/deaminase | Carbohydrate transport and metabolism [G] | 2.20 |
| COG1090 | NAD dependent epimerase/dehydratase family enzyme | General function prediction only [R] | 1.10 |
| COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 0.55 |
| COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 0.55 |
| COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 0.55 |
| COG3307 | O-antigen ligase | Cell wall/membrane/envelope biogenesis [M] | 0.55 |
| COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 0.55 |
| COG4453 | Uncharacterized conserved protein, DUF1778 family | Function unknown [S] | 0.55 |
| COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 0.55 |
| COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 0.55 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 72.53 % |
| Unclassified | root | N/A | 27.47 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000156|NODE_c0563714 | All Organisms → cellular organisms → Bacteria | 1334 | Open in IMG/M |
| 3300001527|A3513AW1_1067754 | Not Available | 501 | Open in IMG/M |
| 3300001546|JGI12659J15293_10110454 | Not Available | 597 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100607949 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 970 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101418563 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300004080|Ga0062385_10876339 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300004080|Ga0062385_11246003 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 510 | Open in IMG/M |
| 3300005177|Ga0066690_11057404 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300005181|Ga0066678_10411701 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 897 | Open in IMG/M |
| 3300005435|Ga0070714_102180992 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 539 | Open in IMG/M |
| 3300005445|Ga0070708_101161470 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300005526|Ga0073909_10693070 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 510 | Open in IMG/M |
| 3300005533|Ga0070734_10496158 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 696 | Open in IMG/M |
| 3300005538|Ga0070731_10101867 | All Organisms → cellular organisms → Bacteria | 1902 | Open in IMG/M |
| 3300005540|Ga0066697_10795849 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 514 | Open in IMG/M |
| 3300005542|Ga0070732_10371277 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 862 | Open in IMG/M |
| 3300005547|Ga0070693_100826271 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 689 | Open in IMG/M |
| 3300005547|Ga0070693_101194186 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300005587|Ga0066654_10250899 | All Organisms → cellular organisms → Bacteria | 933 | Open in IMG/M |
| 3300005591|Ga0070761_10959204 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 542 | Open in IMG/M |
| 3300005602|Ga0070762_10251769 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1098 | Open in IMG/M |
| 3300005610|Ga0070763_10493480 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300005712|Ga0070764_10518656 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300005834|Ga0068851_10097179 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1558 | Open in IMG/M |
| 3300005899|Ga0075271_10052390 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 740 | Open in IMG/M |
| 3300005921|Ga0070766_10263496 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1097 | Open in IMG/M |
| 3300006050|Ga0075028_100105670 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1442 | Open in IMG/M |
| 3300006050|Ga0075028_101037585 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300006052|Ga0075029_100457912 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300006052|Ga0075029_100495387 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
| 3300006052|Ga0075029_100524839 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 784 | Open in IMG/M |
| 3300006052|Ga0075029_101314973 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300006059|Ga0075017_101036537 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 639 | Open in IMG/M |
| 3300006172|Ga0075018_10168608 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1021 | Open in IMG/M |
| 3300006175|Ga0070712_100874511 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 774 | Open in IMG/M |
| 3300006354|Ga0075021_10489764 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300006755|Ga0079222_12408904 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300006881|Ga0068865_100202566 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 1541 | Open in IMG/M |
| 3300009038|Ga0099829_11369622 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300009090|Ga0099827_11296939 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 633 | Open in IMG/M |
| 3300009090|Ga0099827_11513870 | Not Available | 584 | Open in IMG/M |
| 3300009090|Ga0099827_11783035 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 536 | Open in IMG/M |
| 3300009174|Ga0105241_10068214 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2755 | Open in IMG/M |
| 3300009176|Ga0105242_10757799 | Not Available | 956 | Open in IMG/M |
| 3300009518|Ga0116128_1034577 | All Organisms → cellular organisms → Bacteria | 1658 | Open in IMG/M |
| 3300009520|Ga0116214_1155205 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 853 | Open in IMG/M |
| 3300009522|Ga0116218_1004822 | All Organisms → cellular organisms → Bacteria | 6461 | Open in IMG/M |
| 3300009615|Ga0116103_1148553 | Not Available | 569 | Open in IMG/M |
| 3300009645|Ga0116106_1135160 | Not Available | 791 | Open in IMG/M |
| 3300009645|Ga0116106_1287343 | Not Available | 523 | Open in IMG/M |
| 3300009792|Ga0126374_10149755 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 1412 | Open in IMG/M |
| 3300010048|Ga0126373_11067629 | Not Available | 873 | Open in IMG/M |
| 3300010325|Ga0134064_10452803 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
| 3300010358|Ga0126370_11355578 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 669 | Open in IMG/M |
| 3300010361|Ga0126378_12459634 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 595 | Open in IMG/M |
| 3300010375|Ga0105239_11498643 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 779 | Open in IMG/M |
| 3300010376|Ga0126381_102402178 | Not Available | 756 | Open in IMG/M |
| 3300010376|Ga0126381_104146045 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 563 | Open in IMG/M |
| 3300011120|Ga0150983_15956579 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis → Candidatus Koribacter versatilis Ellin345 | 760 | Open in IMG/M |
| 3300011271|Ga0137393_10760181 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
| 3300012208|Ga0137376_11005284 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 714 | Open in IMG/M |
| 3300012208|Ga0137376_11047346 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 698 | Open in IMG/M |
| 3300012211|Ga0137377_11119223 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 717 | Open in IMG/M |
| 3300012350|Ga0137372_10561900 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
| 3300012683|Ga0137398_11069188 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300012917|Ga0137395_10573448 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
| 3300012960|Ga0164301_11618596 | Not Available | 538 | Open in IMG/M |
| 3300013307|Ga0157372_11898676 | Not Available | 685 | Open in IMG/M |
| 3300014156|Ga0181518_10466075 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300014159|Ga0181530_10330403 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 792 | Open in IMG/M |
| 3300014159|Ga0181530_10512755 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300014161|Ga0181529_10714851 | Not Available | 516 | Open in IMG/M |
| 3300014169|Ga0181531_10196372 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 1225 | Open in IMG/M |
| 3300014325|Ga0163163_10284044 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1707 | Open in IMG/M |
| 3300014657|Ga0181522_10879505 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 552 | Open in IMG/M |
| 3300014968|Ga0157379_10310371 | All Organisms → cellular organisms → Bacteria | 1439 | Open in IMG/M |
| 3300014968|Ga0157379_11341973 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 692 | Open in IMG/M |
| 3300015242|Ga0137412_10964320 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 613 | Open in IMG/M |
| 3300015245|Ga0137409_10156932 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2078 | Open in IMG/M |
| 3300017822|Ga0187802_10208693 | Not Available | 752 | Open in IMG/M |
| 3300017823|Ga0187818_10442629 | Not Available | 580 | Open in IMG/M |
| 3300017928|Ga0187806_1307188 | Not Available | 560 | Open in IMG/M |
| 3300017938|Ga0187854_10179469 | Not Available | 946 | Open in IMG/M |
| 3300017943|Ga0187819_10220178 | Not Available | 1116 | Open in IMG/M |
| 3300017948|Ga0187847_10487372 | Not Available | 683 | Open in IMG/M |
| 3300017948|Ga0187847_10565484 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300017955|Ga0187817_10101542 | All Organisms → cellular organisms → Bacteria | 1810 | Open in IMG/M |
| 3300017970|Ga0187783_11015583 | Not Available | 597 | Open in IMG/M |
| 3300017972|Ga0187781_10252657 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 1248 | Open in IMG/M |
| 3300017975|Ga0187782_10024201 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4424 | Open in IMG/M |
| 3300017975|Ga0187782_10716088 | Not Available | 772 | Open in IMG/M |
| 3300017999|Ga0187767_10161088 | Not Available | 680 | Open in IMG/M |
| 3300018006|Ga0187804_10049173 | Not Available | 1646 | Open in IMG/M |
| 3300018007|Ga0187805_10216688 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
| 3300018008|Ga0187888_1100886 | Not Available | 1230 | Open in IMG/M |
| 3300018013|Ga0187873_1398540 | Not Available | 501 | Open in IMG/M |
| 3300018024|Ga0187881_10067586 | All Organisms → cellular organisms → Bacteria | 1679 | Open in IMG/M |
| 3300018034|Ga0187863_10063622 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2091 | Open in IMG/M |
| 3300018037|Ga0187883_10485421 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300018042|Ga0187871_10621486 | Not Available | 600 | Open in IMG/M |
| 3300018047|Ga0187859_10765782 | Not Available | 552 | Open in IMG/M |
| 3300018062|Ga0187784_11260317 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300018062|Ga0187784_11520747 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 530 | Open in IMG/M |
| 3300018085|Ga0187772_10068391 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2226 | Open in IMG/M |
| 3300018086|Ga0187769_10041491 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3168 | Open in IMG/M |
| 3300018433|Ga0066667_10330724 | All Organisms → cellular organisms → Bacteria | 1201 | Open in IMG/M |
| 3300018433|Ga0066667_11564524 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 585 | Open in IMG/M |
| 3300019284|Ga0187797_1044300 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300021088|Ga0210404_10005094 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5295 | Open in IMG/M |
| 3300021170|Ga0210400_10573990 | Not Available | 930 | Open in IMG/M |
| 3300021171|Ga0210405_10265207 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 1358 | Open in IMG/M |
| 3300021180|Ga0210396_10548695 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 1008 | Open in IMG/M |
| 3300021181|Ga0210388_11040564 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 700 | Open in IMG/M |
| 3300021358|Ga0213873_10186478 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 638 | Open in IMG/M |
| 3300021402|Ga0210385_10430176 | Not Available | 994 | Open in IMG/M |
| 3300021404|Ga0210389_10643902 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 832 | Open in IMG/M |
| 3300021405|Ga0210387_10232968 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1607 | Open in IMG/M |
| 3300021407|Ga0210383_11675911 | Not Available | 521 | Open in IMG/M |
| 3300021420|Ga0210394_10859981 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
| 3300021433|Ga0210391_10620666 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
| 3300021433|Ga0210391_10983696 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 657 | Open in IMG/M |
| 3300021478|Ga0210402_10286572 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1524 | Open in IMG/M |
| 3300021478|Ga0210402_11521389 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 596 | Open in IMG/M |
| 3300021559|Ga0210409_11636746 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 520 | Open in IMG/M |
| 3300021560|Ga0126371_10821866 | Not Available | 1075 | Open in IMG/M |
| 3300021560|Ga0126371_10853911 | All Organisms → cellular organisms → Bacteria | 1055 | Open in IMG/M |
| 3300021560|Ga0126371_11676380 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 760 | Open in IMG/M |
| 3300022557|Ga0212123_10120314 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2090 | Open in IMG/M |
| 3300022557|Ga0212123_10143261 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1856 | Open in IMG/M |
| 3300025432|Ga0208821_1044061 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300025576|Ga0208820_1047167 | Not Available | 1224 | Open in IMG/M |
| 3300025898|Ga0207692_11121365 | Not Available | 521 | Open in IMG/M |
| 3300025915|Ga0207693_11035015 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 626 | Open in IMG/M |
| 3300025927|Ga0207687_10051374 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2874 | Open in IMG/M |
| 3300026034|Ga0208773_1026445 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 752 | Open in IMG/M |
| 3300026078|Ga0207702_10212488 | Not Available | 1799 | Open in IMG/M |
| 3300026223|Ga0209840_1029505 | All Organisms → cellular organisms → Bacteria | 1255 | Open in IMG/M |
| 3300026301|Ga0209238_1004226 | All Organisms → cellular organisms → Bacteria | 5773 | Open in IMG/M |
| 3300026538|Ga0209056_10679734 | Not Available | 520 | Open in IMG/M |
| 3300027505|Ga0209218_1079961 | Not Available | 676 | Open in IMG/M |
| 3300027583|Ga0209527_1144675 | Not Available | 527 | Open in IMG/M |
| 3300027616|Ga0209106_1127636 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300027641|Ga0208827_1035785 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1743 | Open in IMG/M |
| 3300027643|Ga0209076_1041579 | All Organisms → cellular organisms → Bacteria | 1295 | Open in IMG/M |
| 3300027645|Ga0209117_1181388 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 538 | Open in IMG/M |
| 3300027652|Ga0209007_1034798 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1291 | Open in IMG/M |
| 3300027692|Ga0209530_1190321 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300027698|Ga0209446_1044114 | All Organisms → cellular organisms → Bacteria | 1125 | Open in IMG/M |
| 3300027842|Ga0209580_10259732 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
| 3300027857|Ga0209166_10560749 | Not Available | 583 | Open in IMG/M |
| 3300027867|Ga0209167_10145238 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1241 | Open in IMG/M |
| 3300027867|Ga0209167_10356240 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300027869|Ga0209579_10118139 | All Organisms → cellular organisms → Bacteria | 1408 | Open in IMG/M |
| 3300027869|Ga0209579_10268858 | All Organisms → cellular organisms → Bacteria | 917 | Open in IMG/M |
| 3300027882|Ga0209590_11036692 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300027895|Ga0209624_10138179 | All Organisms → cellular organisms → Bacteria | 1607 | Open in IMG/M |
| 3300027898|Ga0209067_10287294 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 901 | Open in IMG/M |
| 3300027908|Ga0209006_10431164 | Not Available | 1106 | Open in IMG/M |
| 3300027910|Ga0209583_10513269 | Not Available | 595 | Open in IMG/M |
| 3300027911|Ga0209698_10168117 | All Organisms → cellular organisms → Bacteria | 1789 | Open in IMG/M |
| 3300027911|Ga0209698_10758809 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 735 | Open in IMG/M |
| 3300029915|Ga0311358_10519682 | Not Available | 922 | Open in IMG/M |
| 3300029944|Ga0311352_10348489 | Not Available | 1223 | Open in IMG/M |
| 3300030043|Ga0302306_10420909 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 510 | Open in IMG/M |
| 3300030617|Ga0311356_12006339 | Not Available | 511 | Open in IMG/M |
| 3300030838|Ga0311335_10459553 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
| 3300030862|Ga0265753_1010599 | Not Available | 1204 | Open in IMG/M |
| 3300031028|Ga0302180_10172014 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1185 | Open in IMG/M |
| 3300031231|Ga0170824_100990997 | Not Available | 512 | Open in IMG/M |
| 3300031249|Ga0265339_10093713 | All Organisms → cellular organisms → Bacteria | 1571 | Open in IMG/M |
| 3300031708|Ga0310686_113594797 | Not Available | 522 | Open in IMG/M |
| 3300031713|Ga0318496_10612077 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 602 | Open in IMG/M |
| 3300031715|Ga0307476_10138330 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1743 | Open in IMG/M |
| 3300031718|Ga0307474_11266232 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 582 | Open in IMG/M |
| 3300031779|Ga0318566_10149554 | All Organisms → cellular organisms → Bacteria | 1157 | Open in IMG/M |
| 3300031793|Ga0318548_10394326 | Not Available | 679 | Open in IMG/M |
| 3300031845|Ga0318511_10327029 | Not Available | 696 | Open in IMG/M |
| 3300032041|Ga0318549_10050956 | All Organisms → cellular organisms → Bacteria | 1708 | Open in IMG/M |
| 3300032782|Ga0335082_11309223 | Not Available | 593 | Open in IMG/M |
| 3300032898|Ga0335072_11400740 | Not Available | 604 | Open in IMG/M |
| 3300032955|Ga0335076_11219517 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300033983|Ga0371488_0178227 | Not Available | 1089 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.99% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.24% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 7.14% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.59% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 5.49% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 5.49% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.95% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.95% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.85% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 3.30% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 3.30% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.30% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.75% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.75% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.20% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.65% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.65% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.65% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.65% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.10% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.10% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.10% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.10% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.10% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.10% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.10% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.55% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.55% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.55% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.55% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.55% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.55% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.55% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.55% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.55% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.55% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.55% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.55% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.55% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.55% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.55% |
| Sugar Cane Bagasse Incubating Bioreactor | Engineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor | 0.55% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000156 | Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobic | Engineered | Open in IMG/M |
| 3300001527 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-5cm-13A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300001546 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300005899 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_302 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009518 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 | Environmental | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009615 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_100 | Environmental | Open in IMG/M |
| 3300009645 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
| 3300014159 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG | Environmental | Open in IMG/M |
| 3300014161 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaG | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018008 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40 | Environmental | Open in IMG/M |
| 3300018013 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100 | Environmental | Open in IMG/M |
| 3300018024 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019284 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Host-Associated | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300025432 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025576 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026034 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_302 (SPAdes) | Environmental | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026223 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190 (SPAdes) | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300027505 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027583 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027616 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027652 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027692 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300029915 | III_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030043 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030838 | I_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300030862 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Host-Associated | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033983 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB23AN SIP fraction | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| NODE_05637141 | 3300000156 | Sugar Cane Bagasse Incubating Bioreactor | TLKRALEGGRFAWDKLERTAAVRYQPSERRDSVNVP* |
| A3513AW1_10677542 | 3300001527 | Permafrost | VLFKTIKRAATGEPFAWDKLERTAAVTYQESEDSVQVP* |
| JGI12659J15293_101104542 | 3300001546 | Forest Soil | LFKTLKRALEGRKFAWDKLERTAAVKRVASEDRESVNVP* |
| JGIcombinedJ26739_1006079492 | 3300002245 | Forest Soil | LKRALEGRKFAWDKLERTAAVKRVASEDRESVNVP* |
| JGIcombinedJ26739_1014185631 | 3300002245 | Forest Soil | TVKRALGGQRFAWDKLERTAKMSFRTTESHDSVKVP* |
| Ga0062385_108763391 | 3300004080 | Bog Forest Soil | LVLFRTLKRAIQGLPFAWDKLDRTAAVKYVPAERRDSVKV* |
| Ga0062385_112460031 | 3300004080 | Bog Forest Soil | SLVLFRTLKRAIQGLPFAWDKLDRTAAVKYVPAERKDSVKV* |
| Ga0066690_110574041 | 3300005177 | Soil | VLLKTLKRAIEGQRFAWDKLERTAAVRYTPAERRDSVKVP* |
| Ga0066678_104117012 | 3300005181 | Soil | VVLLKTLKRAIEGQRFAWDKLERTAAMSYRPAESHDSVKVP* |
| Ga0070714_1021809922 | 3300005435 | Agricultural Soil | LFKTLKRALEGRRFAWDKLERTAAVNYVPAENHNHVKVP* |
| Ga0070708_1011614702 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | FSVVLIKTLKRAIQGKLFAWDKLERTAAVNYMPAERRDSVNVP* |
| Ga0073909_106930702 | 3300005526 | Surface Soil | TLKRALEGRKFAWDKLERTAAVKYVPAETHDSVNVH* |
| Ga0070734_104961583 | 3300005533 | Surface Soil | LKRALEGRKFAWDKLERTAAVKYVPAETRDQVNVP* |
| Ga0070731_101018673 | 3300005538 | Surface Soil | VKRAIEGQRFAWDKLERTASMSIKTPEPRESVKVP* |
| Ga0066697_107958492 | 3300005540 | Soil | KTVKRAAEGEPFAWDKLERTAAVTYRESEDSVHVH* |
| Ga0070732_103712771 | 3300005542 | Surface Soil | LFKTLNRALEGRKFAWDKLERTAAVRYVPAENHDQVNVP* |
| Ga0070693_1008262711 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | IVLFKTVIRAIKGEPFAWDKLERTAAVTFEEQEESVEVH* |
| Ga0070693_1011941862 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | VLLKTLKRALEGGRFAWDKLERTAAVRYQPSERRDSVNVP* |
| Ga0066654_102508992 | 3300005587 | Soil | LVLFKTVKRALTGEPFSWDKLERTAAVTYEEAEDSIQVP* |
| Ga0070761_109592041 | 3300005591 | Soil | VKRAIEGQRFAWDKLERTAKMSFRTTETHDSVKVP* |
| Ga0070762_102517691 | 3300005602 | Soil | VLFKTLKRALEGRRFAWDKLERTAAVNYIPSENRDHVNVP* |
| Ga0070763_104934802 | 3300005610 | Soil | KTLKRALEGRKFAWDKLERTAAVKYVPSENRDQVNVP* |
| Ga0070764_105186562 | 3300005712 | Soil | VLFKTLKRALEGRKFAWDKLERTAAVKYVPSENRDQVNVP* |
| Ga0068851_100971792 | 3300005834 | Corn Rhizosphere | KTLKRALEGQAFAWDKLERTAQVTQIPAEQESVKVP* |
| Ga0075271_100523902 | 3300005899 | Rice Paddy Soil | IVLVRTLKRALEGRKFGWDKLERTATVRYEKHEEEPLLTKK* |
| Ga0070766_102634963 | 3300005921 | Soil | VLFKTLKRALEGRRFAWDKLERTAAVNYVPTENRDSVNVP* |
| Ga0075028_1001056701 | 3300006050 | Watersheds | IKTLKRAIAGRPFAWDKLERTAAVNYVPAERRDSVNVP* |
| Ga0075028_1010375851 | 3300006050 | Watersheds | LKTLKRALEGGRFAWDKLERTAAVRYQPSERRDPVKLG* |
| Ga0075029_1004579121 | 3300006052 | Watersheds | LVLLKTLKRAAEGRRFAWDKLERTAAMSYQPSETQESVKVP* |
| Ga0075029_1004953871 | 3300006052 | Watersheds | IVLFKTLKRALEGRKFAWDKLERTAAVNYVPAENRDHVNVP* |
| Ga0075029_1005248391 | 3300006052 | Watersheds | TLKRAIEGRPFAWDKLERTAAVTYAPAEKVEKQDSVKVP* |
| Ga0075029_1013149731 | 3300006052 | Watersheds | LKRALEGRKFAWDKLERTAAVNYVPAESRDHVNVP* |
| Ga0075017_1010365372 | 3300006059 | Watersheds | FRTLKRAIQGRPFAWDKLDRTAAVKYIPAERRDSVKV* |
| Ga0075018_101686082 | 3300006172 | Watersheds | VVLIKTLKRAIAGRPFAWDKLERTAAVNYVPAERRDSVNVP* |
| Ga0070712_1008745111 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | TLKRAAEGQRFAWDKLERTAAMSYKPAETQESVKVP* |
| Ga0075021_104897641 | 3300006354 | Watersheds | VLLKTLKRALEGGRFAWDKLERTAAVRYQPSERRDPVKLG* |
| Ga0079222_124089042 | 3300006755 | Agricultural Soil | FKTVKRAIEGQRFAWDKLERTDAVSYQPVTREDSVKVQ* |
| Ga0068865_1002025662 | 3300006881 | Miscanthus Rhizosphere | RAAEGRRFAWDKLERTAAMSYQPPAEDHESVKVP* |
| Ga0099829_113696221 | 3300009038 | Vadose Zone Soil | TLKRAVQGKPFAWDKLERTAAVKYMPAERRDSVNVP* |
| Ga0099827_112969391 | 3300009090 | Vadose Zone Soil | LKRAIEGQRFAWDKLERTAAVRFTPAERRDSVKVQ* |
| Ga0099827_115138701 | 3300009090 | Vadose Zone Soil | KTLKRALEGRRFAWDKLERTAAVKYVPSENRDRVNVP* |
| Ga0099827_117830352 | 3300009090 | Vadose Zone Soil | TLKRAIEGQRFAWDKLERTAKMSYQPAEQGETIKVP* |
| Ga0105241_100682142 | 3300009174 | Corn Rhizosphere | VVLIKTLKRALEGQAFAWDKLERTAQVTQIPAEQESVKVP* |
| Ga0105242_107577992 | 3300009176 | Miscanthus Rhizosphere | LVLLKTLKRAAEGRRFAWDKLERTAAMSYQPPAEDHESVKVP* |
| Ga0116128_10345771 | 3300009518 | Peatland | RTVKRAIQGRPFAWDKLDRTAAVKYVPAERKDKDKDPVKV* |
| Ga0116214_11552051 | 3300009520 | Peatlands Soil | TVKRAIEGQRFAWDKLERTAKMSFRTTESHDSVKVP* |
| Ga0116218_10048224 | 3300009522 | Peatlands Soil | VLFKTLTRALEGRKFAWDKLERTAAVKYVPVENHDHVNVP* |
| Ga0116103_11485531 | 3300009615 | Peatland | TLKRAIQGRPFAWDKLERTAAVKYVPAERRDSVKVS* |
| Ga0116106_11351602 | 3300009645 | Peatland | FRTLKRAIQGRPFAWDKLDRTADVNYVPAERRDSVKV* |
| Ga0116106_12873432 | 3300009645 | Peatland | VVLFKTLKRALEGRKFAWDKLERTAAVKRVASEDRESVNVP* |
| Ga0126374_101497552 | 3300009792 | Tropical Forest Soil | LKRALEGQRFTWDKLERTAALSYHPVESHDSVKVP* |
| Ga0126373_110676291 | 3300010048 | Tropical Forest Soil | KTVKRALEGEPFAWDKLERTAAVTYEESEDSVQVH* |
| Ga0134064_104528031 | 3300010325 | Grasslands Soil | LFKTVKRAAEGEPFAWDKLERTAAVTYRESEDSVHVP* |
| Ga0126370_113555783 | 3300010358 | Tropical Forest Soil | LKRALEGRKFAWDKLERTAAVKYVPAANHDQVKVP* |
| Ga0126378_124596342 | 3300010361 | Tropical Forest Soil | FEGRPFAWDKLERTAAVSYTPAERVEKNDSVKVP* |
| Ga0105239_114986432 | 3300010375 | Corn Rhizosphere | LKRAAEGERFAWDKLERTAAMSYQPPAEEHESVKVP* |
| Ga0126381_1024021782 | 3300010376 | Tropical Forest Soil | TLKRALEGRKFAWDKLERTAAVNYVPAENHEHVHVP* |
| Ga0126381_1041460452 | 3300010376 | Tropical Forest Soil | LFKTVKRALDGDPFAWDKLERTAAVTYEEAEDSVHVH* |
| Ga0150983_159565791 | 3300011120 | Forest Soil | LKRAIQGKPFAWDKLDRTAAVKYVPAERRDSVKV* |
| Ga0137393_107601811 | 3300011271 | Vadose Zone Soil | TLKRALEGRRFAWDKLERTAAVKYVSSENRDQVNVP* |
| Ga0137376_110052841 | 3300012208 | Vadose Zone Soil | LLKTLKRAVQGRPFAWDKLERTAAVRYRPVESTDSVNVS* |
| Ga0137376_110473461 | 3300012208 | Vadose Zone Soil | TLKRAIEGQRFAWDKLERTAKMSYRPAEQRESVKVP* |
| Ga0137377_111192232 | 3300012211 | Vadose Zone Soil | LLKTLKRAIEGQRFAWDKLERTAKMSYRPAEQRESVKVP* |
| Ga0137372_105619002 | 3300012350 | Vadose Zone Soil | FRTVRRAIDGKPFAWDKLERTAEVTYHESEDSVQVS* |
| Ga0137398_110691882 | 3300012683 | Vadose Zone Soil | LFRTLKRAIQGRPFAWDKLDRTAAVNYVPAERRDSV |
| Ga0137395_105734482 | 3300012917 | Vadose Zone Soil | LFKTLKRALEGRRFAWDKLERTAAVKYVPSENRDQVNVP* |
| Ga0164301_116185962 | 3300012960 | Soil | VLFKTLKRAIEGRKFAWDKLERTAAVNYVPVKEDREKAHVP* |
| Ga0157372_118986761 | 3300013307 | Corn Rhizosphere | KTLKRAIEGRPFAWDKLERTAAVSVRPSEQRESVKV* |
| Ga0181518_104660751 | 3300014156 | Bog | TLKRAIQGRPFAWDKLDRTAAVKYVPAERRDSVKV* |
| Ga0181530_103304031 | 3300014159 | Bog | LKRAIQGRPFAWDKLDRTAAVKYVPAERRDSVKV* |
| Ga0181530_105127551 | 3300014159 | Bog | KRAIQGRPFAWDKLERTAAVRYVPAERRDSVKVS* |
| Ga0181529_107148512 | 3300014161 | Bog | VLFKTLKRALEGRKFAWDKLERTAAVKRVASEDRESVNVP* |
| Ga0181531_101963723 | 3300014169 | Bog | MVLFKTLKRALEGRKFAWDKLERTAAVNYVPAETRDSVNVR* |
| Ga0163163_102840443 | 3300014325 | Switchgrass Rhizosphere | LKTLKRAAEGERFAWDKLERTAAMSYQPPAEEHESVKVP* |
| Ga0181522_108795052 | 3300014657 | Bog | LFKTLKRALEGRRFAWDKLERTAAVKYVPSENRDSVNVP* |
| Ga0157379_103103712 | 3300014968 | Switchgrass Rhizosphere | LKRAAEGRRFAWDKLERTAAMSYQPPAEDHESVKVP* |
| Ga0157379_113419732 | 3300014968 | Switchgrass Rhizosphere | LKTLKRAAEGERFAWDKLERTAAMSYQPPAEEHESVKIP* |
| Ga0137412_109643202 | 3300015242 | Vadose Zone Soil | LLKTLKRAAEGRPFAWDKLERTASMSYQPSENQESVKVP* |
| Ga0137409_101569323 | 3300015245 | Vadose Zone Soil | LLKTLKRAAEGRPFAWDKLERTASMSYQPSEKEESVKVP* |
| Ga0187802_102086932 | 3300017822 | Freshwater Sediment | LFKTLKRALEGRKFAWDKLERTAAVKYVPAETRDHVNVP |
| Ga0187818_104426291 | 3300017823 | Freshwater Sediment | FKTLKRAIEGQRFAWDKLERTAAMSYRPAGSHDSVKVP |
| Ga0187806_13071881 | 3300017928 | Freshwater Sediment | IVLFRTLKRAIQGRPFAWDKLDRTAAVKYIPAERRDSVKV |
| Ga0187854_101794691 | 3300017938 | Peatland | TLKRAIQGRPFAWDKLDRTAAVKYVPTERRASVKV |
| Ga0187819_102201781 | 3300017943 | Freshwater Sediment | VLFKTLKRALEGRKFAWDKLERTAAVKYVPAESREKVNVP |
| Ga0187847_104873721 | 3300017948 | Peatland | KTVKRAISGQSFAWDKLERTAKMSVRGVEDPESMQTHP |
| Ga0187847_105654841 | 3300017948 | Peatland | KTVKRAISGQSFAWDKLERTAKMSFRTTETHDSVKVP |
| Ga0187817_101015421 | 3300017955 | Freshwater Sediment | TLKRAIEGRRFAWDKLERTAAMSFKTPETRESAKVH |
| Ga0187783_110155832 | 3300017970 | Tropical Peatland | VLFKTLKRALEGRKFAWDKLERTAAVKYVPAENHEHVNVP |
| Ga0187781_102526571 | 3300017972 | Tropical Peatland | TLKRAIEGQRFAWDKLERTAAVTYKTPQSRESVKVP |
| Ga0187782_100242016 | 3300017975 | Tropical Peatland | RTLKRAIQGRPFAWDKLERTAAVKYVPAERRDSVKV |
| Ga0187782_107160882 | 3300017975 | Tropical Peatland | LKRALEGRKFAWDKLERTAAVKYVPAENHEHVNVP |
| Ga0187767_101610882 | 3300017999 | Tropical Peatland | VKRAIGGQPFAWDKLERTAAMSFKTPPARESAKVH |
| Ga0187804_100491733 | 3300018006 | Freshwater Sediment | VKRAIEGQRFAWDKLERTAKMSFQTTESHDSVKVP |
| Ga0187805_102166881 | 3300018007 | Freshwater Sediment | LKRAIEGQRFAWDKLERTAAMSYRPAGSHDSVKVP |
| Ga0187888_11008862 | 3300018008 | Peatland | VLFRTLKRALEGRKFAWDKLERTAAVKRVASEDRESVNVP |
| Ga0187873_13985401 | 3300018013 | Peatland | TLKRAIQGRPFAWDKLDRTAAVNYVPAERRDSVKV |
| Ga0187881_100675862 | 3300018024 | Peatland | RTLKRAIQGRPFAWDKLDRTAAVKYVPAERKDKDKDKDPVKV |
| Ga0187863_100636221 | 3300018034 | Peatland | FKTLKRALEGRKFAWDKLERTAAVNYVPAAETRDHVNVP |
| Ga0187883_104854211 | 3300018037 | Peatland | VLFKTLKRALEGRRFAWDKLERTAAVRYVPSEHRDHVNVP |
| Ga0187871_106214862 | 3300018042 | Peatland | VLFKTLKRALEGRKFAWDKLERTAAVNYVPAVEARDHVNVP |
| Ga0187859_107657822 | 3300018047 | Peatland | RTVKRAIQGRPFAWDKLDRTAAVKYVPAERKDKDKDPVKV |
| Ga0187784_112603171 | 3300018062 | Tropical Peatland | QANFKTLKRALEGRKFAWDKLERTAAVKLRPSEEREQVSVR |
| Ga0187784_115207471 | 3300018062 | Tropical Peatland | FSVVLGKTLIRAIEGQRFAWDKLERTAAVSYQAADNQESVKVHE |
| Ga0187772_100683913 | 3300018085 | Tropical Peatland | TLKRAIEGQRFAWDKLERTAAVSYQSAERRESVKVQE |
| Ga0187769_100414914 | 3300018086 | Tropical Peatland | TLKRALEGRRFAWDKLERTAAVKYVPSEERDSVNVP |
| Ga0066667_103307244 | 3300018433 | Grasslands Soil | LKTLKRALEGGRFAWDKLERTAAVRYQPSERRDSVNVP |
| Ga0066667_115645242 | 3300018433 | Grasslands Soil | KTVKRALTGEPFSWDKLERTAAVTYEEAEDSIQVP |
| Ga0187797_10443002 | 3300019284 | Peatland | VVLFRTLKRALEGRRFAWDKLERTAAVKYVPSEERDSVNVP |
| Ga0210404_100050941 | 3300021088 | Soil | TLKRALEGRRFAWDKLERTAAMSYKPVEDHDSVKVP |
| Ga0210400_105739902 | 3300021170 | Soil | RTLKRALEGRKFAWDKLERTAAVNYVPAETKDHVGVP |
| Ga0210405_102652073 | 3300021171 | Soil | LRTLKRAAEGQRFAWDKLERTAAMSYKPAEAPESVKVP |
| Ga0210396_105486951 | 3300021180 | Soil | LLRTLKRAAEGQRFAWDKLERTAAMSYKPAEAPESVKVP |
| Ga0210388_110405642 | 3300021181 | Soil | TLKRALEGRKFAWDKLERTAAVKYVPSENRDQVNVP |
| Ga0213873_101864781 | 3300021358 | Rhizosphere | LKRALEGRPFAWDKLERTAAVRYQPVTDDDSVRVP |
| Ga0210385_104301762 | 3300021402 | Soil | TLKRALEGRKFAWDKLERTAAVNYVPAETKDHVGVP |
| Ga0210389_106439023 | 3300021404 | Soil | LLRTLKRALEGRRFAWDKLERTAAMSYKPVEDHDSVKVP |
| Ga0210387_102329683 | 3300021405 | Soil | LFRTLKRAIQGRPFAWDKLDRTAAVSYVPAERRDSVKV |
| Ga0210383_116759112 | 3300021407 | Soil | KRALEGRKFAWDKLERTAAVNYVPAVEARDHVNVP |
| Ga0210394_108599811 | 3300021420 | Soil | LFKTLKRALEGRKFAWDKLERTAAVKYVPSENRDQVNVP |
| Ga0210391_106206661 | 3300021433 | Soil | VLFKTLKRALEGRKFAWDKLERTAAVKYVPSENRDQVNVP |
| Ga0210391_109836962 | 3300021433 | Soil | VVLFKTLKRALEGRRFAWDKLERTAAVNYVPSENRDSVNVP |
| Ga0210402_102865724 | 3300021478 | Soil | LLRTLKRAAEGQRFAWDKLERTAAMSYKPAEAPDSVKVP |
| Ga0210402_115213891 | 3300021478 | Soil | LKRALEGRRFAWDKLERTAAVNYVPEETRDSVDVR |
| Ga0210409_116367462 | 3300021559 | Soil | LKTLKRAAEGRPFAWDKLERTASMSYQPSEKEESVKVP |
| Ga0126371_108218662 | 3300021560 | Tropical Forest Soil | LFKTLKRAIEGRKFAWDKLERTAAVNYVPAENHDHVNVP |
| Ga0126371_108539111 | 3300021560 | Tropical Forest Soil | TLKRALEGRKFAWDKLERTAAVKYVPAETHDSVNVP |
| Ga0126371_116763801 | 3300021560 | Tropical Forest Soil | TLKRAIEGRPFSWDKLERTAAVRYQPITTHDSLQVP |
| Ga0212123_101203143 | 3300022557 | Iron-Sulfur Acid Spring | FKTLKRALEGRRFAWDKLERTAAVNYVPAEKRDHVNAP |
| Ga0212123_101432613 | 3300022557 | Iron-Sulfur Acid Spring | LFKTLKRALEGRRFAWDKLERTAAVNYIPSENRDHVNVP |
| Ga0208821_10440611 | 3300025432 | Peatland | RTLKRAIQGRPFAWDKLERTAAVRYVPAERRDSVKVS |
| Ga0208820_10471672 | 3300025576 | Peatland | TVKRAIQGRPFAWDKLDRTAAVKYVPAERKDKDKDPVKV |
| Ga0207692_111213652 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | RSSDLRAIEGRPYAWDKLERTAAVRYEPVTREDSVQVP |
| Ga0207693_110350153 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | LKRAAEGQRFAWDKLERTAAMSYKPAETQESVKVP |
| Ga0207687_100513743 | 3300025927 | Miscanthus Rhizosphere | KRAAEGRRFAWDKLERTAAMSYQPPAEDHESVKVP |
| Ga0208773_10264451 | 3300026034 | Rice Paddy Soil | IVLVRTLKRALEGRKFGWDKLERTATVRYEKHEEEPLLTKK |
| Ga0207702_102124883 | 3300026078 | Corn Rhizosphere | IVLFKTLKRALEGRKFAWDKLERTAAVKYVPAETRNHVNVP |
| Ga0209840_10295051 | 3300026223 | Soil | TLKRAIQGRPFAWDKLERTAAVNYVPAERRDSVNVP |
| Ga0209238_10042261 | 3300026301 | Grasslands Soil | LFKTVKRALTGEPFSWDKLERTAAVTYEEAEDSIQVP |
| Ga0209056_106797342 | 3300026538 | Soil | FKTVKRAAEGEPFAWDKLERTAAVTYKESEDSVHVL |
| Ga0209218_10799612 | 3300027505 | Forest Soil | LKRALEGRRFAWDKLERTAAVKYVPSENRDRVNVP |
| Ga0209527_11446751 | 3300027583 | Forest Soil | LKRALEGRRFAWDKLERTAAVNYIPSENRDHVNVP |
| Ga0209106_11276361 | 3300027616 | Forest Soil | KTLKRAIQGKPFAWDKLERTAAVNYVPADRRDSVNVP |
| Ga0208827_10357853 | 3300027641 | Peatlands Soil | RTLKRALEGRRFAWDKLERTAAVKYVPAETREKVNVP |
| Ga0209076_10415792 | 3300027643 | Vadose Zone Soil | SVVLLKTLKRAAEGQSFAWDKLERTVAMSYKPEETRESVKVP |
| Ga0209117_11813881 | 3300027645 | Forest Soil | KTLKRALEGRRFAWDKLERTAAVKYVPSENKESVRVP |
| Ga0209007_10347981 | 3300027652 | Forest Soil | LFKTLKRALEGRKFAWDKLERTAAVNYVPAETRDSVDVR |
| Ga0209530_11903211 | 3300027692 | Forest Soil | FKTLKRALEGRKFAWDKLERTAAVNYVPAETRDSVNVR |
| Ga0209446_10441142 | 3300027698 | Bog Forest Soil | VLFKTLKRALEGRKFAWDKLERTAAVNYVPAENRDHVNVP |
| Ga0209580_102597321 | 3300027842 | Surface Soil | IVLFKTLNRALEGRKFAWDKLERTAAVRYVPAENHDQVNVP |
| Ga0209166_105607492 | 3300027857 | Surface Soil | VLFKTLKRALEGRKFAWDKLERTAAVQYVPAEKHDHVNVP |
| Ga0209167_101452381 | 3300027867 | Surface Soil | LKRALEGRKFAWDKLERTAAVNYVPAEARDSVHVR |
| Ga0209167_103562402 | 3300027867 | Surface Soil | LKRALEGRRFAWDKLERTAAVKYVPSENRDSVNVP |
| Ga0209579_101181393 | 3300027869 | Surface Soil | FKTLKRAIEGRKFAWDKLERTAAVNYVPAETRDHANVP |
| Ga0209579_102688582 | 3300027869 | Surface Soil | FKTLKRALEGRKFAWDKLERTAAVNYVPAENREKVNVP |
| Ga0209590_110366923 | 3300027882 | Vadose Zone Soil | LKRAIQGKPFAWDKLERTAAVNYMPAERRDSVNVP |
| Ga0209624_101381791 | 3300027895 | Forest Soil | VLFKTLKRALEGRRFAWDKLERTAAVRYVPSENRNSVNVN |
| Ga0209067_102872941 | 3300027898 | Watersheds | FKTLKRAMEGRKFAWDKLERTAAVSYMPAEQPESVKIP |
| Ga0209006_104311642 | 3300027908 | Forest Soil | KTLKRALEGRKFAWDKLERTAAVNYVPAENHDQVNVP |
| Ga0209583_105132691 | 3300027910 | Watersheds | FKTLKRAIKGQRFAWDKLERTAAVSYRPAEREDSVKVL |
| Ga0209698_101681173 | 3300027911 | Watersheds | IVLFKTLKRALEGRKFAWDKLERTAAVNYVPAETHDSVNVR |
| Ga0209698_107588092 | 3300027911 | Watersheds | LKTLKRAAEGRQFAWDKLERTAAMSYKPVETPESVKVP |
| Ga0311358_105196821 | 3300029915 | Bog | VLFKTLKRALEGRKFAWDKLERTAAVKRVASEDRESVNVP |
| Ga0311352_103484891 | 3300029944 | Palsa | VVLFKTLKRALEGRRFAWDKLERTAAVGYVPSENRDSVNVP |
| Ga0302306_104209091 | 3300030043 | Palsa | TLKRALEGRRFAWDKLERTAAVKYVPSEDRESVNVP |
| Ga0311356_120063391 | 3300030617 | Palsa | IVLFKTLKRALEGRKFAWDKLERTAAVKYAPAEIREKVNVP |
| Ga0311335_104595531 | 3300030838 | Fen | VLIKTLKRAVQGRPFAWDKLERSADVNYVPAEKRDSVNVP |
| Ga0265753_10105993 | 3300030862 | Soil | SVVLFKTVKRAIEGQRFAWDMLVGTAKMSFQTAESHESVKVP |
| Ga0302180_101720141 | 3300031028 | Palsa | KTLKRALEGRKFAWDKLERTAAVKYAPAEIREKVNVP |
| Ga0170824_1009909971 | 3300031231 | Forest Soil | IVLFKTLKRALEGRKFAWDKLERTAAVNYVPTEIRDHVNVP |
| Ga0265339_100937131 | 3300031249 | Rhizosphere | RTLMRAVTGRPFAWDKLERTAAVKYVPGERRDSVKV |
| Ga0310686_1135947971 | 3300031708 | Soil | TLKRALEGRKFAWDKLERTAAVNYVPTENRDQVNVP |
| Ga0318496_106120771 | 3300031713 | Soil | FKTLKRALEGRKFAWDKLERTAAVNYVPAEAQDHANVR |
| Ga0307476_101383303 | 3300031715 | Hardwood Forest Soil | LFKTLKRALEGRRFAWDKLERTAAVNYVPAENRDQVNVP |
| Ga0307474_112662322 | 3300031718 | Hardwood Forest Soil | FRTLKRAIQGRPFAWDKLARTAAVSYVPAERRDSVKV |
| Ga0318566_101495542 | 3300031779 | Soil | VLIKTLKRAAEGQKFAWDKLERTAAVKAPAERRESVKVP |
| Ga0318548_103943262 | 3300031793 | Soil | LIKTLKRAAEGQKFAWDKLERTAAVKAPAERRESVKVP |
| Ga0318511_103270292 | 3300031845 | Soil | TLKRAAEGQKFAWDKLERTAAVKAPAERRESVKVP |
| Ga0318549_100509561 | 3300032041 | Soil | IKTLKRAAEGQKFAWDKLERTAAVKAPAERRESVKVP |
| Ga0335082_113092232 | 3300032782 | Soil | KTLKRAIEGQRFAWDKLERTAAMSFMTPAAPPPQESTKVH |
| Ga0335072_114007401 | 3300032898 | Soil | LFRTLKRAITGRPFAWDKLDRTAAVKYIPAERHDSVKV |
| Ga0335076_112195171 | 3300032955 | Soil | KTLKRALEGRKFAWDKLERTAAVKYVPAENHDHANVR |
| Ga0371488_0178227_3_119 | 3300033983 | Peat Soil | LFRTLKRAIQGRPFAWDKLDRTAAVKYIPAERRESVKV |
| ⦗Top⦘ |