Basic Information | |
---|---|
Family ID | F031589 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 182 |
Average Sequence Length | 47 residues |
Representative Sequence | AAEKLLPGGEWIARATGGAFLLLGVAVALRPDLVTALRGGHAM |
Number of Associated Samples | 164 |
Number of Associated Scaffolds | 182 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 96.15 % |
% of genes from short scaffolds (< 2000 bps) | 91.76 % |
Associated GOLD sequencing projects | 159 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.50 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (96.154 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (11.539 % of family members) |
Environment Ontology (ENVO) | Unclassified (24.725 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (41.758 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 45.07% β-sheet: 0.00% Coil/Unstructured: 54.93% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 182 Family Scaffolds |
---|---|---|
PF07040 | DUF1326 | 88.46 |
PF09948 | DUF2182 | 3.30 |
PF12697 | Abhydrolase_6 | 1.10 |
PF02771 | Acyl-CoA_dh_N | 0.55 |
PF08241 | Methyltransf_11 | 0.55 |
PF09601 | DUF2459 | 0.55 |
PF00501 | AMP-binding | 0.55 |
PF14572 | Pribosyl_synth | 0.55 |
PF12773 | DZR | 0.55 |
PF00296 | Bac_luciferase | 0.55 |
PF03061 | 4HBT | 0.55 |
PF14833 | NAD_binding_11 | 0.55 |
PF05164 | ZapA | 0.55 |
PF13193 | AMP-binding_C | 0.55 |
PF01872 | RibD_C | 0.55 |
PF01619 | Pro_dh | 0.55 |
COG ID | Name | Functional Category | % Frequency in 182 Family Scaffolds |
---|---|---|---|
COG5588 | Uncharacterized conserved protein, DUF1326 domain | Function unknown [S] | 88.46 |
COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.55 |
COG0506 | Proline dehydrogenase | Amino acid transport and metabolism [E] | 0.55 |
COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.55 |
COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.55 |
COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.55 |
COG3027 | Cell division protein ZapA, inhibits GTPase activity of FtsZ | Cell cycle control, cell division, chromosome partitioning [D] | 0.55 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 96.15 % |
Unclassified | root | N/A | 3.85 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2166559005|cont_contig46464 | All Organisms → cellular organisms → Bacteria | 900 | Open in IMG/M |
2228664021|ICCgaii200_c0720506 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 886 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_101957634 | All Organisms → cellular organisms → Bacteria | 1134 | Open in IMG/M |
3300000891|JGI10214J12806_10960266 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
3300000891|JGI10214J12806_11261969 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
3300000891|JGI10214J12806_11656854 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 527 | Open in IMG/M |
3300001661|JGI12053J15887_10611401 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
3300002243|C687J29039_10176931 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
3300003319|soilL2_10135651 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1070 | Open in IMG/M |
3300004058|Ga0055498_10024714 | All Organisms → cellular organisms → Bacteria | 921 | Open in IMG/M |
3300004479|Ga0062595_100213467 | All Organisms → cellular organisms → Bacteria | 1209 | Open in IMG/M |
3300004643|Ga0062591_100464732 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1072 | Open in IMG/M |
3300004643|Ga0062591_101027038 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
3300004643|Ga0062591_102522614 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 541 | Open in IMG/M |
3300005176|Ga0066679_11016330 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 515 | Open in IMG/M |
3300005177|Ga0066690_10544290 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 777 | Open in IMG/M |
3300005178|Ga0066688_11026312 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 501 | Open in IMG/M |
3300005328|Ga0070676_11456096 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 526 | Open in IMG/M |
3300005332|Ga0066388_101907337 | All Organisms → cellular organisms → Bacteria | 1061 | Open in IMG/M |
3300005332|Ga0066388_103118672 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 847 | Open in IMG/M |
3300005345|Ga0070692_10316521 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 958 | Open in IMG/M |
3300005445|Ga0070708_101108759 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 741 | Open in IMG/M |
3300005446|Ga0066686_10146999 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1555 | Open in IMG/M |
3300005446|Ga0066686_10987684 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 547 | Open in IMG/M |
3300005459|Ga0068867_101960169 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
3300005467|Ga0070706_101964839 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 530 | Open in IMG/M |
3300005536|Ga0070697_101827768 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
3300005549|Ga0070704_101771506 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 571 | Open in IMG/M |
3300005552|Ga0066701_10937236 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 512 | Open in IMG/M |
3300005558|Ga0066698_10040449 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2893 | Open in IMG/M |
3300005577|Ga0068857_100346557 | All Organisms → cellular organisms → Bacteria | 1375 | Open in IMG/M |
3300005578|Ga0068854_101341833 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
3300005598|Ga0066706_10862339 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 709 | Open in IMG/M |
3300005615|Ga0070702_101142762 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 624 | Open in IMG/M |
3300005713|Ga0066905_101630955 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
3300005764|Ga0066903_103393093 | Not Available | 860 | Open in IMG/M |
3300005764|Ga0066903_107773247 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
3300005843|Ga0068860_100690510 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1030 | Open in IMG/M |
3300005844|Ga0068862_100057797 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3327 | Open in IMG/M |
3300006031|Ga0066651_10014597 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3264 | Open in IMG/M |
3300006175|Ga0070712_100359817 | All Organisms → cellular organisms → Bacteria | 1193 | Open in IMG/M |
3300006791|Ga0066653_10784523 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 501 | Open in IMG/M |
3300006844|Ga0075428_102462733 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 533 | Open in IMG/M |
3300006846|Ga0075430_100933578 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 715 | Open in IMG/M |
3300006847|Ga0075431_101053656 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 779 | Open in IMG/M |
3300006852|Ga0075433_10490994 | All Organisms → cellular organisms → Bacteria | 1081 | Open in IMG/M |
3300006903|Ga0075426_10122132 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1872 | Open in IMG/M |
3300006903|Ga0075426_10381105 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1039 | Open in IMG/M |
3300006914|Ga0075436_100189287 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1456 | Open in IMG/M |
3300006969|Ga0075419_10339214 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1020 | Open in IMG/M |
3300007255|Ga0099791_10053047 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1818 | Open in IMG/M |
3300007265|Ga0099794_10590795 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
3300009012|Ga0066710_100162145 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3129 | Open in IMG/M |
3300009090|Ga0099827_10735154 | All Organisms → cellular organisms → Bacteria | 853 | Open in IMG/M |
3300009100|Ga0075418_11045907 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
3300009147|Ga0114129_12956795 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
3300009157|Ga0105092_10373287 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
3300009162|Ga0075423_10582825 | Not Available | 1178 | Open in IMG/M |
3300009177|Ga0105248_12166585 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
3300009553|Ga0105249_10078709 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3059 | Open in IMG/M |
3300009792|Ga0126374_10485328 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
3300009810|Ga0105088_1065197 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
3300009810|Ga0105088_1104877 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
3300010043|Ga0126380_10519225 | All Organisms → cellular organisms → Bacteria | 919 | Open in IMG/M |
3300010322|Ga0134084_10330211 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
3300010335|Ga0134063_10581872 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
3300010336|Ga0134071_10272292 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
3300010359|Ga0126376_11601841 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 683 | Open in IMG/M |
3300010360|Ga0126372_10125488 | All Organisms → cellular organisms → Bacteria | 1994 | Open in IMG/M |
3300010360|Ga0126372_10513077 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1129 | Open in IMG/M |
3300010362|Ga0126377_12638295 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
3300010366|Ga0126379_12727959 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 591 | Open in IMG/M |
3300010371|Ga0134125_12946121 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 517 | Open in IMG/M |
3300010398|Ga0126383_12805639 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 569 | Open in IMG/M |
3300010403|Ga0134123_12200310 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
3300011269|Ga0137392_10412043 | All Organisms → cellular organisms → Bacteria | 1122 | Open in IMG/M |
3300012081|Ga0154003_1025229 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1093 | Open in IMG/M |
3300012096|Ga0137389_10756909 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
3300012096|Ga0137389_11078568 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 688 | Open in IMG/M |
3300012096|Ga0137389_11388293 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
3300012203|Ga0137399_10585359 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 938 | Open in IMG/M |
3300012203|Ga0137399_10810318 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
3300012206|Ga0137380_10905992 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 757 | Open in IMG/M |
3300012210|Ga0137378_10827346 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
3300012353|Ga0137367_10940434 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
3300012355|Ga0137369_10197100 | All Organisms → cellular organisms → Bacteria | 1560 | Open in IMG/M |
3300012360|Ga0137375_11466791 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300012362|Ga0137361_10822213 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
3300012685|Ga0137397_10498182 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 907 | Open in IMG/M |
3300012908|Ga0157286_10321964 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 573 | Open in IMG/M |
3300012918|Ga0137396_10237957 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1342 | Open in IMG/M |
3300012929|Ga0137404_12091313 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
3300012948|Ga0126375_11378737 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
3300012948|Ga0126375_11725032 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 544 | Open in IMG/M |
3300012971|Ga0126369_11436549 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
3300012975|Ga0134110_10439178 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
3300012976|Ga0134076_10359477 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
3300012986|Ga0164304_11128711 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
3300014154|Ga0134075_10211907 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 834 | Open in IMG/M |
3300014870|Ga0180080_1050805 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
3300014875|Ga0180083_1098782 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
3300014968|Ga0157379_12125703 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
3300015053|Ga0137405_1081606 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1793 | Open in IMG/M |
3300015077|Ga0173483_10159178 | All Organisms → cellular organisms → Bacteria | 1004 | Open in IMG/M |
3300015254|Ga0180089_1096149 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
3300015358|Ga0134089_10285271 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
3300015359|Ga0134085_10024709 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2311 | Open in IMG/M |
3300015373|Ga0132257_101240321 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 945 | Open in IMG/M |
3300015374|Ga0132255_100481855 | All Organisms → cellular organisms → Bacteria | 1820 | Open in IMG/M |
3300016319|Ga0182033_10090096 | All Organisms → cellular organisms → Bacteria | 2226 | Open in IMG/M |
3300017656|Ga0134112_10364446 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
3300017974|Ga0187777_11025624 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
3300018071|Ga0184618_10218262 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
3300018075|Ga0184632_10427757 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
3300018079|Ga0184627_10534329 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
3300018468|Ga0066662_10436652 | All Organisms → cellular organisms → Bacteria | 1166 | Open in IMG/M |
3300018468|Ga0066662_11151009 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
3300018468|Ga0066662_12104068 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
3300019362|Ga0173479_10690237 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
3300020002|Ga0193730_1140324 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
3300020199|Ga0179592_10264827 | Not Available | 769 | Open in IMG/M |
3300021063|Ga0206227_1130007 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 510 | Open in IMG/M |
3300021081|Ga0210379_10404639 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
3300021560|Ga0126371_13791234 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 510 | Open in IMG/M |
3300025324|Ga0209640_10225370 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1587 | Open in IMG/M |
3300025325|Ga0209341_10332845 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1244 | Open in IMG/M |
3300025580|Ga0210138_1030975 | All Organisms → cellular organisms → Bacteria | 1176 | Open in IMG/M |
3300025885|Ga0207653_10068658 | All Organisms → cellular organisms → Bacteria | 1208 | Open in IMG/M |
3300025916|Ga0207663_10345127 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1125 | Open in IMG/M |
3300025918|Ga0207662_10439766 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
3300025930|Ga0207701_11307070 | Not Available | 594 | Open in IMG/M |
3300025957|Ga0210089_1012814 | All Organisms → cellular organisms → Bacteria | 921 | Open in IMG/M |
3300025972|Ga0207668_11532262 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
3300026088|Ga0207641_10854647 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 902 | Open in IMG/M |
3300026297|Ga0209237_1021886 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3630 | Open in IMG/M |
3300026318|Ga0209471_1246448 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
3300026351|Ga0257170_1022990 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
3300026482|Ga0257172_1000564 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3667 | Open in IMG/M |
3300026524|Ga0209690_1070251 | All Organisms → cellular organisms → Bacteria | 1499 | Open in IMG/M |
3300026529|Ga0209806_1037841 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2352 | Open in IMG/M |
3300026532|Ga0209160_1174420 | Not Available | 916 | Open in IMG/M |
3300026538|Ga0209056_10601208 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
3300026548|Ga0209161_10320496 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
3300027654|Ga0209799_1153595 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 524 | Open in IMG/M |
3300027717|Ga0209998_10009816 | All Organisms → cellular organisms → Bacteria | 1985 | Open in IMG/M |
3300027909|Ga0209382_10697855 | All Organisms → cellular organisms → Bacteria | 1092 | Open in IMG/M |
3300027950|Ga0209885_1016976 | Not Available | 773 | Open in IMG/M |
3300028047|Ga0209526_10375448 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 948 | Open in IMG/M |
3300028536|Ga0137415_11172225 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 583 | Open in IMG/M |
3300028771|Ga0307320_10330649 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
3300028812|Ga0247825_11108748 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
3300028884|Ga0307308_10327216 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
3300030006|Ga0299907_10421129 | All Organisms → cellular organisms → Bacteria | 1069 | Open in IMG/M |
3300030606|Ga0299906_10060107 | All Organisms → cellular organisms → Bacteria | 3034 | Open in IMG/M |
(restricted) 3300031197|Ga0255310_10003169 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4295 | Open in IMG/M |
3300031549|Ga0318571_10264100 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 637 | Open in IMG/M |
3300031572|Ga0318515_10018513 | All Organisms → cellular organisms → Bacteria | 3257 | Open in IMG/M |
3300031640|Ga0318555_10635049 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 578 | Open in IMG/M |
3300031679|Ga0318561_10673509 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
3300031681|Ga0318572_10203779 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1156 | Open in IMG/M |
3300031720|Ga0307469_10456841 | All Organisms → cellular organisms → Bacteria | 1107 | Open in IMG/M |
3300031720|Ga0307469_11914493 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 574 | Open in IMG/M |
3300031723|Ga0318493_10354911 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 798 | Open in IMG/M |
3300031740|Ga0307468_100252641 | All Organisms → cellular organisms → Bacteria | 1241 | Open in IMG/M |
3300031798|Ga0318523_10253054 | All Organisms → cellular organisms → Bacteria | 880 | Open in IMG/M |
3300031852|Ga0307410_10239539 | All Organisms → cellular organisms → Bacteria | 1405 | Open in IMG/M |
3300031858|Ga0310892_11095986 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
3300031941|Ga0310912_10301990 | All Organisms → cellular organisms → Bacteria | 1239 | Open in IMG/M |
3300031965|Ga0326597_11002323 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
3300031997|Ga0315278_11505702 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
3300032126|Ga0307415_101287865 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
3300032180|Ga0307471_104171173 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 510 | Open in IMG/M |
3300032205|Ga0307472_101883729 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 596 | Open in IMG/M |
3300033412|Ga0310810_10224385 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2095 | Open in IMG/M |
3300033500|Ga0326730_1080152 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
3300033550|Ga0247829_10275169 | All Organisms → cellular organisms → Bacteria | 1361 | Open in IMG/M |
3300034165|Ga0364942_0081768 | All Organisms → cellular organisms → Bacteria | 1042 | Open in IMG/M |
3300034165|Ga0364942_0134041 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
3300034176|Ga0364931_0227700 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
3300034354|Ga0364943_0306283 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
3300034660|Ga0314781_038843 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.54% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 11.54% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.14% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.59% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.04% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.49% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.95% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.95% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.30% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.75% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.75% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.20% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.20% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 2.20% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.65% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.65% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.65% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 1.65% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.65% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.65% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.10% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.10% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.10% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.10% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.10% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.10% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.55% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.55% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.55% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.55% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.55% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.55% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.55% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.55% |
Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.55% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.55% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.55% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.55% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.55% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.55% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.55% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.55% |
Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.55% |
Simulated | Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated | 0.55% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2166559005 | Simulated microbial communities from Lyon, France | Engineered | Open in IMG/M |
2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
3300002243 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_2 | Environmental | Open in IMG/M |
3300003319 | Sugarcane bulk soil Sample L2 | Environmental | Open in IMG/M |
3300004058 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D1 | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300009810 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300012081 | Attine ant fungus gardens microbial communities from Florida, USA - TSFL087 MetaG | Host-Associated | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012908 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1 | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
3300014870 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT560_16_10D | Environmental | Open in IMG/M |
3300014875 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_1_16_10D | Environmental | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
3300015254 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT860_16_10D | Environmental | Open in IMG/M |
3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021063 | Subsurface sediment microbial communities from Mancos shale, Colorado, United States - Mancos D4 | Environmental | Open in IMG/M |
3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
3300025325 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 (SPAdes) | Environmental | Open in IMG/M |
3300025580 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1 (SPAdes) | Environmental | Open in IMG/M |
3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
3300025957 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D1 (SPAdes) | Environmental | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
3300026351 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-05-B | Environmental | Open in IMG/M |
3300026482 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-B | Environmental | Open in IMG/M |
3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) | Host-Associated | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300027950 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_40_50 (SPAdes) | Environmental | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
3300030606 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125 | Environmental | Open in IMG/M |
3300031197 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1 | Environmental | Open in IMG/M |
3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
3300033500 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF7AN SIP fraction | Environmental | Open in IMG/M |
3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
3300034165 | Sediment microbial communities from East River floodplain, Colorado, United States - 19_s17 | Environmental | Open in IMG/M |
3300034176 | Sediment microbial communities from East River floodplain, Colorado, United States - 21_j17 | Environmental | Open in IMG/M |
3300034354 | Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17 | Environmental | Open in IMG/M |
3300034660 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
cont_0464.00003780 | 2166559005 | Simulated | RRGEWVARATGVAFLLLGAAVALWPDLVAALRGGDAT |
ICCgaii200_07205061 | 2228664021 | Soil | VLLVTAVVAAEKLLPGGGWIARATGVAFLLLGAAVTLRPELVMVLRGARAM |
INPhiseqgaiiFebDRAFT_1019576343 | 3300000364 | Soil | VLLITAVVAAEKLLPGGEWLARATGLALLVLGVAVAFRPDLVTVLRGHTM* |
JGI10214J12806_109602662 | 3300000891 | Soil | GGEWFARAAGGALLLLGATVALRPDLVTVLRGGHSM* |
JGI10214J12806_112619692 | 3300000891 | Soil | GEWIARATGGAFLLLGVAVALRPDLVTALRGGHAM* |
JGI10214J12806_116568541 | 3300000891 | Soil | WVLLVAAMVAAEKVLPGGEWIARATGVALVVLGVAVAVRPALALTLRGVAPVM* |
JGI12053J15887_106114012 | 3300001661 | Forest Soil | AAGAMGLPWVLLITAVVAAEKLTSGGEWIARITGSALVLLGVTVALRPDLVTALRSGHPM |
C687J29039_101769312 | 3300002243 | Soil | MGLPWVLLITAVVAGEKLLPGGEWVARAAGGALVLLGLTVALRPDLVTVLRGGHAM* |
soilL2_101356512 | 3300003319 | Sugarcane Root And Bulk Soil | PWVLLIACVVAAEKLLPRGEWIARATGVALMLLGVAVALRPDLAAALRSGGM* |
Ga0055498_100247142 | 3300004058 | Natural And Restored Wetlands | KLLPGGDWVARAAGGALLLLGATVALRPDLVTVLRGGHAM* |
Ga0062595_1002134673 | 3300004479 | Soil | IAAMVAAEKLLRRGEWVARATGAAFLLLGAAVALWPDLVTALRGGHAT* |
Ga0062591_1004647321 | 3300004643 | Soil | IASAVAAEKLLPRGEWIARLIGVALLILGGTVAVRPALVAALRSGGAAM* |
Ga0062591_1010270381 | 3300004643 | Soil | EKLLPGGQWFARATGGALLLLGVTVVYRPDLVMVLRGGHAW* |
Ga0062591_1025226142 | 3300004643 | Soil | AVVAAEKLLPRGEWIARATGGAFLLLGVAVALRPDLVTVLRGGHVT* |
Ga0066679_110163301 | 3300005176 | Soil | VLLIACVVASEKLLPGGEWIARAAGVALVLLGLAVVVHPGLASALRAAST* |
Ga0066690_105442901 | 3300005177 | Soil | AMGLPWVLLIACVVAGEKLLPRGEWIARMTGVVLAVLGVLVAIRPGLAMALRASAM* |
Ga0066688_110263122 | 3300005178 | Soil | PWVLLIGLAVAAEKLLPRGEWIARAIGVTLVLLGAAVAVRPDLTVTLRGGGSSM* |
Ga0070676_114560961 | 3300005328 | Miscanthus Rhizosphere | AEKLLPGGQWFARAAGGALLLLGVTVAFRPDLVMVLRGGHAW* |
Ga0066388_1019073371 | 3300005332 | Tropical Forest Soil | AAGAMGLPWVLLIAALVAGEKLLPGGEWIARIAGGVLMLLAVAVALRPDLVATLRGGHTM |
Ga0066388_1031186722 | 3300005332 | Tropical Forest Soil | IWVLLIAAVVAAEKLLPRGEWIAQTTGIALVLLGMAVALRPALAEALRAGAHSM* |
Ga0070692_103165212 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | VVAAEKLLPGGEWFARAAGGALLLLGVTVALRPDLVTVLRGGHAM* |
Ga0070708_1011087591 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | IAAVVAAEKLLRRGEWVARATGAAFLLLGAAVALWPDLVTALRGGHPT* |
Ga0066686_101469991 | 3300005446 | Soil | AAVVAAEKLLPRGEWIARTTGVALVLLGVAVAVRPSLAVALRAGGYSM* |
Ga0066686_109876842 | 3300005446 | Soil | IAAVVAAEKLLPRGEWVARVTGVALVLLGVAVAVRPGLAVALRAGGHSM* |
Ga0068867_1019601691 | 3300005459 | Miscanthus Rhizosphere | EKLLPGGEWFARAAGGALLLLGVTVALRPDLVTVLRGGHAM* |
Ga0070706_1019648391 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | IVAAEKLLPRGEWIARTTGIVLVLLGLAVVVRPGFAILLRASTLPM* |
Ga0070697_1018277682 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | AAEKLLPGGQWFARAAGGALLLLGVTVAFRPDLVMVLRGGHAW* |
Ga0070704_1017715062 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | VVAAEKLLPRGEWIARATGAVFLLLGTVAALYPHLVNVLRGAHAM* |
Ga0066701_109372361 | 3300005552 | Soil | AEKLLPRGEWIARTTGVALVLLGVAVAVRPSLAVALRAGGYSM* |
Ga0066698_100404491 | 3300005558 | Soil | KLMWGGDWIARIAGSALVLLGVTVALRPDLVTALRSGHPM* |
Ga0068857_1003465571 | 3300005577 | Corn Rhizosphere | AMGLAWVLLITAMVAAEKLLPGGEWIARATGGAFLLLGVAVALRPDLVTALRGGHAM* |
Ga0068854_1013418331 | 3300005578 | Corn Rhizosphere | EKLLPGGEWIARATGGAFLLLGVAVALRPDLVTALRGGHAM* |
Ga0066706_108623391 | 3300005598 | Soil | IAAVVAAEKLLPRGEWIARTIGVALVLLGVAVAVRPGLALVLRVGGHSM* |
Ga0070702_1011427621 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MGLIWVLTIAAVVAAEKLLRRGEWVARATGAAFLLLGAAVALWPDLVTALRGGHPT* |
Ga0066905_1016309552 | 3300005713 | Tropical Forest Soil | IAAVVTAEKLLPRGEWIAQTTGIALVLLGMAVAMRPALAEALRAGAHSM* |
Ga0066903_1033930931 | 3300005764 | Tropical Forest Soil | LLPGGEWMARATGGAFLLLGVAVVMRQELVTALRGGHLM* |
Ga0066903_1077732471 | 3300005764 | Tropical Forest Soil | GGQWIARATGGALLLLGIALALRPDFVTALRGGHTM* |
Ga0068860_1006905103 | 3300005843 | Switchgrass Rhizosphere | LVAAVVAAEKLLPRGEWIARATGGALVLLGVAVALRPSLVAALRGGHAM* |
Ga0068862_1000577971 | 3300005844 | Switchgrass Rhizosphere | PGGEWIARATGGAFLLLGVAVALRPDLVTALRGGHAM* |
Ga0066651_100145971 | 3300006031 | Soil | AEKILPRGEWIARMTGVALALLGVAVAAEPGLAALLRAWAM* |
Ga0070712_1003598172 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | PWALLIAAVVFAEKALPRGAWKARTAGAALVLLGVLVIVEPGLAAALRAWSL* |
Ga0066653_107845232 | 3300006791 | Soil | GLSWVLLMACVGAGEKLLPRGEWIVRMTGVALAVLGVIVALRPGLAMALRASSM* |
Ga0075428_1024627332 | 3300006844 | Populus Rhizosphere | VLLIAAVVAAEKLLPRGEWIARTTGIALVLLGVAVAIRPSLAGALRAAGHSM* |
Ga0075430_1009335782 | 3300006846 | Populus Rhizosphere | ACVVAAEKILPRGEWVARTTGVVLALLGVAVAIEPGLAASLRGASM* |
Ga0075431_1010536562 | 3300006847 | Populus Rhizosphere | LIACVVAAEKILPRGEWVARVSGVALALLGVAVAVDPRLAATLRGAAM* |
Ga0075433_104909941 | 3300006852 | Populus Rhizosphere | LLPGGEWIARTAGGALVLLGVAVALRPDLVTALRGAHAL* |
Ga0075426_101221325 | 3300006903 | Populus Rhizosphere | VVAAEKLLQGGEWMAWATGGAFLLLGLAVVWRPDLVTALRGGLAM* |
Ga0075426_103811051 | 3300006903 | Populus Rhizosphere | IVAAEKLLRGGEWVAWVTGVALAALGVAVAVHPQLATALRASSM* |
Ga0075436_1001892873 | 3300006914 | Populus Rhizosphere | LLIAAIVGAEKLLPRGEWIARAIGIALVLLGIAVAVRPSFASLLRAGTPSM* |
Ga0075419_103392141 | 3300006969 | Populus Rhizosphere | TVAVEKLVPRGEWIARLTGVALVLLGVAVAVRPALAAGLRSSGASM* |
Ga0099791_100530471 | 3300007255 | Vadose Zone Soil | LIACVVAGEKLLPRGEWIARTTGVALAGLGVIVAIRPGLAMALRAASM* |
Ga0099794_105907951 | 3300007265 | Vadose Zone Soil | ITAVVAAEKLMSGGKWIARIVGGALVLLGVTVALRPDFVTALRSGHPM* |
Ga0066710_1001621451 | 3300009012 | Grasslands Soil | IAAVVAAEKLLPRGEWVARVTGVALVLLGVAVAVRPGLAVALRAGGHSM |
Ga0099827_107351542 | 3300009090 | Vadose Zone Soil | WVLLITAVVAAEKLLSGGEWIARIAGSALVLLGVTVALRPDLVTALRSGHPM* |
Ga0075418_110459071 | 3300009100 | Populus Rhizosphere | GGEWIARATGVALVVLGMTVAVRPELVMVLRGAHAM* |
Ga0114129_129567952 | 3300009147 | Populus Rhizosphere | GGERVARVGGVALVLLGLLVALQPDLATQLRGSTM* |
Ga0105092_103732872 | 3300009157 | Freshwater Sediment | ACVVAAEKLLPRGEWLARLAGVALVLLGAAVAVRPGLAVALRSSM* |
Ga0075423_105828251 | 3300009162 | Populus Rhizosphere | VAAEKLLPGGERVARAGGVALVVLGLLVAVQPEVAIQLRGATM* |
Ga0105248_121665851 | 3300009177 | Switchgrass Rhizosphere | AAEKLLPGGEWIARATGGAFLLLGVAVALRPDLVAALRGGHAM* |
Ga0105249_100787094 | 3300009553 | Switchgrass Rhizosphere | GLIWVLTIAAMVAAEKLLRRGEWVARATGAAFLLLGAAVALWPDLVTALRGGHAT* |
Ga0126374_104853282 | 3300009792 | Tropical Forest Soil | EKLLPGGEWIARTAGVALMLLGVAVAVRPGLAAILRAGAHSM* |
Ga0105088_10651972 | 3300009810 | Groundwater Sand | VAAEKLLPGGEWFARAAGGALLLLGVTVALRPDLVMVLRGGHAM* |
Ga0105088_11048772 | 3300009810 | Groundwater Sand | VVAAEKLLPRGEWVARVTGITLVLLGVAVAVRPGLAVALRAGSHSM* |
Ga0126380_105192251 | 3300010043 | Tropical Forest Soil | IAAVVSAEKLLPAGEWIARATGGALLLLGVAVALRPDLVAALRGGQAM* |
Ga0134084_103302112 | 3300010322 | Grasslands Soil | LLIAAVVAAEKLLPRGEWIARATGGALLLLGVAVALRPALVTALRAGHAM* |
Ga0134063_105818721 | 3300010335 | Grasslands Soil | KLLPRGEWIARTTGVALAVLGMIVAIRPGLAMALRAASM* |
Ga0134071_102722921 | 3300010336 | Grasslands Soil | AVVAAEKLLPRGEWIARATGGALLLLGVAVALRPAVVTALRAGHSM* |
Ga0126376_116018412 | 3300010359 | Tropical Forest Soil | PWVLLIACVVAAEKILPRGEWVARTTGVALALLGVTVAIEPGLAAALRGASM* |
Ga0126372_101254881 | 3300010360 | Tropical Forest Soil | LTIAAVVAAEKLLRGGEWVARATGAAFLLLGVAVALWPDLVAALRAG* |
Ga0126372_105130773 | 3300010360 | Tropical Forest Soil | WVLLIACVVAAEKILPRGEWVARTTGVALALLGVTVAIEPGLAAALRGASM* |
Ga0126377_126382952 | 3300010362 | Tropical Forest Soil | AAEKLLPRGEWIARATGGAFLLRGVALALRPDLVTALRGGHAM* |
Ga0126379_127279592 | 3300010366 | Tropical Forest Soil | WVLLITAVVAAEKLLPKGEWIARATGGALLLLGVVLALRPALVTALRGGHVM* |
Ga0134125_129461212 | 3300010371 | Terrestrial Soil | LIAAIVAAEKLLPRGEWIARTTGIVLVLLGLAVVVRPGFAILLRASTLPM* |
Ga0126381_1026449082 | 3300010376 | Tropical Forest Soil | AAEKILPRGEWVARTTGVALALLGVTVAIEPGLAAALRGASM* |
Ga0126383_128056392 | 3300010398 | Tropical Forest Soil | WVLLIAAVVSAEKLLPAGEWIARATGGALVLLGVAVALRPDLVAALRGAHAM* |
Ga0134123_122003102 | 3300010403 | Terrestrial Soil | VLLITAVVAAEKLLPGGDWMARATGGALLFLGMAVAVRPDLVAALRGAHAM* |
Ga0137392_104120431 | 3300011269 | Vadose Zone Soil | VVAAEKLLPRGEWIARATGAALLLLGVAVVLRPALVTALRAGHAM* |
Ga0154003_10252293 | 3300012081 | Attine Ant Fungus Gardens | LAWVLLITALVAAEKLLPKGAWIARATGGALLLLGVAAALRPDLVAALRGAHAM* |
Ga0137389_107569092 | 3300012096 | Vadose Zone Soil | VAAGAMGLPWVLLITAVVAAEKLMRGGEWIARIAGGALVLLGVTVALRPDLVTALRSGHPM* |
Ga0137389_110785682 | 3300012096 | Vadose Zone Soil | WVLLIAAVVAAEKLLPRGEWIARTTGVALVLLGVAVAVRPSLAVVLRAGGHSM* |
Ga0137389_113882931 | 3300012096 | Vadose Zone Soil | RGEWIARVTGVALVLLGLAVVVRPDLAVVLRGGGHAM* |
Ga0137399_105853593 | 3300012203 | Vadose Zone Soil | VVAGEKLLPRGEWIARMTGVALAVLGVIVAIRPGLAMALRAPSM* |
Ga0137399_108103181 | 3300012203 | Vadose Zone Soil | GEKLLPRGEWIARMTGVALAVLGVIVALRPGLAMALRASSM* |
Ga0137380_109059921 | 3300012206 | Vadose Zone Soil | WVLLIAVVVAAEKILPRGEWIARLAGVALVALGIAVAVRPELAFALRAGRHSM* |
Ga0137378_108273461 | 3300012210 | Vadose Zone Soil | AEKLLPRGEWIARTTGIALVLLGMAVAVRPSFAILLRASALPL* |
Ga0137367_109404342 | 3300012353 | Vadose Zone Soil | AGEKLVPRGEWIVRATGVALVLLGLAVAVRPELATVLRAGGHSM* |
Ga0137369_101971003 | 3300012355 | Vadose Zone Soil | WVLLITALVAAEKLLPGGEWLARAAGGALLLLGATVALRPDLVMVLRGGHPM* |
Ga0137375_114667912 | 3300012360 | Vadose Zone Soil | EKLLPGGEWLARAAGGALLLLGATVALRPDLVMVLRGGHPM* |
Ga0137361_108222131 | 3300012362 | Vadose Zone Soil | EWIARIAGSALVLLGVTVALRPDLVTALRSGHSM* |
Ga0137397_104981822 | 3300012685 | Vadose Zone Soil | GLAWVLLIAAVVAAEKLLPRGEWIARATGGALLLLGAAVALRPALVTALRAGHAM* |
Ga0157286_103219642 | 3300012908 | Soil | WVLLITAVVAAEKLLPGGEWIARATGVALVVLGMTVAVRPELVMVLRGAHAM* |
Ga0137396_102379571 | 3300012918 | Vadose Zone Soil | KILPRGEWIARLAGVALVALGIAVAVRPELAVALRAGRHSM* |
Ga0137404_120913131 | 3300012929 | Vadose Zone Soil | EWIARITGSALVLLGVTVALRPDFVTALRSGHPM* |
Ga0126375_113787372 | 3300012948 | Tropical Forest Soil | VSAEKLLPAGEWIARATGGALLLLGVAVALRPDLVAALRGGHAM* |
Ga0126375_117250321 | 3300012948 | Tropical Forest Soil | WVFLIAALVAADKLAPRGDWIARLAGAALVLLGIAVALKPDLGHLLRGGGSM* |
Ga0126369_114365491 | 3300012971 | Tropical Forest Soil | TAVVAAEKLLPAGEWVARATGVGLVVLGVIVAVHPELVTVLRGAHPM* |
Ga0134110_104391781 | 3300012975 | Grasslands Soil | IACVVASEKLLPRGEWIARMTGVALAVLGVIVALRPGLAMALRASSM* |
Ga0134076_103594771 | 3300012976 | Grasslands Soil | LIGLAVAAEKLLPRGEWIARAIGVALVLLGAAVAVRPDLAVALRGGGSSM* |
Ga0164304_111287112 | 3300012986 | Soil | MGLRWVLLITAVVAAEKLLPGGEWFARAAGGALLLLGATVALRPDLVTVLRGGHAM* |
Ga0134075_102119071 | 3300014154 | Grasslands Soil | AWVLLIAAVVAAEKLLPRGEWIARATGGALLLLGVAVALRPAVVTALRAGHSM* |
Ga0180080_10508052 | 3300014870 | Soil | AAEKLLPGGAWFARAAGGALLLLGVTVALWPDLVTVLRGAHAM* |
Ga0180083_10987821 | 3300014875 | Soil | VLLITAVVAAEKLLPGGEWIARAAGVALLLLGLTVALRPEFVTVLRGGHAL* |
Ga0157379_121257032 | 3300014968 | Switchgrass Rhizosphere | LITAVVAAEKLLPGGEWFARAAGGALLLLGVTVALRPDLVTVLRGGHAM* |
Ga0137405_10816061 | 3300015053 | Vadose Zone Soil | PWVLLIAAVVAAEKLLPRGAWIARVTGVALLVLGVAVAVRPELAVALRAGGQSI* |
Ga0173483_101591781 | 3300015077 | Soil | TAVVAAEKLLPGGEWLARATGLALLVLAVAVAIRPDLVTVLRGHTM* |
Ga0180089_10961491 | 3300015254 | Soil | EKLLPGGEWFARAAGGALLLLGVTVALWPDLVTVLRGGHAM* |
Ga0134089_102852711 | 3300015358 | Grasslands Soil | KLLPGGEWIARVTGVALVALGVAVALHPGFAIALRAGGHSM* |
Ga0134085_100247094 | 3300015359 | Grasslands Soil | LLIACVVAAEKILPRGEWIARMTGVALALLGVAVAAEPGLAALLRAWAM* |
Ga0132257_1012403212 | 3300015373 | Arabidopsis Rhizosphere | GLAWVLLVAAVVAAEKLLPRGEWIARATGGAFVLLGVAVALRPSLVAALRGGHAM* |
Ga0132255_1004818551 | 3300015374 | Arabidopsis Rhizosphere | LITAVVAAEKLLPGGEWLARGAGAALLVLGVAVAFRPDLVTVLRGHTM* |
Ga0182033_100900963 | 3300016319 | Soil | MGLAWVLLITAVVAAERLLPRGEWIARATGGAFLLLGVAVTLRPDLVTALRGGHAM |
Ga0134112_103644462 | 3300017656 | Grasslands Soil | LIGLAVAAEKLLPRGEWIARAIGVALVLLGAAVAVRPDLAVALRGGGSSM |
Ga0187777_110256241 | 3300017974 | Tropical Peatland | AEKLLPRGDWIARTTGIVLVLLGIAVAVRPSFGVLLRAGIRSMYSM |
Ga0184618_102182622 | 3300018071 | Groundwater Sediment | GGEWFARATGGALLLLGVTVAFRPDLVTVLRGGHAM |
Ga0184632_104277571 | 3300018075 | Groundwater Sediment | ITAVVAAEKLLPSGEWFARAAGGALLLLGVTVALRPDLVMVLRGAHAM |
Ga0184627_105343292 | 3300018079 | Groundwater Sediment | VLLITAVVAAEKLLPGGEWFARAAGGALLLLGVTVALRPDLVTVLRGGHAM |
Ga0066662_104366521 | 3300018468 | Grasslands Soil | AEMLLRRAEWIARRTVVGLVLLGVAVAVRPSLAAALRAGGHSM |
Ga0066662_111510092 | 3300018468 | Grasslands Soil | VAAEKLMPRGEWIARTTGVALALLGAAVALHPGLATVLRASSM |
Ga0066662_121040682 | 3300018468 | Grasslands Soil | VAGEKLLPRGEWIARMTGVVLAVLGVLVAIRPGLAMALRASAM |
Ga0173479_106902372 | 3300019362 | Soil | GEWIARATGGAFLLLGVAVALRPDLVTALRGGHAM |
Ga0193730_11403242 | 3300020002 | Soil | KLLPGGEWFARAAGGALLLLGATVALRPDLVMVLRGGHPM |
Ga0179592_102648272 | 3300020199 | Vadose Zone Soil | RLPRGEWIARMTGVALAVLGVIVAIRPGLAMALRASSM |
Ga0206227_11300072 | 3300021063 | Deep Subsurface Sediment | AMGLVWVLLIAALVAAEKLLPGGEWIARAAGGALVLLGVAVAFRPDLVMALRGGHTM |
Ga0210379_104046391 | 3300021081 | Groundwater Sediment | VVAAEKLLPGGEWLARAAGGALLLLGVTVALWPDLVTVLRGGHAM |
Ga0126371_137912342 | 3300021560 | Tropical Forest Soil | VLVAAGAMGLPWVLLIAAVVAGEKLLPGGEWIARIAGGVLMLLAVAVALRPDLVATLRGGHTM |
Ga0209640_102253703 | 3300025324 | Soil | LPWVLLITAIVAVEKLTPGGEWIARIAGVALVLLGVTVALRPDLVAALRGAHAM |
Ga0209341_103328453 | 3300025325 | Soil | LIAAGVAAEKLVPRGEWVARLTGVVLVLLGVAVAVHPGLAAALRAGARSM |
Ga0210138_10309751 | 3300025580 | Natural And Restored Wetlands | WVLLITAVVAAEKLLPGGEWFARAAGGALLLLGFTVALWPDLVMVLRGGHTL |
Ga0207653_100686583 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | VLLIAAVVAAEKLLPRGEWIARATGGAFLLLGVAVALRPDLVTALRGGHAM |
Ga0207663_103451273 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | LIWVLTIAAVVAAEKLLRRGEWIARATGVAFLLLGAAVALWPDLVTALRGGHPT |
Ga0207662_104397662 | 3300025918 | Switchgrass Rhizosphere | LLITAMVAAEKLLPGGEWIARATGGAFLLLGVAVALRPDLVTALRGGHAM |
Ga0207701_113070702 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | VVVLLEKLVPRGEQVARVTGVALVVLGVAVALNPDLAMMLRPSTMGM |
Ga0210089_10128141 | 3300025957 | Natural And Restored Wetlands | KLLPGGDWVARAAGGALLLLGATVALRPDLVTVLRGGHAM |
Ga0207668_115322622 | 3300025972 | Switchgrass Rhizosphere | GGEWMARATGGALLFLGMAVAVRPDLVAALRGAHAM |
Ga0207641_108546471 | 3300026088 | Switchgrass Rhizosphere | GLIWVLTIAAVVAAEKLLRRGEWVARATGAAFLLLGAAVALWPDLVAALRGGHAT |
Ga0209237_10218861 | 3300026297 | Grasslands Soil | GLPWVLLIACLVAAEKLMPRGEWIARTTGVALALLGAAVALHPGLATVLRASSM |
Ga0209471_12464481 | 3300026318 | Soil | VVAAEKLLRGGEWFARATGVALALLGVAVAIYPRLATALRASWM |
Ga0257170_10229902 | 3300026351 | Soil | LRWVLLITAVVAAEKLLPGGEWFARAAGGALLLLGVTVALRPDLVTVLRGGHAM |
Ga0257172_10005641 | 3300026482 | Soil | AGAMGLPWVLLITAVVAAEKLTWGGEWIARITGSALVLLGMTVALRPDLVTALRSGHPM |
Ga0209690_10702513 | 3300026524 | Soil | EKLLPRGEWIARTTGVALVLLGVAVAVRPSLAVALRAGGHSM |
Ga0209806_10378411 | 3300026529 | Soil | LVAAGAMGLPWVLLITAVVAAEKLMWGGDWIARIAGSALVLLGVTVALRPDLVTALRSGHPM |
Ga0209160_11744202 | 3300026532 | Soil | TAVVAAEKLMWGGDWIARIAGSALVLLGVTVALRPDLVTALRSGHPM |
Ga0209056_106012082 | 3300026538 | Soil | AEKLLPGGEWIARAIGVALVLLGAAVVIRPELVVALRGGGSPM |
Ga0209161_103204961 | 3300026548 | Soil | EKLLPRGEWIARTIGVALVLLGVAVAVRPGLALVLRVGGHSM |
Ga0209799_11535952 | 3300027654 | Tropical Forest Soil | WVLLIAAVVAAEKLLPRGEWIARATGVALMVLGIAVAVRPGLAMALRAGTQAM |
Ga0209998_100098163 | 3300027717 | Arabidopsis Thaliana Rhizosphere | VADGDVGEAGAVAAEKLLPRGEWIARLTGVGLMVLGAAVAARPELATALRSSGVAM |
Ga0209382_106978551 | 3300027909 | Populus Rhizosphere | GEWIARATGAAFLFLGTVAALHPNLVNVLRGTHAM |
Ga0209885_10169761 | 3300027950 | Groundwater Sand | AVVAAEKLLPRGEWVARVIGVALVLLGVAVAVRPGLAVALRAGGHSM |
Ga0209526_103754481 | 3300028047 | Forest Soil | WVLLITAVVAAEKLMWGGEWIARITGSALVLLGVTVALRPDLVTALRSGHPM |
Ga0137415_111722251 | 3300028536 | Vadose Zone Soil | VLLIAVVVAAEKILPRGEWIARLAGVALVALGIAVAVRPELAVALRAARLSM |
Ga0307320_103306492 | 3300028771 | Soil | GGEWFARAAGGALLLLGATVALRPDLVMVLRGGHPM |
Ga0247825_111087481 | 3300028812 | Soil | AEKLLPRGEWIARLAGVALVLMGVAVAIRPGLAAVLRSGGHSM |
Ga0307308_103272161 | 3300028884 | Soil | LLPGGEWFARAAGGALLLLGATVALRPDLVMVLRGGHPM |
Ga0299907_104211292 | 3300030006 | Soil | LRWVLLITAVVAAEKLLPGGEWFAWTAGGVLLLLGVMVALRPDLVMVLRGGHAM |
Ga0299906_100601071 | 3300030606 | Soil | LIAVVVAAEKLLPRGERIARATGVALVLLGIAVALAPGLAASLRGGGHAM |
(restricted) Ga0255310_100031695 | 3300031197 | Sandy Soil | RWVLLITAVVAAEKLLPGGEWFARAAGGALLLLGVAVALRPDLVAVLRDGHAM |
Ga0318571_102641001 | 3300031549 | Soil | GLAWVLLIAAAVAAEKLLPRGEWIARTTGIALVILGIAVAVRPSFGVLLRAGNPM |
Ga0318515_100185132 | 3300031572 | Soil | MGLAWVLLITAVVAAEKLLPRGEWIARATGGAFLLLGVAVTLRPDLVTALRGGHAM |
Ga0318555_106350492 | 3300031640 | Soil | MGLAWVLLITAVVAAERLLPRGEWIARATGGVLLLLGVAVALRPDLVTTLRGGHAM |
Ga0318561_106735092 | 3300031679 | Soil | AVVAVEKLLPGGEWIARTTGVALMLLGVAVAVRPGLATALRAGTQAL |
Ga0318572_102037791 | 3300031681 | Soil | WVLLITAVVAAEKLLPRGEWIARATGGAFLLLGVAVTLRPDLVTALRGGHAM |
Ga0307469_104568412 | 3300031720 | Hardwood Forest Soil | KQLPGGEGFARAAGGALLLLGVTVALRPDLVMVLRGGHPM |
Ga0307469_119144932 | 3300031720 | Hardwood Forest Soil | IWVLLIAAVVAAEKLLPRGEWIARTTGIALVLLGIAVAIRPSLAGALRAGGHSM |
Ga0318493_103549111 | 3300031723 | Soil | MGLAWVLLITAVVAAEKLLPRGEWIARATGGVLLLLGVAVALRPDLVTTLRGGHAM |
Ga0307468_1002526413 | 3300031740 | Hardwood Forest Soil | KLLPRGEWIARTTGVALMLLGIAVAVRPGLATMLRTGAHPM |
Ga0318523_102530541 | 3300031798 | Soil | MGLAWVLLITAVVAAEKLLPRGEWIARATGGAFLLLGVAVALRPDLVTALR |
Ga0307410_102395393 | 3300031852 | Rhizosphere | VAGAMGLPWVLFIACIVAGEKLLPGGERIAWVTGVLLGLLGVAVALYPNLAVTLRATS |
Ga0310892_110959862 | 3300031858 | Soil | LLPGGEWFARAAGGALLLLGVTVAFRPDLVTVLRGGHAM |
Ga0310912_103019901 | 3300031941 | Soil | AVEKLLPGGEWIARTTGVALMLLGVAVAVRPGLATALRAGTQAL |
Ga0326597_110023231 | 3300031965 | Soil | VVAGEKLLPGGEWVARAAGGALVLLGLTVAVRPDLVTVLRGGHAM |
Ga0315278_115057021 | 3300031997 | Sediment | LPGGEWFARAAGGALLLLGVTVALRPDLVTVLRGGHTM |
Ga0307415_1012878651 | 3300032126 | Rhizosphere | KLLPRGEWIARLIGVMLMLLGGTVAVRPALVAALRGGAAM |
Ga0307471_1041711732 | 3300032180 | Hardwood Forest Soil | MGLAWVLLITALVAAEKLLPRGEWIARATGGAFLLLGVAVALRPDLVTALRGGHAM |
Ga0307472_1018837291 | 3300032205 | Hardwood Forest Soil | VLLIAAVVAAEKLLPRGEWIARATGGALLLLGVAVALRPAFVAALRAGHAM |
Ga0310810_102243851 | 3300033412 | Soil | VVVAAEKILPRGEWIARAAGIALVLLGVAVALRPGLALILRGVNATM |
Ga0326730_10801521 | 3300033500 | Peat Soil | AAEKLSPRGEWIARATGGAFLLLGMATALRPDLVTALRGGHAM |
Ga0247829_102751691 | 3300033550 | Soil | AAEKLLPGGEWIARATGGAFLLLGVAVALRPDLVTALRGGHAM |
Ga0364942_0081768_906_1040 | 3300034165 | Sediment | VAAEKLLPGGEWFARAAGAALLLLGVTVALRPDLVTVLRGGHAM |
Ga0364942_0134041_680_796 | 3300034165 | Sediment | MPGGEWIARIAGAALVLLGVTVALRPDLVAALRGAHAM |
Ga0364931_0227700_2_133 | 3300034176 | Sediment | AEKLLPRGEWIARTTGLALVLLGIAVAVRPGLAVALRAGGHSM |
Ga0364943_0306283_481_600 | 3300034354 | Sediment | LLPRGEWIARATGGAFLLLGVAVALRPDLVTVLRAGHVT |
Ga0314781_038843_1_165 | 3300034660 | Soil | IWVLLVAAMVAAEKVLPGGEWIARATGVALVVLGVAVAVRPALALTLRGVAPVM |
⦗Top⦘ |