| Basic Information | |
|---|---|
| Family ID | F031611 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 182 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MAAAGLEASAEQRRRVRRSALLWALIAAAFYVGFIVLAVVRGTK |
| Number of Associated Samples | 114 |
| Number of Associated Scaffolds | 182 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 67.96 % |
| % of genes near scaffold ends (potentially truncated) | 28.57 % |
| % of genes from short scaffolds (< 2000 bps) | 79.67 % |
| Associated GOLD sequencing projects | 106 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (87.363 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (40.110 % of family members) |
| Environment Ontology (ENVO) | Unclassified (48.352 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (50.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 58.33% β-sheet: 0.00% Coil/Unstructured: 41.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 182 Family Scaffolds |
|---|---|---|
| PF04442 | CtaG_Cox11 | 40.66 |
| PF00115 | COX1 | 36.81 |
| PF00510 | COX3 | 8.24 |
| PF02104 | SURF1 | 3.30 |
| PF02628 | COX15-CtaA | 2.20 |
| PF00116 | COX2 | 1.10 |
| PF11137 | DUF2909 | 1.10 |
| PF00155 | Aminotran_1_2 | 1.10 |
| PF13500 | AAA_26 | 0.55 |
| PF10003 | DUF2244 | 0.55 |
| COG ID | Name | Functional Category | % Frequency in 182 Family Scaffolds |
|---|---|---|---|
| COG3175 | Cytochrome c oxidase assembly protein Cox11 | Posttranslational modification, protein turnover, chaperones [O] | 40.66 |
| COG1845 | Heme/copper-type cytochrome/quinol oxidase, subunit 3 | Energy production and conversion [C] | 8.24 |
| COG3346 | Cytochrome oxidase assembly protein ShyY1 | Posttranslational modification, protein turnover, chaperones [O] | 3.30 |
| COG1612 | Heme A synthase | Coenzyme transport and metabolism [H] | 2.20 |
| COG1622 | Heme/copper-type cytochrome/quinol oxidase, subunit 2 | Energy production and conversion [C] | 1.10 |
| COG4263 | Nitrous oxide reductase | Inorganic ion transport and metabolism [P] | 1.10 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 88.46 % |
| Unclassified | root | N/A | 11.54 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459018|G1P06HT01AR9KH | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 532 | Open in IMG/M |
| 2228664022|INPgaii200_c0336462 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 555 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_105835351 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1233 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_105836115 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1246 | Open in IMG/M |
| 3300004633|Ga0066395_10416790 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 760 | Open in IMG/M |
| 3300005332|Ga0066388_100305375 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2237 | Open in IMG/M |
| 3300005332|Ga0066388_104350061 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 722 | Open in IMG/M |
| 3300005332|Ga0066388_105982135 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 615 | Open in IMG/M |
| 3300005332|Ga0066388_107121443 | Not Available | 562 | Open in IMG/M |
| 3300005355|Ga0070671_101350464 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 629 | Open in IMG/M |
| 3300005363|Ga0008090_10162348 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1027 | Open in IMG/M |
| 3300005434|Ga0070709_10173493 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1509 | Open in IMG/M |
| 3300005436|Ga0070713_100054273 | Not Available | 3324 | Open in IMG/M |
| 3300005436|Ga0070713_100135768 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2173 | Open in IMG/M |
| 3300005436|Ga0070713_100376139 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1322 | Open in IMG/M |
| 3300005437|Ga0070710_10208756 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1237 | Open in IMG/M |
| 3300005542|Ga0070732_10249925 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1062 | Open in IMG/M |
| 3300005764|Ga0066903_100876357 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1620 | Open in IMG/M |
| 3300005764|Ga0066903_101696670 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1203 | Open in IMG/M |
| 3300005764|Ga0066903_102436497 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1012 | Open in IMG/M |
| 3300005764|Ga0066903_107698494 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 554 | Open in IMG/M |
| 3300006173|Ga0070716_101054851 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300006854|Ga0075425_100005731 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 12948 | Open in IMG/M |
| 3300009792|Ga0126374_10052264 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2081 | Open in IMG/M |
| 3300009792|Ga0126374_11184741 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288 | 611 | Open in IMG/M |
| 3300010043|Ga0126380_10852919 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 751 | Open in IMG/M |
| 3300010048|Ga0126373_10087941 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales | 2848 | Open in IMG/M |
| 3300010048|Ga0126373_10727334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1052 | Open in IMG/M |
| 3300010048|Ga0126373_11031881 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 888 | Open in IMG/M |
| 3300010048|Ga0126373_11956127 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 649 | Open in IMG/M |
| 3300010360|Ga0126372_10319928 | All Organisms → cellular organisms → Bacteria | 1375 | Open in IMG/M |
| 3300010360|Ga0126372_11197783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 784 | Open in IMG/M |
| 3300010360|Ga0126372_11247010 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 770 | Open in IMG/M |
| 3300010361|Ga0126378_11326701 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 814 | Open in IMG/M |
| 3300010361|Ga0126378_12190748 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 631 | Open in IMG/M |
| 3300010376|Ga0126381_100973575 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1223 | Open in IMG/M |
| 3300010376|Ga0126381_103035851 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 666 | Open in IMG/M |
| 3300010376|Ga0126381_103954117 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 577 | Open in IMG/M |
| 3300010398|Ga0126383_10304234 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1594 | Open in IMG/M |
| 3300010398|Ga0126383_11497830 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 764 | Open in IMG/M |
| 3300012971|Ga0126369_10042195 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3839 | Open in IMG/M |
| 3300012971|Ga0126369_13178360 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 538 | Open in IMG/M |
| 3300015371|Ga0132258_10183454 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales | 5061 | Open in IMG/M |
| 3300015374|Ga0132255_101306852 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales | 1094 | Open in IMG/M |
| 3300016270|Ga0182036_10422043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1043 | Open in IMG/M |
| 3300016270|Ga0182036_11111709 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 655 | Open in IMG/M |
| 3300016294|Ga0182041_10357364 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1230 | Open in IMG/M |
| 3300016294|Ga0182041_11001293 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 755 | Open in IMG/M |
| 3300016319|Ga0182033_11677989 | Not Available | 575 | Open in IMG/M |
| 3300016371|Ga0182034_10659622 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
| 3300016404|Ga0182037_11567032 | Not Available | 585 | Open in IMG/M |
| 3300017927|Ga0187824_10349812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 533 | Open in IMG/M |
| 3300017927|Ga0187824_10364065 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 523 | Open in IMG/M |
| 3300017928|Ga0187806_1232744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 633 | Open in IMG/M |
| 3300017936|Ga0187821_10239532 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 706 | Open in IMG/M |
| 3300017947|Ga0187785_10029956 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1968 | Open in IMG/M |
| 3300017947|Ga0187785_10413510 | Not Available | 652 | Open in IMG/M |
| 3300017959|Ga0187779_10107999 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1682 | Open in IMG/M |
| 3300017959|Ga0187779_10169563 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 1354 | Open in IMG/M |
| 3300017959|Ga0187779_10385002 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 912 | Open in IMG/M |
| 3300017970|Ga0187783_10004422 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 10415 | Open in IMG/M |
| 3300017970|Ga0187783_10215492 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 1409 | Open in IMG/M |
| 3300017970|Ga0187783_10600853 | Not Available | 796 | Open in IMG/M |
| 3300017974|Ga0187777_11007630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 603 | Open in IMG/M |
| 3300018058|Ga0187766_10415812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 892 | Open in IMG/M |
| 3300018060|Ga0187765_10013714 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 3722 | Open in IMG/M |
| 3300018060|Ga0187765_10190751 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 1179 | Open in IMG/M |
| 3300018060|Ga0187765_10747036 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 647 | Open in IMG/M |
| 3300018060|Ga0187765_11104189 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 551 | Open in IMG/M |
| 3300021358|Ga0213873_10256288 | Not Available | 555 | Open in IMG/M |
| 3300021377|Ga0213874_10153358 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288 | 805 | Open in IMG/M |
| 3300021441|Ga0213871_10004204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 2861 | Open in IMG/M |
| 3300021560|Ga0126371_10472465 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1401 | Open in IMG/M |
| 3300021560|Ga0126371_10654575 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1199 | Open in IMG/M |
| 3300021560|Ga0126371_11008098 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 974 | Open in IMG/M |
| 3300021560|Ga0126371_12073688 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 685 | Open in IMG/M |
| 3300021560|Ga0126371_12993733 | Not Available | 572 | Open in IMG/M |
| 3300025898|Ga0207692_10233412 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 1096 | Open in IMG/M |
| 3300025929|Ga0207664_10007171 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 7730 | Open in IMG/M |
| 3300025939|Ga0207665_10703098 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 795 | Open in IMG/M |
| 3300027371|Ga0209418_1097634 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 527 | Open in IMG/M |
| 3300027703|Ga0207862_1243329 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 528 | Open in IMG/M |
| 3300027842|Ga0209580_10179421 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1047 | Open in IMG/M |
| 3300031543|Ga0318516_10009483 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 4654 | Open in IMG/M |
| 3300031543|Ga0318516_10041545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2474 | Open in IMG/M |
| 3300031543|Ga0318516_10064923 | All Organisms → cellular organisms → Bacteria | 2014 | Open in IMG/M |
| 3300031543|Ga0318516_10244866 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1037 | Open in IMG/M |
| 3300031543|Ga0318516_10408458 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 782 | Open in IMG/M |
| 3300031543|Ga0318516_10467085 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288 | 725 | Open in IMG/M |
| 3300031543|Ga0318516_10486935 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 708 | Open in IMG/M |
| 3300031543|Ga0318516_10653669 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 598 | Open in IMG/M |
| 3300031544|Ga0318534_10010639 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 4606 | Open in IMG/M |
| 3300031544|Ga0318534_10073194 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 1941 | Open in IMG/M |
| 3300031544|Ga0318534_10123336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1489 | Open in IMG/M |
| 3300031544|Ga0318534_10151471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1338 | Open in IMG/M |
| 3300031544|Ga0318534_10759239 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 546 | Open in IMG/M |
| 3300031545|Ga0318541_10008601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 4489 | Open in IMG/M |
| 3300031545|Ga0318541_10190305 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1134 | Open in IMG/M |
| 3300031549|Ga0318571_10079466 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1038 | Open in IMG/M |
| 3300031561|Ga0318528_10035707 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2465 | Open in IMG/M |
| 3300031561|Ga0318528_10606411 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 587 | Open in IMG/M |
| 3300031572|Ga0318515_10431179 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288 | 705 | Open in IMG/M |
| 3300031572|Ga0318515_10501169 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288 | 648 | Open in IMG/M |
| 3300031573|Ga0310915_10058860 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae | 2503 | Open in IMG/M |
| 3300031573|Ga0310915_10748362 | Not Available | 689 | Open in IMG/M |
| 3300031668|Ga0318542_10309740 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288 | 809 | Open in IMG/M |
| 3300031679|Ga0318561_10013463 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 3631 | Open in IMG/M |
| 3300031679|Ga0318561_10543685 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 640 | Open in IMG/M |
| 3300031681|Ga0318572_10974522 | Not Available | 504 | Open in IMG/M |
| 3300031713|Ga0318496_10403717 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 755 | Open in IMG/M |
| 3300031715|Ga0307476_10065987 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 2498 | Open in IMG/M |
| 3300031715|Ga0307476_10171432 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1566 | Open in IMG/M |
| 3300031718|Ga0307474_10019058 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 4988 | Open in IMG/M |
| 3300031719|Ga0306917_11551618 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 509 | Open in IMG/M |
| 3300031720|Ga0307469_10580299 | All Organisms → cellular organisms → Bacteria | 998 | Open in IMG/M |
| 3300031724|Ga0318500_10332554 | Not Available | 748 | Open in IMG/M |
| 3300031736|Ga0318501_10034403 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 2267 | Open in IMG/M |
| 3300031736|Ga0318501_10650649 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 580 | Open in IMG/M |
| 3300031747|Ga0318502_10177340 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1226 | Open in IMG/M |
| 3300031748|Ga0318492_10757830 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 521 | Open in IMG/M |
| 3300031753|Ga0307477_10120201 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 1831 | Open in IMG/M |
| 3300031754|Ga0307475_11147995 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 606 | Open in IMG/M |
| 3300031765|Ga0318554_10240759 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 1030 | Open in IMG/M |
| 3300031765|Ga0318554_10257401 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 994 | Open in IMG/M |
| 3300031765|Ga0318554_10370795 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 813 | Open in IMG/M |
| 3300031770|Ga0318521_10079303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1768 | Open in IMG/M |
| 3300031778|Ga0318498_10020273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 2808 | Open in IMG/M |
| 3300031778|Ga0318498_10032095 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2283 | Open in IMG/M |
| 3300031778|Ga0318498_10211948 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 877 | Open in IMG/M |
| 3300031778|Ga0318498_10261029 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 780 | Open in IMG/M |
| 3300031782|Ga0318552_10200871 | Not Available | 1009 | Open in IMG/M |
| 3300031792|Ga0318529_10045037 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1884 | Open in IMG/M |
| 3300031793|Ga0318548_10039102 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2121 | Open in IMG/M |
| 3300031796|Ga0318576_10070084 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1557 | Open in IMG/M |
| 3300031797|Ga0318550_10264180 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 835 | Open in IMG/M |
| 3300031805|Ga0318497_10017581 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 3423 | Open in IMG/M |
| 3300031805|Ga0318497_10240616 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1003 | Open in IMG/M |
| 3300031821|Ga0318567_10209975 | Not Available | 1088 | Open in IMG/M |
| 3300031831|Ga0318564_10175916 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 954 | Open in IMG/M |
| 3300031832|Ga0318499_10234777 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 713 | Open in IMG/M |
| 3300031833|Ga0310917_10452618 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 873 | Open in IMG/M |
| 3300031860|Ga0318495_10454647 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 561 | Open in IMG/M |
| 3300031890|Ga0306925_11164384 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 775 | Open in IMG/M |
| 3300031890|Ga0306925_12047104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 538 | Open in IMG/M |
| 3300031893|Ga0318536_10133358 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1258 | Open in IMG/M |
| 3300031910|Ga0306923_10148329 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2676 | Open in IMG/M |
| 3300031912|Ga0306921_10411225 | Not Available | 1578 | Open in IMG/M |
| 3300031942|Ga0310916_10333737 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 1287 | Open in IMG/M |
| 3300031942|Ga0310916_10821115 | Not Available | 782 | Open in IMG/M |
| 3300031954|Ga0306926_10100268 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae | 3550 | Open in IMG/M |
| 3300031954|Ga0306926_11061975 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 960 | Open in IMG/M |
| 3300031959|Ga0318530_10021214 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 2237 | Open in IMG/M |
| 3300031962|Ga0307479_10114160 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 2630 | Open in IMG/M |
| 3300031962|Ga0307479_10494943 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 1206 | Open in IMG/M |
| 3300031981|Ga0318531_10050957 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1758 | Open in IMG/M |
| 3300031981|Ga0318531_10121575 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1159 | Open in IMG/M |
| 3300031981|Ga0318531_10416074 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 608 | Open in IMG/M |
| 3300032001|Ga0306922_11210226 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288 | 768 | Open in IMG/M |
| 3300032008|Ga0318562_10855188 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 520 | Open in IMG/M |
| 3300032041|Ga0318549_10143236 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1061 | Open in IMG/M |
| 3300032044|Ga0318558_10034560 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 2155 | Open in IMG/M |
| 3300032052|Ga0318506_10121993 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1128 | Open in IMG/M |
| 3300032054|Ga0318570_10081644 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1391 | Open in IMG/M |
| 3300032055|Ga0318575_10512005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288 | 609 | Open in IMG/M |
| 3300032063|Ga0318504_10114342 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1220 | Open in IMG/M |
| 3300032063|Ga0318504_10164537 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1026 | Open in IMG/M |
| 3300032063|Ga0318504_10318846 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300032066|Ga0318514_10021849 | Not Available | 2918 | Open in IMG/M |
| 3300032067|Ga0318524_10338565 | Not Available | 780 | Open in IMG/M |
| 3300032068|Ga0318553_10071132 | Not Available | 1742 | Open in IMG/M |
| 3300032090|Ga0318518_10158762 | Not Available | 1150 | Open in IMG/M |
| 3300032094|Ga0318540_10113571 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → environmental samples → uncultured Gemmatimonadota bacterium | 1282 | Open in IMG/M |
| 3300032174|Ga0307470_10742088 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 753 | Open in IMG/M |
| 3300032205|Ga0307472_100343685 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1222 | Open in IMG/M |
| 3300032783|Ga0335079_10008211 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 11895 | Open in IMG/M |
| 3300032805|Ga0335078_10925223 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1043 | Open in IMG/M |
| 3300032828|Ga0335080_10234740 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2008 | Open in IMG/M |
| 3300032892|Ga0335081_11458848 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 760 | Open in IMG/M |
| 3300032893|Ga0335069_10064466 | All Organisms → cellular organisms → Bacteria | 4739 | Open in IMG/M |
| 3300033158|Ga0335077_10274641 | Not Available | 1856 | Open in IMG/M |
| 3300033805|Ga0314864_0058440 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288 | 891 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 40.11% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 13.19% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.24% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 7.69% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.04% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.49% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.40% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.30% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.20% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.65% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.10% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.10% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.10% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.55% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.55% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.55% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.55% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.55% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.55% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.55% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.55% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459018 | Litter degradation MG2 | Engineered | Open in IMG/M |
| 2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Host-Associated | Open in IMG/M |
| 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
| 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Host-Associated | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027371 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027703 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033805 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_10 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 2MG_01961620 | 2170459018 | Switchgrass, Maize And Mischanthus Litter | MPATEIAAAEERRRRVRRSALVWSLFAAAFYLGFIILTLVRGMK |
| INPgaii200_03364622 | 2228664022 | Soil | MPATEIAAAEERRRRVRRSAWQWALVAAAFYLGFIVLSLLRGMK |
| INPhiseqgaiiFebDRAFT_1058353512 | 3300000364 | Soil | MPATEIAAAEERRRRVRRSAWQWALVAAAFYLGFIVLSLLRGMK* |
| INPhiseqgaiiFebDRAFT_1058361152 | 3300000364 | Soil | MSAIGIEASAQRRRVRRSAWAWALIAAAFYLGFIVLALLRGMK* |
| Ga0066395_104167902 | 3300004633 | Tropical Forest Soil | MAAANLEAGTAQRRRVRRSALLWGLIAAAFYVGFIVLAVVHGTK* |
| Ga0066388_1003053753 | 3300005332 | Tropical Forest Soil | MAAAGMEAIEQRRRRVRRSALLWALIAAAFYLGFIVLAVVRGTK* |
| Ga0066388_1043500612 | 3300005332 | Tropical Forest Soil | MAAADLEAGAGLRRRVRRSALLWALIAATFYLGFIVLALTRGLK* |
| Ga0066388_1059821352 | 3300005332 | Tropical Forest Soil | MAAAGMEASGERRRRVRRSALLWGLIAAAFYIGFILIAVLRGTK* |
| Ga0066388_1071214431 | 3300005332 | Tropical Forest Soil | MAAANLAASAAQRRRVRRSALLWGLIAAAFYVGFIFLAVVHGTK* |
| Ga0070671_1013504641 | 3300005355 | Switchgrass Rhizosphere | MSTTGVAATEQRRRVRRSALLWALIAAAFYFGFIIVALVRGAK* |
| Ga0008090_101623483 | 3300005363 | Tropical Rainforest Soil | MAAAGMEASGEQRRRVRRSALLWGLIAAAFYIGFILIALVRGTK* |
| Ga0070709_101734933 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MSATGIEASAQRRRVRRSAWAWALIAAAFYLGFIVLALLRGMK* |
| Ga0070713_1000542736 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MSSTGVAASEQQRRRVRRSALLWALIAAAFYLGFIIMALLRGAK* |
| Ga0070713_1001357681 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MSTTGVAATEQRRRVRRSALLWALIAAAFYFGFIIVALVR |
| Ga0070713_1003761392 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MSATGIEAGAQRRRVRRSAWAWALIAAAFYLGFIVLALLRGMK* |
| Ga0070710_102087563 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MSSTGVAASEQQRRRVRRSALLWALIAAAFYFGFIIVALVRGAK* |
| Ga0070732_102499253 | 3300005542 | Surface Soil | MAATDLEVTEQQRRRRVRRSALLWALIAAGFYLGFIVLSLVRAAK* |
| Ga0066903_1008763572 | 3300005764 | Tropical Forest Soil | MSATGIEAGAQRRRVRRSAWAWGLIAAAFYLGFIVLALLRGMR* |
| Ga0066903_1016966702 | 3300005764 | Tropical Forest Soil | MAAADLEAGAELRRRVRRSALLWALIAATFYLGFIVLAVMRGLK* |
| Ga0066903_1024364972 | 3300005764 | Tropical Forest Soil | MAAADLEAGAELRRRVRRSALLWALIAASFYLGFIVLAVVRGLK* |
| Ga0066903_1076984942 | 3300005764 | Tropical Forest Soil | MAAAHLDAGTAQRRRVRRSALLWGLIAAAFYVGFIVLAVVHGTK* |
| Ga0070716_1010548512 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MSTTGVAATEQRRRVRRSALLWALIAAAFYLGFIIMALLRGAK* |
| Ga0075425_1000057317 | 3300006854 | Populus Rhizosphere | MAAAGMEAATQQRRRVRRSALLWALLAAAFYLGFIIMALLRGAK* |
| Ga0126374_100522642 | 3300009792 | Tropical Forest Soil | MSATGIEASAQRRRVRRSAWAWALLAAAFYLGFIVLAVLRGMK* |
| Ga0126374_111847412 | 3300009792 | Tropical Forest Soil | MAAAHLDAGTAQRRRVRRSALLWGLIAAAFYVGFIVLAVVHGTK |
| Ga0126380_108529192 | 3300010043 | Tropical Forest Soil | MATANLAASTAQRRRVRRSALLWGLIAAAFYVGFIVLAVVHGTK* |
| Ga0126373_100879415 | 3300010048 | Tropical Forest Soil | MTAVEQRRRRVRRSAFALALVAAAFYVGFIVLALVRGSS* |
| Ga0126373_107273342 | 3300010048 | Tropical Forest Soil | MAAANLEAGTAQRRRVRRSALLWGLIAAAFYVGFIVMAVVHGTK* |
| Ga0126373_110318812 | 3300010048 | Tropical Forest Soil | MAAAGMEASGERRRRVRRSALLWGLIAVAFYIGFILIAVMRGTK* |
| Ga0126373_119561272 | 3300010048 | Tropical Forest Soil | MAATGLETSAAQRRRVRRSVLLWALIAAAFYVGFIVLAVVHGTK* |
| Ga0126372_103199283 | 3300010360 | Tropical Forest Soil | MSATGIEANAQRRRVRRSAWAWALIAAAFYLGFIVLALVRGMK* |
| Ga0126372_111977832 | 3300010360 | Tropical Forest Soil | MAAANLAASTAQRRRVRRSALLWGLIAAAFYVGFIVLAVVHGTK* |
| Ga0126372_112470102 | 3300010360 | Tropical Forest Soil | MAAAGMEAIEQQRRRVRRSALLWALIAAAFYLGFIVLAVVRGTK* |
| Ga0126378_113267012 | 3300010361 | Tropical Forest Soil | MAAAGMEASGERRRRVRRSALLWGLIAAAFYIVFILIAVLRGTK* |
| Ga0126378_121907482 | 3300010361 | Tropical Forest Soil | MAAADLEAGAELRRRVRRSALLWTLIAATFYLGFIVLAVLRGLK* |
| Ga0126381_1009735752 | 3300010376 | Tropical Forest Soil | MAAADLEASAEQRRRVRRSALLWGLIAAAFYVAFIVMAVVHGTK* |
| Ga0126381_1030358512 | 3300010376 | Tropical Forest Soil | MAAAGTEASGAQRRRVRRSALLWGLIAAAFYLGFIVIAVVHGTK* |
| Ga0126381_1039541172 | 3300010376 | Tropical Forest Soil | MASADLEAGVGLRRRVRRSALLWALIAGAFYLGFIVLALTRGLK* |
| Ga0126383_103042343 | 3300010398 | Tropical Forest Soil | MAAAHLDAGTAQRRRVRRSALLWGLIAAAFYVGFIVMAVVHGTK* |
| Ga0126383_114978302 | 3300010398 | Tropical Forest Soil | MSATGIEAGAQRRRVRRSAWAWALIAAAFYLGFIVLALVRGMK* |
| Ga0126369_100421952 | 3300012971 | Tropical Forest Soil | MSATGIEAGAQRRRVRRSAWAWALLAAAFYLGFIVLAVLRGMR* |
| Ga0126369_131783602 | 3300012971 | Tropical Forest Soil | MAAAGMEASGERRRRVRRSALLWALIAAAFYLGFIVLTVLRGR* |
| Ga0132258_101834547 | 3300015371 | Arabidopsis Rhizosphere | MSSTGVAATEQQRRRVRRSALLWSLIAVAFYLGFIIVALLRGAK* |
| Ga0132255_1013068522 | 3300015374 | Arabidopsis Rhizosphere | MSATGIETSAQRRRVRRSAWAWALIAAAFYLGFIVLALVRGMK* |
| Ga0182036_104220433 | 3300016270 | Soil | MAAADLEAGAEQRRRVRRSALLWALIAATFYLGFIVLAVTRGLK |
| Ga0182036_111117092 | 3300016270 | Soil | RARSRALMSAAGMAAGAERRRRVRRSALLWALIAAAFYLGFIVLALSRGMK |
| Ga0182041_103573643 | 3300016294 | Soil | MAATGLAVSEQRRRVRRSALLWALIAAAFYLGFIVLALLRGLK |
| Ga0182041_110012932 | 3300016294 | Soil | MAADLQASLAQRRRIRRSALLWASIAAAFYLGFIVLAVMRGLK |
| Ga0182033_116779892 | 3300016319 | Soil | MATANLQVGTEQLRRVRRSALLWASIAAAFYLGFIVLAVMRGLK |
| Ga0182034_106596222 | 3300016371 | Soil | MAATGLAVSEQRRRVRRSALLWALIAAAFYLGFIVLALMRAMK |
| Ga0182037_115670321 | 3300016404 | Soil | MAAADLEAGAEQRRRVRRSALLWALIAATFYLGFIVLAVIR |
| Ga0187824_103498122 | 3300017927 | Freshwater Sediment | MSSTGVAATEQRRRVRRSALLWALIAAAFYFGFIIVALVRGAK |
| Ga0187824_103640652 | 3300017927 | Freshwater Sediment | MSSATGLTADQQQRRRVRRSALLWALVAAAFYLGFIVLALLRGAK |
| Ga0187806_12327442 | 3300017928 | Freshwater Sediment | MAAAGLEASAEQRRRVRRSALLWALIAAAFYVGFIVLAVVRGTK |
| Ga0187821_102395322 | 3300017936 | Freshwater Sediment | MSATGVAATEQRRRVRRSALLWALIAAAFYFGFIIVALVRGAK |
| Ga0187785_100299563 | 3300017947 | Tropical Peatland | MAAAGLEANVQQRRRVRRSALLWALIAAAFYFGFIIVALVRGAK |
| Ga0187785_104135102 | 3300017947 | Tropical Peatland | MPGTDMAADEQRRLRVRRSALIWALIAAAFYVGFIVVSLLRGAK |
| Ga0187779_101079993 | 3300017959 | Tropical Peatland | MAAADLEAGAELRRRVRRSALLWALIAASFYLGFIVLALVRGLK |
| Ga0187779_101695632 | 3300017959 | Tropical Peatland | MAADLQASVEQRRRVRRSALLWAAIAAAFYLGFIVLAIMRATK |
| Ga0187779_103850022 | 3300017959 | Tropical Peatland | MSAALSHADERRRRVRRSALTWTLIAVGFYLSFIVLALLRGLK |
| Ga0187783_100044227 | 3300017970 | Tropical Peatland | MSGTDMALEEQRRLRVRRSALVWALIAAAFYIGFIVLTLVRGAK |
| Ga0187783_102154921 | 3300017970 | Tropical Peatland | EERRRLRVRRSAVLWALIAAGFYVGFIIMTLVRGGK |
| Ga0187783_106008531 | 3300017970 | Tropical Peatland | MPPLTVHPGSSEQQRRVRRSALLWALIAAAFYVGFIVLTLVRG |
| Ga0187777_110076302 | 3300017974 | Tropical Peatland | MLSPGVAASEQRRRVRRSALLWASIAAAFYLGFIVLALLRGMK |
| Ga0187766_104158123 | 3300018058 | Tropical Peatland | MPGTDMAADEQRRLRVRRSALIWALIAAAFYVGFIVMSLLRGAK |
| Ga0187765_100137147 | 3300018060 | Tropical Peatland | MPGTDMAADEQRRLRVRRSALIWALIAAAFYVGFIVLSLLRGAK |
| Ga0187765_101907512 | 3300018060 | Tropical Peatland | MAAADLQAIMEQRRRVRRSALLWASIAAAFYLGFIVLAVVRATQ |
| Ga0187765_107470362 | 3300018060 | Tropical Peatland | MSSTGVAAAEQRRRVRRSALLWALIAAAFYFGFIIVALVRGAK |
| Ga0187765_111041892 | 3300018060 | Tropical Peatland | MASADVAGDQQRRLRVRRSAIGWALLAAAFYVGFIVLTLVRGAK |
| Ga0213873_102562882 | 3300021358 | Rhizosphere | MSSSALAATEQQRRRVRRSALLWALIAAAFYVGFIVLALLRGAK |
| Ga0213874_101533582 | 3300021377 | Plant Roots | MSSTGVAVSEQQRRRVRRSALLWALVAAAFYLGFIVMAILRGVK |
| Ga0213871_100042045 | 3300021441 | Rhizosphere | MSATGFDATQQRRRVRRSALLWTLVAAAFYFGFIVLAVVRGLR |
| Ga0126371_104724652 | 3300021560 | Tropical Forest Soil | MAAADLEAGAELRRRVRRSALLWALIAASFYLGFIVLAVVRGLK |
| Ga0126371_106545753 | 3300021560 | Tropical Forest Soil | MAATDLEVTAQRRRVRRSALLWALIAATFYLGFIVLAVVHGTK |
| Ga0126371_110080982 | 3300021560 | Tropical Forest Soil | MSATGIEASAQRRRVRRSAWAWALIAAAFYLGFIVLALLRGMR |
| Ga0126371_120736882 | 3300021560 | Tropical Forest Soil | MAAAGMEASGERRRRVRRSALLWGLIAAAFYIVFILIAVLRGTK |
| Ga0126371_129937332 | 3300021560 | Tropical Forest Soil | MAAADLEAGAEQRRRVRRSALLWALIAGAFYLGFIVLALTRGLK |
| Ga0207692_102334122 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MSSTGVAASEQQRRRVRRSALLWALIAAAFYFGFIIVALVRGAK |
| Ga0207664_100071719 | 3300025929 | Agricultural Soil | MSTTGVAATEQRRRVRRSALLWALIAAAFYLGFIIMALLRGAK |
| Ga0207665_107030983 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | LMSSTGVAASEQQRRRVRRSALLWALIAAAFYLGFIIMALLRGAK |
| Ga0209418_10976342 | 3300027371 | Forest Soil | MAATGLETSTEQRRRVRRSALLWALIAAAFYVSFIVLAVIHGTQ |
| Ga0207862_12433291 | 3300027703 | Tropical Forest Soil | ARSRALMSATGMTTGAERRRRVRRSALLWALIAAAFYLGFIVLALLRAMK |
| Ga0209580_101794213 | 3300027842 | Surface Soil | RALMAATDLEVTEQQRRRRVRRSALLWALIAAGFYLGFIVLSLVRAAK |
| Ga0318516_100094833 | 3300031543 | Soil | MAAAGMKPGGGRRRRVRRSALLWGLIAAAFYIGFILIAVVRGTK |
| Ga0318516_100415453 | 3300031543 | Soil | MAATGLAVSEQRRRVRRSALLWTLIAAAFYLGFIVLALSRGMK |
| Ga0318516_100649233 | 3300031543 | Soil | MAAIGLAVSEQRRRVRRSALLWALIAAAFYLGFIVLALLRGLK |
| Ga0318516_102448663 | 3300031543 | Soil | MATANLQVGTEQRRRVRRSALLWASIAAAFYLGFIVLAVMRGLK |
| Ga0318516_104084582 | 3300031543 | Soil | MSASELAQSEQRRRLRRSALLWALIPVAFYLGFIVMALVRGAK |
| Ga0318516_104670852 | 3300031543 | Soil | MAAADLEAGSEQRRRVRRSALLWALIAAAFYMAFIVMAVVRGTK |
| Ga0318516_104869352 | 3300031543 | Soil | MAAVGTEADAEQRRRVRRSAWLWGLVAAAFYLGFIVMSIVRGMK |
| Ga0318516_106536692 | 3300031543 | Soil | MAAADLEGGAELRRRVRRSALLWALIAATFYLGFIVLAVIRGLK |
| Ga0318534_100106393 | 3300031544 | Soil | MAAAGMKPGGEQRRRVRRSALLWGLIAAAFYIGFILIAVVRGTK |
| Ga0318534_100731942 | 3300031544 | Soil | MAAADLEAGSEQRRRVRRSALLWGLIAAAFYMAFIVMAVVRGTK |
| Ga0318534_101233362 | 3300031544 | Soil | MAATDLEAGAELRRRVRRSALLWALIAATFYLGFIVLAVIRGLK |
| Ga0318534_101514712 | 3300031544 | Soil | MSAAGMAAGAERRRRVRRSALLWALIAAAFYLGFIVLAVTRGLK |
| Ga0318534_107592392 | 3300031544 | Soil | MAASMEGSEAQRRRVRRSALLWTLIAAAFYVGFIVVSLVRGAK |
| Ga0318541_100086012 | 3300031545 | Soil | MAAADLEASHEQRRRVRRSALLWGLIAAAFYVGFIVLAVVRGTK |
| Ga0318541_101903052 | 3300031545 | Soil | MAATGLAVSEQRRRVRRSALLWTLIAAAFYLGFIVLALLRGLK |
| Ga0318571_100794661 | 3300031549 | Soil | DRARSRALMAAIGLAVSEQRRRVRRSALLWALIAAAFYLGFIVLALLRGLK |
| Ga0318528_100357074 | 3300031561 | Soil | MAATGLAVSEQRRRVRRSALLWTLIAATFYLGFIVLALSRGMK |
| Ga0318528_106064112 | 3300031561 | Soil | MAAAGLEARPEQRRRVRRSALLWGLIAVAFYVAFIVIAVMRSTK |
| Ga0318515_104311792 | 3300031572 | Soil | MAATDLEAGAELRRRVRRSALLWALIAATFYLGFIVLAVIRG |
| Ga0318515_105011692 | 3300031572 | Soil | MAGARLAASGEQRRRVRRSALLWALIAAWFYVAFIV |
| Ga0310915_100588603 | 3300031573 | Soil | MAAAGTGTSGEQRRRVRRSALLWGLIAAAFYIGFILIAVVRGTK |
| Ga0310915_107483621 | 3300031573 | Soil | MAAADLEAGSEQRRRVRRSALLWGLIAAAFYMAFIVMAVVR |
| Ga0318542_103097402 | 3300031668 | Soil | MAAADLEAGSEQRRRVRRSALLWALIAAAFYMAFIVMAV |
| Ga0318561_100134635 | 3300031679 | Soil | MAAVGTEAGAEQRRRVRRSAWLWGLIAAAFYLGFIVMSIVRGMK |
| Ga0318561_105436851 | 3300031679 | Soil | RALMAATGLAVSEQRRRVRRSALLWTLIAAAFYLGFIVLALSRGMK |
| Ga0318572_109745221 | 3300031681 | Soil | MSATGMAAGAERRRRVRRSALLWALIAAAFYLGFIVLAVTRGLK |
| Ga0318496_104037171 | 3300031713 | Soil | DLEASHEQRRRVRRSALLWGLIAAAFYVGFIVLAVVRGTK |
| Ga0307476_100659872 | 3300031715 | Hardwood Forest Soil | MAAVGLEPGTSAQRRRVRRSALLWALIAAAFYLGFIILTLVRGWK |
| Ga0307476_101714322 | 3300031715 | Hardwood Forest Soil | MAAAGLEGSPEQRRRVRRSALLWALIATAFYVGFIVLAVVRGQ |
| Ga0307474_100190586 | 3300031718 | Hardwood Forest Soil | MAAGLEASPEQRRRVRRSALLWALIAAAFYVAFIVMAVVRGTK |
| Ga0306917_115516182 | 3300031719 | Soil | MSATGIEASAQRRRVRRSAWAWALIAAAFYHGFIVLALLRGMK |
| Ga0307469_105802992 | 3300031720 | Hardwood Forest Soil | MSASGIDAMSQRRRVRRSAWLWAMIAAGFYLGFIVLTLLRGTQ |
| Ga0307469_119221112 | 3300031720 | Hardwood Forest Soil | MSSSAPAAAEQRRRVRRSALAWALIAAAFYLGFIVLTLVRAAR |
| Ga0318500_103325541 | 3300031724 | Soil | MAATGLAVSEQRRRVRRSALLWTLIAAAFYLGFIV |
| Ga0318501_100344032 | 3300031736 | Soil | MAAIGLAVSEQRRRVRRSALLWTLIAAAFYLGFIVLALSRGMK |
| Ga0318501_106506492 | 3300031736 | Soil | MSDAGMAAGAERRRRVRRSALLWALIAAAFYLGFIVLAVTRGLK |
| Ga0318502_101773402 | 3300031747 | Soil | MAGARLAASGEQRRRVRRSALLWALIAAWFYVAFIVIAVMRSTK |
| Ga0318492_107578301 | 3300031748 | Soil | ELAQSEQRRRLRRSALLWALIPVAFYLGFIVMALVRGAK |
| Ga0307477_101202012 | 3300031753 | Hardwood Forest Soil | MAAVGLEQGTSARRRRVRRSALLWALIAAAFYLGFIILTLVRGWK |
| Ga0307475_111479952 | 3300031754 | Hardwood Forest Soil | MSATGIEATEQRRRVRRSALLWALIAAAFYLGFIVLAVTRGMK |
| Ga0318554_102407591 | 3300031765 | Soil | MAATGLAVSEQRRRVRRSALLWTLIAAAFYLGFIVLALSR |
| Ga0318554_102574012 | 3300031765 | Soil | MSVSELAQSEQRRRLRRSALLWALIPVAFYLGFIVMALVRGAK |
| Ga0318554_103707951 | 3300031765 | Soil | RALMAATGLAVSEQRRRVRRSALLWTLIAAAFYLGFIVLALLRGMK |
| Ga0318521_100793032 | 3300031770 | Soil | MAAADLEASHEQRAATHAAAFYVGFIVLAVVRGTK |
| Ga0318498_100202736 | 3300031778 | Soil | RALMAAAGMKPGGEQRRRVRRSALLWGLIAAAFYIGFILIAVVRGTK |
| Ga0318498_100320953 | 3300031778 | Soil | MAAVGTEADAEQRRRVRRSAWLWGLIAAAFYLGFIVMSIVRGMK |
| Ga0318498_102119481 | 3300031778 | Soil | GCGDRTRGRALMAATDLEAGAELRRRVRRSALLWALIAATFYLGFIVLAVIRGLK |
| Ga0318498_102610292 | 3300031778 | Soil | MATANLQVGTEQRRRVRRSALLWASIAAAFYLGFIVLAVMRGTP |
| Ga0318552_102008712 | 3300031782 | Soil | MAAADLEAGSEQRRRVRRSALLWALIAAAFYMAFIVMAVV |
| Ga0318529_100450371 | 3300031792 | Soil | LAVSEQRRRVRRSALLWTLIAATFYLGFIVLALSRGMK |
| Ga0318548_100391023 | 3300031793 | Soil | MATADLQASTEQRRRVRRSALLWASIAAAFYLGFIVLAVMRGLK |
| Ga0318576_100700843 | 3300031796 | Soil | LAVSEQRRRVRRSALLWTLIAAAFYLGFIVLALSRGMK |
| Ga0318550_102641801 | 3300031797 | Soil | ARGRALMAAVGTEADAEQRRRVRRSAWLWGLVAAAFYLGFIVMSIVRGMK |
| Ga0318497_100175816 | 3300031805 | Soil | ALMAAVGTEADAEQRRRVRRSAWLWGLVAAAFYLGFIVMSIVRGMK |
| Ga0318497_102406162 | 3300031805 | Soil | MAATGLAVSEQRRRVRRSALLWTLIAAAFYLGFIVLALLRGMR |
| Ga0318567_102099752 | 3300031821 | Soil | MAAADLEAGSEQRRRVRRSALLWGLIAAAFYMAFI |
| Ga0318564_101759162 | 3300031831 | Soil | MATANLQVGTEQRRRVRRSALLWASIAAAFYLGFIVLAV |
| Ga0318499_102347772 | 3300031832 | Soil | SRALMAAIGLAVSEQRRRVRRSALLWALIAAAFYLGFIVLALLRGLK |
| Ga0310917_104526181 | 3300031833 | Soil | ARGRALMAAAGTGTSGEQRRRVRRSALLWGLIAAAFYIGFILIAVVRGTK |
| Ga0318495_104546471 | 3300031860 | Soil | LMQPAGMTAVEQRRRRVRRSALALALLAAAFYVGFIVLALVRGSS |
| Ga0306925_111643842 | 3300031890 | Soil | MAAADLEGGAELRRRVRRSALLWALIAATFYLGFIVLAVMRGLK |
| Ga0306925_120471041 | 3300031890 | Soil | RGRALMATANLQVGTEQRRRVRRSALLWASIAAAFYLGFIVLAVMRGLK |
| Ga0318536_101333581 | 3300031893 | Soil | ATGIEASAQRRRVRRSAWAWALIAAAFYLGFIVLALLRGMK |
| Ga0306923_101483292 | 3300031910 | Soil | MAAADLEAGSEQRRRVRRSALLWGLIAAAFYVAFIVMAVMRGTK |
| Ga0306921_104112251 | 3300031912 | Soil | MAAAGMKPGGEQRRRVRRSALLWGLIAAAFYIGFILIAVVRGT |
| Ga0310916_103337372 | 3300031942 | Soil | MAATDLEAGAELRRRVRRSALLWALIAATFYLGFIVLAVTRGLK |
| Ga0310916_108211151 | 3300031942 | Soil | MAATGLAVSEQRRRVRRSALLWTLIAAAFYLGFIVLALLRGMK |
| Ga0306926_101002681 | 3300031954 | Soil | ARLAASGEQRRRVRRSALLWALIAAWFYVAFIVIAVMRSTK |
| Ga0306926_110619752 | 3300031954 | Soil | MQPAGMTAVEQRRRRVRRSALALALLAAAFYVGFIVLALVRGSS |
| Ga0318530_100212145 | 3300031959 | Soil | AGMKPGGEQRRRVRRSALLWGLIAAAFYIGFILIAVVRGTK |
| Ga0307479_101141605 | 3300031962 | Hardwood Forest Soil | MAAGLEASQEQRRRVRRSALLWALIAAAFYVAFIVMAVVRGTK |
| Ga0307479_104949432 | 3300031962 | Hardwood Forest Soil | MAAVGLEQGTCEQRRRVRRSALLWALIAAAFYVGFIILTLVRGSK |
| Ga0318531_100509573 | 3300031981 | Soil | MAAAGMKPGGEQRRRVRRSALLWGLIAAAFYVGFIVLAVVRGTK |
| Ga0318531_101215752 | 3300031981 | Soil | MAAADLEAGSEQRRRVRRSALLWGLIAAAFYIGFILIAVVRGTK |
| Ga0318531_104160742 | 3300031981 | Soil | YGDRARSRALMAAIGLAVSEQRRRVRRSALLWALIAAAFYLGFIVLALLRGLK |
| Ga0306922_112102261 | 3300032001 | Soil | MSAAGMAAGAERRRRVRRSALLWALIAAAFYLGFIVLAVT |
| Ga0318562_108551882 | 3300032008 | Soil | MQAAGLAADAERRRRVRRSALLWALVAGSFYLGFIVMALVRGWQ |
| Ga0318549_101432363 | 3300032041 | Soil | MAATDLEAGAELRRRVRRSALLWALIAATFYLGFIVLAVMRGLK |
| Ga0318558_100345605 | 3300032044 | Soil | LMAAAGMKPGGGRRRRVRRSALLWGLIAAAFYIGFILIAVVRGTK |
| Ga0318506_101219931 | 3300032052 | Soil | GLAVSEQRRRVRRSALLWTLIAAAFYLGFIVLALSRGMK |
| Ga0318570_100816441 | 3300032054 | Soil | ASTEQRRRVRRSALLWASIAAAFYLGFIVLAVMRGLK |
| Ga0318575_105120052 | 3300032055 | Soil | MSAAGMAAGAERRRRVRRSALLWALIAAAFYLGFI |
| Ga0318504_101143422 | 3300032063 | Soil | MAATDLEAGAELRRRVRRSALLWALIAATFYLGFIVLSVMRGLK |
| Ga0318504_101645371 | 3300032063 | Soil | RSRALMAAIGLAVSEQRRRVRRSALLWALIAAAFYLGFIVLAMLRGLK |
| Ga0318504_103188461 | 3300032063 | Soil | MSATGIEASAQRRRVRRSAWAWALIAAAFYLGFIV |
| Ga0318514_100218491 | 3300032066 | Soil | MAAIGLAVSEQRRRVRRSALLWALIAAAFYLGFIVLALL |
| Ga0318524_103385651 | 3300032067 | Soil | DRARGRALMAAAGTGTSGEQRRRVRRSALLWGLIAAAFYIGFILIAVVRGTK |
| Ga0318553_100711322 | 3300032068 | Soil | MAAVGTEADAEQRRRVRRSAWLWGLVAAAFYLGFI |
| Ga0318518_101587621 | 3300032090 | Soil | MAAAGMKPGGGRRRRVRRSALLWGLIAAAFYIGFILIAV |
| Ga0318540_101135712 | 3300032094 | Soil | MAAADLEAGAEQRRRVRRSALLWALIAATFYLGFIVLA |
| Ga0307470_107420882 | 3300032174 | Hardwood Forest Soil | MSASGIDAMSQRRRVRRSAWLWALIAAGFYLGFIVLTLLRGTQ |
| Ga0307472_1003436852 | 3300032205 | Hardwood Forest Soil | MSAAATASAAAVQRRRVRRSALTWALIAAAFYLGFIVLTLVRAAR |
| Ga0335079_100082118 | 3300032783 | Soil | MPSTDMAADEERRLRVRRSALIWALIAAAFYIGFIVLSLLRGAK |
| Ga0335078_109252233 | 3300032805 | Soil | LMPSTDMAADEERRLRVRRSALIWALIAAAFYIGFIVLSLLRGAK |
| Ga0335080_102347402 | 3300032828 | Soil | MSSPGVAATEQRRRVRRSALLWALIAAAFYFGFIVMALVRGAK |
| Ga0335081_114588481 | 3300032892 | Soil | DRTRRGALMPSTDMAADEERRLRVRRSALIWALIAAAFYIGFIVLSLLRGAK |
| Ga0335069_100644665 | 3300032893 | Soil | MSATGIEPTAQRRRLRRSALLWATVAAAFYLGFIVLAVLRSRR |
| Ga0335077_102746413 | 3300033158 | Soil | MSASGIAATEQRRRVRRSALLWALIAAAFYFGFIIVALVRGAK |
| Ga0314864_0058440_91_225 | 3300033805 | Peatland | MSATGLEAGEAQRRRVRRSALLWALIAAGCYLGFILLALLRAQR |
| ⦗Top⦘ |