| Basic Information | |
|---|---|
| Family ID | F031569 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 182 |
| Average Sequence Length | 45 residues |
| Representative Sequence | ENLLLVVSQGSGDLAVIRVRTNFLLTMIPVGDHPQDLAVKLF |
| Number of Associated Samples | 143 |
| Number of Associated Scaffolds | 182 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.55 % |
| % of genes near scaffold ends (potentially truncated) | 97.80 % |
| % of genes from short scaffolds (< 2000 bps) | 87.36 % |
| Associated GOLD sequencing projects | 130 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.57 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (97.802 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (29.670 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.923 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.253 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 31.43% Coil/Unstructured: 68.57% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.57 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 182 Family Scaffolds |
|---|---|---|
| PF03065 | Glyco_hydro_57 | 13.19 |
| PF02687 | FtsX | 4.40 |
| PF12704 | MacB_PCD | 2.75 |
| PF02896 | PEP-utilizers_C | 1.10 |
| PF01541 | GIY-YIG | 0.55 |
| PF02371 | Transposase_20 | 0.55 |
| PF05016 | ParE_toxin | 0.55 |
| PF14559 | TPR_19 | 0.55 |
| PF07494 | Reg_prop | 0.55 |
| PF01661 | Macro | 0.55 |
| PF02129 | Peptidase_S15 | 0.55 |
| PF02565 | RecO_C | 0.55 |
| PF02239 | Cytochrom_D1 | 0.55 |
| COG ID | Name | Functional Category | % Frequency in 182 Family Scaffolds |
|---|---|---|---|
| COG1381 | Recombinational DNA repair protein RecO (RecF pathway) | Replication, recombination and repair [L] | 0.55 |
| COG2110 | O-acetyl-ADP-ribose deacetylase (regulator of RNase III), contains Macro domain | Translation, ribosomal structure and biogenesis [J] | 0.55 |
| COG3292 | Periplasmic ligand-binding sensor domain | Signal transduction mechanisms [T] | 0.55 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.55 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.80 % |
| Unclassified | root | N/A | 2.20 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459024|GZRSKLJ02GMFP9 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10041245 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1221 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100553076 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1028 | Open in IMG/M |
| 3300002914|JGI25617J43924_10094871 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1071 | Open in IMG/M |
| 3300002914|JGI25617J43924_10263269 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 586 | Open in IMG/M |
| 3300004152|Ga0062386_100560300 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
| 3300005167|Ga0066672_10976067 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_58_21 | 519 | Open in IMG/M |
| 3300005171|Ga0066677_10353291 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 842 | Open in IMG/M |
| 3300005171|Ga0066677_10426703 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 758 | Open in IMG/M |
| 3300005180|Ga0066685_10021879 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3845 | Open in IMG/M |
| 3300005332|Ga0066388_103779159 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 773 | Open in IMG/M |
| 3300005332|Ga0066388_107656411 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
| 3300005537|Ga0070730_10055683 | All Organisms → cellular organisms → Bacteria | 2837 | Open in IMG/M |
| 3300005538|Ga0070731_10736482 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 655 | Open in IMG/M |
| 3300005553|Ga0066695_10415147 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 833 | Open in IMG/M |
| 3300005553|Ga0066695_10637925 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 633 | Open in IMG/M |
| 3300005553|Ga0066695_10907129 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300005559|Ga0066700_10543167 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 810 | Open in IMG/M |
| 3300005561|Ga0066699_10876629 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 627 | Open in IMG/M |
| 3300005569|Ga0066705_10425972 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 831 | Open in IMG/M |
| 3300005574|Ga0066694_10017618 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3118 | Open in IMG/M |
| 3300005586|Ga0066691_10803243 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 554 | Open in IMG/M |
| 3300005764|Ga0066903_100245081 | All Organisms → cellular organisms → Bacteria | 2755 | Open in IMG/M |
| 3300005877|Ga0075296_1029452 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
| 3300006031|Ga0066651_10814128 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_58_21 | 507 | Open in IMG/M |
| 3300006032|Ga0066696_10817729 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 594 | Open in IMG/M |
| 3300006102|Ga0075015_100308716 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 872 | Open in IMG/M |
| 3300006176|Ga0070765_100611153 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1028 | Open in IMG/M |
| 3300006176|Ga0070765_100885781 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 844 | Open in IMG/M |
| 3300006176|Ga0070765_101591203 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 614 | Open in IMG/M |
| 3300006354|Ga0075021_10710314 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 646 | Open in IMG/M |
| 3300006796|Ga0066665_11382661 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_58_21 | 544 | Open in IMG/M |
| 3300006806|Ga0079220_10922765 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 681 | Open in IMG/M |
| 3300006871|Ga0075434_101453176 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 695 | Open in IMG/M |
| 3300006893|Ga0073928_10220178 | All Organisms → cellular organisms → Bacteria | 1472 | Open in IMG/M |
| 3300006893|Ga0073928_10823324 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300007255|Ga0099791_10192803 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 959 | Open in IMG/M |
| 3300007265|Ga0099794_10227346 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 959 | Open in IMG/M |
| 3300007265|Ga0099794_10302686 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 828 | Open in IMG/M |
| 3300007788|Ga0099795_10430319 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 604 | Open in IMG/M |
| 3300009012|Ga0066710_100994443 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1294 | Open in IMG/M |
| 3300009012|Ga0066710_102065922 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 840 | Open in IMG/M |
| 3300009012|Ga0066710_102116062 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 826 | Open in IMG/M |
| 3300009038|Ga0099829_10049193 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3115 | Open in IMG/M |
| 3300009038|Ga0099829_10077623 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2533 | Open in IMG/M |
| 3300009038|Ga0099829_11807009 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_58_21 | 500 | Open in IMG/M |
| 3300009088|Ga0099830_10035194 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3423 | Open in IMG/M |
| 3300009444|Ga0114945_10690371 | Not Available | 622 | Open in IMG/M |
| 3300009792|Ga0126374_11890764 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
| 3300010159|Ga0099796_10584938 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_58_21 | 503 | Open in IMG/M |
| 3300010321|Ga0134067_10000081 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 11545 | Open in IMG/M |
| 3300010321|Ga0134067_10108166 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 958 | Open in IMG/M |
| 3300010358|Ga0126370_11939415 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 574 | Open in IMG/M |
| 3300010361|Ga0126378_10672914 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1147 | Open in IMG/M |
| 3300010366|Ga0126379_13583613 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
| 3300010376|Ga0126381_101417476 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1004 | Open in IMG/M |
| 3300010396|Ga0134126_11319668 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 799 | Open in IMG/M |
| 3300012189|Ga0137388_10245308 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1628 | Open in IMG/M |
| 3300012200|Ga0137382_10391784 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 978 | Open in IMG/M |
| 3300012202|Ga0137363_10345597 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1230 | Open in IMG/M |
| 3300012202|Ga0137363_10708086 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 852 | Open in IMG/M |
| 3300012203|Ga0137399_10066984 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2679 | Open in IMG/M |
| 3300012203|Ga0137399_11134548 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 658 | Open in IMG/M |
| 3300012207|Ga0137381_11194053 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 654 | Open in IMG/M |
| 3300012210|Ga0137378_10085146 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2886 | Open in IMG/M |
| 3300012211|Ga0137377_10536311 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1108 | Open in IMG/M |
| 3300012351|Ga0137386_11269093 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_58_21 | 512 | Open in IMG/M |
| 3300012356|Ga0137371_10240795 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1414 | Open in IMG/M |
| 3300012359|Ga0137385_11564486 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
| 3300012361|Ga0137360_10789841 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 817 | Open in IMG/M |
| 3300012362|Ga0137361_10824458 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 843 | Open in IMG/M |
| 3300012362|Ga0137361_11155381 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 696 | Open in IMG/M |
| 3300012363|Ga0137390_10710550 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 967 | Open in IMG/M |
| 3300012683|Ga0137398_10412388 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 920 | Open in IMG/M |
| 3300012683|Ga0137398_10660996 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 725 | Open in IMG/M |
| 3300012685|Ga0137397_11088939 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_58_21 | 583 | Open in IMG/M |
| 3300012918|Ga0137396_10975384 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_58_21 | 616 | Open in IMG/M |
| 3300012922|Ga0137394_10887043 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 745 | Open in IMG/M |
| 3300012923|Ga0137359_10210409 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1737 | Open in IMG/M |
| 3300012924|Ga0137413_10352457 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1045 | Open in IMG/M |
| 3300012924|Ga0137413_10933817 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_58_21 | 676 | Open in IMG/M |
| 3300012924|Ga0137413_11182702 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_58_21 | 609 | Open in IMG/M |
| 3300012925|Ga0137419_10735677 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 803 | Open in IMG/M |
| 3300012925|Ga0137419_11722186 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
| 3300012929|Ga0137404_10206321 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1667 | Open in IMG/M |
| 3300012931|Ga0153915_11172662 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 897 | Open in IMG/M |
| 3300012944|Ga0137410_10642918 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 880 | Open in IMG/M |
| 3300014157|Ga0134078_10018953 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2140 | Open in IMG/M |
| 3300015054|Ga0137420_1067030 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 986 | Open in IMG/M |
| 3300015054|Ga0137420_1353778 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1575 | Open in IMG/M |
| 3300015241|Ga0137418_10771790 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 725 | Open in IMG/M |
| 3300015245|Ga0137409_10611052 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 920 | Open in IMG/M |
| 3300015264|Ga0137403_11405687 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_58_21 | 546 | Open in IMG/M |
| 3300016319|Ga0182033_10857310 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 803 | Open in IMG/M |
| 3300016404|Ga0182037_10198590 | All Organisms → cellular organisms → Bacteria | 1554 | Open in IMG/M |
| 3300017942|Ga0187808_10424930 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 609 | Open in IMG/M |
| 3300017955|Ga0187817_10027727 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3414 | Open in IMG/M |
| 3300017955|Ga0187817_11122625 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
| 3300018006|Ga0187804_10001582 | All Organisms → cellular organisms → Bacteria | 6532 | Open in IMG/M |
| 3300018058|Ga0187766_10943740 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 611 | Open in IMG/M |
| 3300018482|Ga0066669_10065161 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2379 | Open in IMG/M |
| 3300019880|Ga0193712_1046718 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 943 | Open in IMG/M |
| 3300020006|Ga0193735_1185307 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_58_21 | 509 | Open in IMG/M |
| 3300020199|Ga0179592_10050490 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1892 | Open in IMG/M |
| 3300020580|Ga0210403_10534944 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 950 | Open in IMG/M |
| 3300020581|Ga0210399_10324940 | All Organisms → cellular organisms → Bacteria | 1284 | Open in IMG/M |
| 3300020581|Ga0210399_11506335 | Not Available | 522 | Open in IMG/M |
| 3300020583|Ga0210401_10140999 | All Organisms → cellular organisms → Bacteria | 2255 | Open in IMG/M |
| 3300020583|Ga0210401_10472163 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1117 | Open in IMG/M |
| 3300021086|Ga0179596_10147956 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1114 | Open in IMG/M |
| 3300021088|Ga0210404_10376428 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 791 | Open in IMG/M |
| 3300021088|Ga0210404_10743283 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 560 | Open in IMG/M |
| 3300021088|Ga0210404_10811152 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
| 3300021170|Ga0210400_10988526 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 684 | Open in IMG/M |
| 3300021178|Ga0210408_10176945 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1694 | Open in IMG/M |
| 3300021384|Ga0213876_10151469 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1233 | Open in IMG/M |
| 3300021406|Ga0210386_11575732 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 546 | Open in IMG/M |
| 3300021407|Ga0210383_10400313 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella sibirica | 1184 | Open in IMG/M |
| 3300021433|Ga0210391_11134168 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 607 | Open in IMG/M |
| 3300021474|Ga0210390_10378094 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1198 | Open in IMG/M |
| 3300021474|Ga0210390_10536850 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 984 | Open in IMG/M |
| 3300021475|Ga0210392_10098434 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1919 | Open in IMG/M |
| 3300021476|Ga0187846_10423910 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300021479|Ga0210410_11524192 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 561 | Open in IMG/M |
| 3300021560|Ga0126371_12890807 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 582 | Open in IMG/M |
| 3300021560|Ga0126371_13177750 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_58_21 | 556 | Open in IMG/M |
| 3300022557|Ga0212123_10104846 | All Organisms → cellular organisms → Bacteria | 2296 | Open in IMG/M |
| 3300022557|Ga0212123_10406480 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 911 | Open in IMG/M |
| 3300024227|Ga0228598_1104468 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
| 3300025905|Ga0207685_10854845 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_3_56_11 | 504 | Open in IMG/M |
| 3300026041|Ga0207639_10790875 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 884 | Open in IMG/M |
| 3300026317|Ga0209154_1051972 | All Organisms → cellular organisms → Bacteria | 1824 | Open in IMG/M |
| 3300026330|Ga0209473_1261274 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 590 | Open in IMG/M |
| 3300026523|Ga0209808_1001809 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 11053 | Open in IMG/M |
| 3300026536|Ga0209058_1191252 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 868 | Open in IMG/M |
| 3300026550|Ga0209474_10499728 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 616 | Open in IMG/M |
| 3300026551|Ga0209648_10073647 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2868 | Open in IMG/M |
| 3300026557|Ga0179587_10249565 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1135 | Open in IMG/M |
| 3300026557|Ga0179587_10626112 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 708 | Open in IMG/M |
| 3300027535|Ga0209734_1118455 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_58_21 | 509 | Open in IMG/M |
| 3300027587|Ga0209220_1139709 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300027651|Ga0209217_1067852 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1051 | Open in IMG/M |
| 3300027655|Ga0209388_1016925 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2015 | Open in IMG/M |
| 3300027655|Ga0209388_1144634 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 673 | Open in IMG/M |
| 3300027660|Ga0209736_1164608 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 585 | Open in IMG/M |
| 3300027663|Ga0208990_1141724 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 640 | Open in IMG/M |
| 3300027671|Ga0209588_1170138 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 685 | Open in IMG/M |
| 3300027829|Ga0209773_10359205 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 606 | Open in IMG/M |
| 3300027857|Ga0209166_10376518 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 739 | Open in IMG/M |
| 3300027869|Ga0209579_10124245 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1371 | Open in IMG/M |
| 3300027874|Ga0209465_10391933 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 695 | Open in IMG/M |
| 3300027882|Ga0209590_10380767 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 911 | Open in IMG/M |
| 3300027903|Ga0209488_10384235 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1041 | Open in IMG/M |
| 3300027903|Ga0209488_10966205 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 593 | Open in IMG/M |
| 3300027908|Ga0209006_10649217 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 868 | Open in IMG/M |
| 3300027911|Ga0209698_10964058 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 637 | Open in IMG/M |
| 3300028037|Ga0265349_1001031 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2796 | Open in IMG/M |
| 3300028906|Ga0308309_11117719 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 681 | Open in IMG/M |
| 3300031057|Ga0170834_103668350 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 786 | Open in IMG/M |
| 3300031231|Ga0170824_106663458 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1026 | Open in IMG/M |
| 3300031240|Ga0265320_10065960 | Not Available | 1717 | Open in IMG/M |
| 3300031572|Ga0318515_10189181 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1102 | Open in IMG/M |
| 3300031590|Ga0307483_1006808 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 930 | Open in IMG/M |
| 3300031682|Ga0318560_10256298 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 940 | Open in IMG/M |
| 3300031715|Ga0307476_10327125 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1126 | Open in IMG/M |
| 3300031715|Ga0307476_10455039 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 947 | Open in IMG/M |
| 3300031748|Ga0318492_10347233 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 776 | Open in IMG/M |
| 3300031754|Ga0307475_10183427 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1670 | Open in IMG/M |
| 3300031754|Ga0307475_11509652 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
| 3300031782|Ga0318552_10154273 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1154 | Open in IMG/M |
| 3300031794|Ga0318503_10268095 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 554 | Open in IMG/M |
| 3300031823|Ga0307478_10260474 | All Organisms → cellular organisms → Bacteria | 1412 | Open in IMG/M |
| 3300031823|Ga0307478_10835931 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 771 | Open in IMG/M |
| 3300031860|Ga0318495_10340257 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 665 | Open in IMG/M |
| 3300031962|Ga0307479_10136662 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2399 | Open in IMG/M |
| 3300031962|Ga0307479_11098746 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 762 | Open in IMG/M |
| 3300032076|Ga0306924_10573143 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1279 | Open in IMG/M |
| 3300032180|Ga0307471_100878325 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1064 | Open in IMG/M |
| 3300032180|Ga0307471_101838259 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 756 | Open in IMG/M |
| 3300032205|Ga0307472_100075350 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2220 | Open in IMG/M |
| 3300032261|Ga0306920_101293568 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1049 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 29.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 9.89% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.59% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.85% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.85% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.85% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.20% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 2.20% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.20% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.20% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.20% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.20% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.65% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.65% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.65% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.10% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.10% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.55% |
| Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 0.55% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.55% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.55% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.55% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.55% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.55% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.55% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.55% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.55% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.55% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.55% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.55% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.55% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459024 | Grass soil microbial communities from Rothamsted Park, UK - FD1 (NaCl 300g/L 5ml) | Environmental | Open in IMG/M |
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005877 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_404 | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009444 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019880 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a1 | Environmental | Open in IMG/M |
| 3300020006 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Host-Associated | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027535 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027663 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028037 | Soil microbial communities from Maridalen valley, Oslo, Norway - NSE1 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Host-Associated | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031590 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FD1_07467560 | 2170459024 | Grass Soil | LLLVVNKGSSDLSVIRARLGEQSLLTMIPVGDRPQELAVKLF |
| AF_2010_repII_A1DRAFT_100412452 | 3300000597 | Forest Soil | PNETLLLVASRASGDLAVIRVRTNFLVTMVPVGNKPQDLAVKLYGNK* |
| JGIcombinedJ26739_1005530762 | 3300002245 | Forest Soil | SLLLVVNQGSGDLAVIRISTDNPGLLTMIPVGDNPQELAIKLFK* |
| JGI25617J43924_100948711 | 3300002914 | Grasslands Soil | RFDPAENLLLVVSQGSGDLAVIRVRTNFLLTMIPVGDHPQGLAVKLF* |
| JGI25617J43924_102632692 | 3300002914 | Grasslands Soil | EENLLLVVSQGSGDLAVIRVRTNFLVTMIPVGEHPQELAVKLF* |
| Ga0062386_1005603004 | 3300004152 | Bog Forest Soil | LLAVNQASGDLAVIRISTENPGLLTMIPVGDSPRDLAVKLFQ* |
| Ga0066672_109760671 | 3300005167 | Soil | ENLLLVVSQGSGDLAVIRVRTNFLLTMIPVGDHPHELAVKLF* |
| Ga0066677_103532912 | 3300005171 | Soil | NLLLVVSQGSGDLAVIRVRTNFLLTMIPVGDHPQDLAVKLF* |
| Ga0066677_104267031 | 3300005171 | Soil | KGFPVPAGDAPAALRFDPAENLLLVVSQGSGDLAVIRVRTNFLLTLIPVGDHPQELAVKLF* |
| Ga0066685_100218793 | 3300005180 | Soil | SEALLLVVSQGSGDLAVIRVRTNFLVTMIPVGDRPQELAVKLYGNKEETK* |
| Ga0066388_1037791591 | 3300005332 | Tropical Forest Soil | GDAPGALRFDPDETLLLSVSQGSGNLAVIRVRTNFLVTMVPVGDRPQDLAVKLYGNKETTK* |
| Ga0066388_1076564112 | 3300005332 | Tropical Forest Soil | DDPTALAFDPNESLLLVVSQGSGDLAVVRVRTNSLVTMVPVGDRPQELAVKLYGKQEETK |
| Ga0070730_100556832 | 3300005537 | Surface Soil | VVNQGSGDVAVIRVRTNSLLTMIPVGEGPQDLAIKLF* |
| Ga0070731_107364822 | 3300005538 | Surface Soil | PEENLLLVVNKGSSDLSVIRARLGDQSLLTMIPVGDHPQELAVKLF* |
| Ga0066695_104151472 | 3300005553 | Soil | VNEDSGDLAVIRVGTNSLLTMIPVGDRPRDLAVKLF* |
| Ga0066695_106379251 | 3300005553 | Soil | VSHGSGDLAVIRVRTNFLVTMIPVGDHPQELAVKLF* |
| Ga0066695_109071292 | 3300005553 | Soil | ALRFDRSPNETLLLVVSQGSGDLAVIRVRTNFLVTMIPVGDRPQDLAVKLYGEKEGTK* |
| Ga0066700_105431672 | 3300005559 | Soil | LVVSHGSGDLAVIRVRTNFLVTMIPVGDHPQELAVKLF* |
| Ga0066699_108766291 | 3300005561 | Soil | VSQGSGDLAVIRVRTNFLVTMVPVGDRPQDLAVKLYGNKEVTR* |
| Ga0066705_104259722 | 3300005569 | Soil | RFDPAENLLLVVSQGSGDLAVIRVRTNFLLTMIPVGEHPQELAVKLF* |
| Ga0066694_100176181 | 3300005574 | Soil | ENLLLVVSQGSGDLAVIRVRTNFLLTMIPVGDHPQDLAVKLF* |
| Ga0066691_108032431 | 3300005586 | Soil | ENLLLVVSQGSGDLAVIRVRTNFLLTMIPVGDHPQELAVKLF* |
| Ga0066903_1002450811 | 3300005764 | Tropical Forest Soil | PAGDAPGALRFDPDETLLLSVSQGSGNLAVIRVRTNFLVTMVPVGDRPQDLAVKLYGNKETTK* |
| Ga0075296_10294521 | 3300005877 | Rice Paddy Soil | NEGSDDLAVIRVRTNSLLTLIPVGSHPRELAVKLF* |
| Ga0066651_108141281 | 3300006031 | Soil | RSPNETLLLVVSQGSGDLAVIRVRTNFLVTMIPVGDRPQDLAVKLYGEKEGTK* |
| Ga0066696_108177292 | 3300006032 | Soil | VSQGSGDLAVIRVRTNFLVTMVPVGARPQDLAVKLYGNK* |
| Ga0075015_1003087162 | 3300006102 | Watersheds | LRFDPEENLLLVVSAGSGDLAVIRVRTNFLVTMISVGSHPQDLAIKLY* |
| Ga0070765_1006111531 | 3300006176 | Soil | EENLLLVVNKGSSDLSVIRARLGDQSLLTMIPVGDHPQELAVKLF* |
| Ga0070765_1008857812 | 3300006176 | Soil | PDAIRFDPEENLLLVVNKGSSDLSVIRARLDDQSLLTMIPTGDHPQELAVKLF* |
| Ga0070765_1015912032 | 3300006176 | Soil | QSPGAIRFDPEENLLLVVNQGSGDLSVIRARLNNQSLLTMIPVGDHPQELAVKLF* |
| Ga0075021_107103141 | 3300006354 | Watersheds | ESLLLVVSAGSGDLAVIRVRTNFLVTMIPVGDHPQELAVKLF* |
| Ga0066665_113826612 | 3300006796 | Soil | SHGSGDLAVIRVRTNFLVTMIPVGDHPQELAVKLF* |
| Ga0079220_109227652 | 3300006806 | Agricultural Soil | GSGDLAVIRVRTNFLVTVISVGQSPKELAVKLYGNKESTK* |
| Ga0075434_1014531761 | 3300006871 | Populus Rhizosphere | VNHDSGDLAVIRARPDNQSLLTLIPVGEHPRDLAVKLF* |
| Ga0073928_102201781 | 3300006893 | Iron-Sulfur Acid Spring | ENLLLAVNHDSGDIAIICVRTNYLVTMIPVGDNPTDIAVKLF* |
| Ga0073928_108233241 | 3300006893 | Iron-Sulfur Acid Spring | NLLLAVNHDSGDIAIIRVRTNYLVTMIPVGDNPTDLAIKLF* |
| Ga0099791_101928033 | 3300007255 | Vadose Zone Soil | VVSQGSGDLAVIRVRTNFLLTMIPVGDHPQDLAVKLF* |
| Ga0099794_102273461 | 3300007265 | Vadose Zone Soil | TLRFDPAENLLLVVSAGSGDLAVIRVRTNFLLTMIPVGDHPQDLAVKLF* |
| Ga0099794_103026862 | 3300007265 | Vadose Zone Soil | PSLLLVVNQGSGDLAVIGLRAGSESLLTMIPVGPRPQELAVKLF* |
| Ga0099795_104303191 | 3300007788 | Vadose Zone Soil | SLLLVVNQGSGDIAVIRVRNEAQSLVTLISVGDHPEDLAVKLF* |
| Ga0066710_1009944431 | 3300009012 | Grasslands Soil | LVVSQGSGDLAVIRVRTNFLVTMIPVGDHPLDLAVKLF |
| Ga0066710_1020659222 | 3300009012 | Grasslands Soil | AGDAPAALRFDPAENLLLVVSEGSGDLAVIRVRTNFLLTMISVGSHPQGLAVKLF |
| Ga0066710_1021160621 | 3300009012 | Grasslands Soil | NENLLLVVSHGSGDLAVIRVRTNFLVTMIPVGDHPQELAVKLF |
| Ga0099829_100491933 | 3300009038 | Vadose Zone Soil | GDAPGALRFDPGSPETLLLVVSEGSGDLAIIRVRTNFLLTMIPVGNHPQELAVKLF* |
| Ga0099829_100776232 | 3300009038 | Vadose Zone Soil | FDPAENLLLVVSQGSGDLAVIRVRTNFLLTMIPVGDYPQDLAVKLF* |
| Ga0099829_118070091 | 3300009038 | Vadose Zone Soil | LVVSEGSGDLAVIRVRTNFLLTMIPVGNHPQELAVKLF* |
| Ga0099830_100351944 | 3300009088 | Vadose Zone Soil | ALRFDPAENLLLVVSQGSGDLAVIRVRTNFLLTMIPVGDHPQDLAVKLF* |
| Ga0114945_106903711 | 3300009444 | Thermal Springs | DLLLIVNEESDDDTVLRRRTNGLITMIPVGARPRDLAVKVF* |
| Ga0126374_118907641 | 3300009792 | Tropical Forest Soil | GALRFDPNETLLLVASRASGDLAVIRVRTNFLVTMVPVGDRPQDLAVKLYGNK* |
| Ga0099796_105849383 | 3300010159 | Vadose Zone Soil | LLVVSAGSGDLAVIRVRTNFLLTLIPVGDRPQDLAVKLY* |
| Ga0134067_100000817 | 3300010321 | Grasslands Soil | GSGDLAVIRVRTNFLVTMIPVGDRPQELAVKLYGNKEETK* |
| Ga0134067_101081661 | 3300010321 | Grasslands Soil | TLLLVVSQGSGDLAVIRVGTNFLVTMVPVGDRPQDLAVKLYGNK* |
| Ga0126370_119394152 | 3300010358 | Tropical Forest Soil | RFDPNETLLMVVSHGSGDLTVIRVRTNFLVTMIPVGQRPQELAVKLYGNKEGTK* |
| Ga0126378_106729141 | 3300010361 | Tropical Forest Soil | RASGDLAVIRVRTNFLVTMVPVGNKPQDLAVKLYGNK* |
| Ga0126379_135836132 | 3300010366 | Tropical Forest Soil | VVSHASGDLAVIRVRTNFLVTMIPVGERPEELAVKLYGKEGETK* |
| Ga0126381_1014174761 | 3300010376 | Tropical Forest Soil | VIRVRTNFLVTMVPVGDRPQDLAVKLYGNKETTK* |
| Ga0134126_113196682 | 3300010396 | Terrestrial Soil | VRFDPAENLLLVVNHDSGDLAVIRARPDNQSLLTLIPVGEHPRDLAVKLF* |
| Ga0137388_102453082 | 3300012189 | Vadose Zone Soil | LVVNQGSGDLAVIGLRAGSQSLLTMIPVGTKPQDLAVKLF* |
| Ga0137388_110102081 | 3300012189 | Vadose Zone Soil | FPIPAGRGPGVLRFDPSESLVMVVNQDSGDLGVIRVRTNSPLTLIPVGDHPRDLAVKMF* |
| Ga0137382_103917841 | 3300012200 | Vadose Zone Soil | FDRSPNETLLLVVSQGSGDLAVIRVRTNFLVTMIPVGDRPQDLAVKLYGEKEGTK* |
| Ga0137363_103455971 | 3300012202 | Vadose Zone Soil | LRFDPEENLLLVVSQGSGDLAVIRVRTNFLVTMIPVGDHPQELAVKLF* |
| Ga0137363_107080861 | 3300012202 | Vadose Zone Soil | APGALRFDPGSPETLLLVVSEGSGDLAVIRVRTNFLLTMIPVGNHPQELAVKLF* |
| Ga0137399_100669841 | 3300012203 | Vadose Zone Soil | DPAENLLLVVSAGSGDLAVIRVRTNFLLTMIPVGDHPQDLAVKLF* |
| Ga0137399_111345481 | 3300012203 | Vadose Zone Soil | VKPSLLLVVNEGSGDLAVIGLRGGSQSLLTMIPVGPRPRDLAVKLF* |
| Ga0137381_111940532 | 3300012207 | Vadose Zone Soil | AVIRVRTNFLVTMVPVGDKPQDLAVKLYGEKEVTK* |
| Ga0137378_100851462 | 3300012210 | Vadose Zone Soil | FDPAENLLLVVSQGSGDLAVIRVRTNFLLTMIPVGDHPQDLAVKLF* |
| Ga0137377_105363111 | 3300012211 | Vadose Zone Soil | DAPGALRFDPGSPETLLLVVSEGSGDLAVIRVRTNFLLTMIPVGNHPQELAVKLF* |
| Ga0137386_112690932 | 3300012351 | Vadose Zone Soil | LRFDPGSPETLLLVVSEGSGDLAVIRVRTNFLLTMIPVGNHPQGLAVKLF* |
| Ga0137371_102407952 | 3300012356 | Vadose Zone Soil | TLLLVVSQGSGDLAVIRVRTNFLVTMIPVGDHPLDLAVKLF* |
| Ga0137385_115644861 | 3300012359 | Vadose Zone Soil | PGKGFPIPAGDEPGALRFDPNETLLLVVSQGSGDLAVIRVRTNFLVTMVPVGARPQDLAVKLYGNK* |
| Ga0137360_107898412 | 3300012361 | Vadose Zone Soil | DPAENLLLVVSEGSGDLAVIRVRTNFLVTMIPVGSHPQDLAVKLF* |
| Ga0137361_108244582 | 3300012362 | Vadose Zone Soil | FDPAENLLLVVSQGSGDLAVIRVRTNFLLTMIPVGDHPQDLAIRLF* |
| Ga0137361_111553812 | 3300012362 | Vadose Zone Soil | PAVLRFDPAENLLLVVSQGSGDLAVIRVRTNFLLTMIPVGDHPQDLAVNLF* |
| Ga0137390_107105501 | 3300012363 | Vadose Zone Soil | IVNQGSGDLAVIRVLTNSLLTMIPVGDHPHDLAVKLF* |
| Ga0137398_104123882 | 3300012683 | Vadose Zone Soil | SGDLAVIGLRGGSQSLLTMIPVGPRPRDLAVKLF* |
| Ga0137398_106609961 | 3300012683 | Vadose Zone Soil | SEGSGDLAIIRVRTNFLLTMIPVGNHPQELAVKLF* |
| Ga0137397_110889392 | 3300012685 | Vadose Zone Soil | LLLVVSQGSGDLAVIRVRTNFLVTMIPVGDHPQELAVKLF* |
| Ga0137396_109753841 | 3300012918 | Vadose Zone Soil | LVVSEGSGDLAVIRVRTNFLLTMIPVGSHPQDLAVKLF* |
| Ga0137394_108870432 | 3300012922 | Vadose Zone Soil | LVVSQGSGDLAVIRVRTNFLVTMIPVGDHPQELAVKLF* |
| Ga0137359_102104091 | 3300012923 | Vadose Zone Soil | LLLVVSQGSGDLAVIRVRTNFLLTMIPVGDHPQELAVKLF* |
| Ga0137413_103524571 | 3300012924 | Vadose Zone Soil | AENLLLVVSAGSGDLAVIRVRTNFLLTMIPVGDHPKDLAVKLF* |
| Ga0137413_109338173 | 3300012924 | Vadose Zone Soil | KGFPVPSGDAPEVLRFDPAENLLLVVSAGSGDLAVIRVRTNFLLTLIPVGDRPQDLAVKLY* |
| Ga0137413_111827022 | 3300012924 | Vadose Zone Soil | LLLVVSAGSGDLAVIRVRTNFLLTMIPVGDHPQDLAVKLF* |
| Ga0137419_107356772 | 3300012925 | Vadose Zone Soil | NLLLVVSQGSGDLAVIRVRTNSLVTMIPVGDHPRELAVKLF* |
| Ga0137419_117221861 | 3300012925 | Vadose Zone Soil | VKPSLLLVVNEGSGDLAVIGLRGGSQSLLTMIAVGPRPRDLAVKLF* |
| Ga0137404_102063211 | 3300012929 | Vadose Zone Soil | PAENLLLVVSQGSGDLAVIRVRTNFLLTMIPVGDHPQELAVKLF* |
| Ga0153915_111726622 | 3300012931 | Freshwater Wetlands | ANEASDDLAVIRVRTNSLLTMIPVGNHPRELAVKLF* |
| Ga0137410_106429181 | 3300012944 | Vadose Zone Soil | PSLLLVVNEGSGDLAVIGLRGGSQSLLTMIPVGPRPRDLAVKLF* |
| Ga0134078_100189532 | 3300014157 | Grasslands Soil | LCFDPAENLLLVVSQGSGDLAVIRVRTNFLLTMIPVGDHPQDLAVKLF* |
| Ga0137420_10670301 | 3300015054 | Vadose Zone Soil | FDPVRFDPAENLLLVVSEGSGDLAIIRVRTNFLLTMIPVGNHPQELAVKLF* |
| Ga0137420_13537782 | 3300015054 | Vadose Zone Soil | ALRFDPAENLLLVVSEGSGDLAVIRVRTNFLLTLIPVGDHPQNLAVKLF* |
| Ga0137418_107717901 | 3300015241 | Vadose Zone Soil | VSVGSGDLTVIRVQTNFLLTMIPVGDHPQDLAVKLF* |
| Ga0137409_106110522 | 3300015245 | Vadose Zone Soil | LVVSQGSGDLVVIRVRTNFLVTMIPVGDHPQDLAVKLF* |
| Ga0137403_114056872 | 3300015264 | Vadose Zone Soil | FPVPAGDSPSALRFDPAENLLLVVSEGSGDLAVIRVRTNFLLTLIPVGDHPQDLAVKLF* |
| Ga0182033_108573102 | 3300016319 | Soil | LLVASRASGDLAVIRVRTNFLVTMVPVGDRPQDLAVKLYGNK |
| Ga0182037_101985901 | 3300016404 | Soil | IPAGDEPGALRFDPNETLLLVASRASGDLAVIRVRTNFLVTMVPVGDRPQDLAVKLYGNK |
| Ga0187808_104249301 | 3300017942 | Freshwater Sediment | HAPTVLRFDPSTPETLLLAVSQGSGNLAVVRVRTNFLVTMIPVGDHPQDLAVKLF |
| Ga0187817_100277273 | 3300017955 | Freshwater Sediment | GDSPTVLRFDPSTPETLLLAVSQGSGDLAVVRVRTNFLVTMIPVGDHPQDLAVKLF |
| Ga0187817_111226251 | 3300017955 | Freshwater Sediment | STPETLLLAVSQGSGNLAVVRVRTNFLVTMIPVGDHPQDLAVKLF |
| Ga0187804_100015825 | 3300018006 | Freshwater Sediment | LAVSQGSGNLAVVRVRTNFLVTMIPVGDHPQDLAVKLF |
| Ga0187766_109437402 | 3300018058 | Tropical Peatland | VGQGSGDLAVIRVSTNFLVTMIPVGDHPLELTVKLY |
| Ga0066669_100651612 | 3300018482 | Grasslands Soil | DPSEALLLVVSHGSGDLAVIRVRTNFLVTMIPVGDRPQELAVKLYGNKEETK |
| Ga0193712_10467182 | 3300019880 | Soil | NPSLLLAVNQGSGDLTVIRVRSDSQSLLTMIPVGDQPQDLVVKLF |
| Ga0193735_11853072 | 3300020006 | Soil | VWRFDPAENVLLVVSQGSGDLAVIRVRTNFLLTMIPVGDHPQDLAVNLF |
| Ga0179592_100504901 | 3300020199 | Vadose Zone Soil | IVVNEGSSDVAVIRVRTNSLLTMIPVGDRPQDLAVKLF |
| Ga0210403_105349442 | 3300020580 | Soil | RFDPAENLLLVVSQGSGDLAVIRVRTNFLVTMIPVGERPQDLAVKLF |
| Ga0210399_103249402 | 3300020581 | Soil | DPDEPNENLLVVVNEGSSDVAVIRVRTNSLLTMIPVGNKPQDLAVKLF |
| Ga0210399_115063351 | 3300020581 | Soil | LLLAVNHDSGDISIIRVRTNYLVTMIPVGDNPTDLAVKLF |
| Ga0210401_101409991 | 3300020583 | Soil | DPEENLLIAVNEASADVAVIRVRTNSLLTMIPVGAAPQDLAVKLF |
| Ga0210401_104721632 | 3300020583 | Soil | PAENLLLVVNRGSGDLSVIRARLENQSLLTMIPVGDHPQELAVKLF |
| Ga0179596_101479561 | 3300021086 | Vadose Zone Soil | FDPAENLLLVVSEGSGDLAIIRVRTNFLLTMIPVGNHPQELAVKLF |
| Ga0210404_103764281 | 3300021088 | Soil | FDPAENLLLIVSQGSGDLTVIRVRTNFLVTMIPVGDRPEELAVKLF |
| Ga0210404_107432831 | 3300021088 | Soil | GSGDLAVIGLRAGSESLLTMIPVGPRPQDLAVKLF |
| Ga0210404_108111521 | 3300021088 | Soil | FDPAENLLLVVNRGSGDLSVIRARLENQSLLTMIPVGDHPQELAVKLF |
| Ga0210400_109885261 | 3300021170 | Soil | LLLVIDPASGELVVIRVRTDSQSLVTMIPVGDHPQDLAVKLF |
| Ga0210408_101769452 | 3300021178 | Soil | LLLVVDPASGELVVIRVRTDSQSLVTMIPVGDHPQDLAVKLF |
| Ga0213876_101514692 | 3300021384 | Plant Roots | PDAIRFDPEENLLLVVNKGSSDLSVIRARLGDQSLLTMIPVGDRPQELAVKLF |
| Ga0210386_115757322 | 3300021406 | Soil | QGSGDLAVIGLRAGSQSLLTMIAVGAQPGDLAVKMF |
| Ga0210383_104003132 | 3300021407 | Soil | LIAVNEASADVAVIRVRTNSLLTMIPVGAAPKDLAVKLF |
| Ga0210391_111341681 | 3300021433 | Soil | VPDAIRFDPEENLLLVLNKGSNDLSVIRARLDDQSLLTMIPTGDHPQELAVKLF |
| Ga0210390_103780941 | 3300021474 | Soil | FDPDENLLIVVNQDSADVAVIRVRTNSMLTMIPVGNRPQDLAVKLF |
| Ga0210390_105368502 | 3300021474 | Soil | TPDAIRFDPEENLLLVVNKGSSDLSVIRARLDDQSLLTMIPTGDHPQELAVKLF |
| Ga0210392_100984341 | 3300021475 | Soil | IRFDPEENLLLVVNKGSSDLSVIRARLGEQSLLTMIPVGDQPEELAVKLF |
| Ga0187846_104239102 | 3300021476 | Biofilm | PEERLVIVANQGSGDIAVIRVATNSLLTMIPVGDKPQDLAVKLF |
| Ga0210410_115241921 | 3300021479 | Soil | PAENLLLVVSQGSGDLAVIRVRTNFLLTMIPVGVHPQELAVKLF |
| Ga0126371_128908072 | 3300021560 | Tropical Forest Soil | AVIRVRTNSLVTMVPVGDRPQELAVKLFGNREEMK |
| Ga0126371_131777502 | 3300021560 | Tropical Forest Soil | VADEGSGDVAVIRTRTNTLVTMIPAGDRPKDLAVKLF |
| Ga0212123_101048461 | 3300022557 | Iron-Sulfur Acid Spring | DPQENLLLAVNHDSGDIAIIRVRTNYLVTMIPVGDNPTDLAVKLF |
| Ga0212123_104064803 | 3300022557 | Iron-Sulfur Acid Spring | IVVNEASGDVAVIRVRTNSLLTMIPVGAAPQDLAVKLF |
| Ga0228598_11044681 | 3300024227 | Rhizosphere | TAGQSPGVLRFDPDEPNENLLIVVNEGSGDVAIIRVRTNSLLTLIPVGDKPQDLAVKLY |
| Ga0207685_108548451 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | LLLAVDHDSGDISIIRVRTNYLVTMIPVGPNPTDLAIKLF |
| Ga0207639_107908752 | 3300026041 | Corn Rhizosphere | RFDPAENLLLVVNHDSGDLAVIRARPDNQSLLTLIPVGEHPRDLAVKLF |
| Ga0209154_10519723 | 3300026317 | Soil | MVLAIPAGDMPGTLRFDPNETLLLVVSQGSGDLAVIRVGTNFLVTMVPVGDRPQDLAVKLYGNK |
| Ga0209473_12612741 | 3300026330 | Soil | RSRLIPTGDEPGALRFDPNETLLLVVSQGSGDLAVIRVRTNFLVTMVPVGARPQDLAVKLYGNK |
| Ga0209808_10018091 | 3300026523 | Soil | VVSQGSGDLAVIRVRTNFLVTMIPVGDRPQELAVKLYGNKEETK |
| Ga0209058_11912521 | 3300026536 | Soil | VVSEGSGDLAVIRVRTNFLLTMIPVGSHPQGLAVKLF |
| Ga0209474_104997281 | 3300026550 | Soil | VVSQGSGDLAVIRVRTNFLVTMVPVGARPQDLAVKLYGNK |
| Ga0209648_100736471 | 3300026551 | Grasslands Soil | DPAENLLLVVSQGSGHLAVIRVRTNFLLTMIPVGDYPQDLAVKLF |
| Ga0179587_102495652 | 3300026557 | Vadose Zone Soil | FDPAENLLLVVSQGSGDLAVIRVRTNFLLTMIPVGDHPQELAVKLF |
| Ga0179587_106261122 | 3300026557 | Vadose Zone Soil | SLLLVVNQGSGDLAVIGLRAGSESLLTMIPVGPRPQDLAVKLF |
| Ga0209734_11184552 | 3300027535 | Forest Soil | FEAAGPGENPSLLLVVDQGSGDLAVIRVQTDSQSLVTMIPVGDHPQDIAVKLF |
| Ga0209220_11397091 | 3300027587 | Forest Soil | VKPSLLLVVNQGSGDLAVIGLRAGSQSLLTMIPVGSRPQDLAIKLF |
| Ga0209217_10678521 | 3300027651 | Forest Soil | VDQGSGDLAFIRTRTNSLITMVPVGDQPRDLAVKLFQ |
| Ga0209388_10169251 | 3300027655 | Vadose Zone Soil | LLVVSQGSGDLAVIRVRTNFLVTMIPVGDHPQELAVKLF |
| Ga0209388_11446341 | 3300027655 | Vadose Zone Soil | PGSPETLLLVVSEGSGDLAVIRVRTNFLLTMIPVGNHPQELAVKLF |
| Ga0209736_11646081 | 3300027660 | Forest Soil | LLVVNQGSGDLAVIGLRAGSQSLLTMIPVGSQPQELAVKLF |
| Ga0208990_11417241 | 3300027663 | Forest Soil | NLLLVVSQGSGDLAVIRVRTNFLLTMIPVGEHPQELAVKLF |
| Ga0209588_11701382 | 3300027671 | Vadose Zone Soil | LLVVSQGSGDLAVIRVRTNSLVTMIPVGDHPQELAVKLF |
| Ga0209773_103592052 | 3300027829 | Bog Forest Soil | VGQSPDAIRFDPAENLLLVVNRGSGDLSVIRARLENQSLLTMIPVGDHPQELAVKLF |
| Ga0209166_103765181 | 3300027857 | Surface Soil | LLLVVNQGSGDLAVIRVRTNFLVTVIPVGQRPEGLAVKLYGNKEPAR |
| Ga0209579_101242452 | 3300027869 | Surface Soil | ADEGSGDVAVIRTRTNTLVTMIPAGEKPKDLAVKLF |
| Ga0209465_103919331 | 3300027874 | Tropical Forest Soil | GSGNLAVIRVRTNFLVTMVPVGDRPQDLAVKLYGNKETTK |
| Ga0209590_103807672 | 3300027882 | Vadose Zone Soil | LLVVSAGSGDLAVIRVRTNFLLTMIPVGDQPRELAVKLF |
| Ga0209488_103842351 | 3300027903 | Vadose Zone Soil | PAVLRFDPAENLLLVVSQGSGDLAVIRVRTNFLLTMIPVGDHPQDLAVNLF |
| Ga0209488_109662051 | 3300027903 | Vadose Zone Soil | AGDSPAVLRFDPAENLLLVVSQGSGDLAVIRVRTNFLLTMIPVGDHPQDLAVNLF |
| Ga0209006_106492172 | 3300027908 | Forest Soil | KGSSDLSVIRARLDDQSLLTMIPTGDHPQELAVKLF |
| Ga0209698_109640581 | 3300027911 | Watersheds | TLRFDPEESLLLAVNEGSGDLAVIRVRTNFLLTMIPLGVHPDGIAVKLFKQIR |
| Ga0265349_10010311 | 3300028037 | Soil | NEGSGDVAIIRVRTNSLLTMIPVGDKPQDLAVKLF |
| Ga0308309_111177191 | 3300028906 | Soil | VMRFDPEENLLIAVNEASADVAVIRVRTNSLLTMIPVGAAPKDLAVKLF |
| Ga0170834_1036683502 | 3300031057 | Forest Soil | ENLLVVVNEGSSDVAVIRVRTNSLLTMIPVGNKPQDLAVKLF |
| Ga0170824_1066634581 | 3300031231 | Forest Soil | AIRFDPEENLLLVVNKGSSDLSVIRARLGDQSLLTMIPVGERPQELAVKLF |
| Ga0265320_100659602 | 3300031240 | Rhizosphere | NLLIVVNEGSSNVAVIRVRTNSLLTMIPVGAAPKDLAVKLF |
| Ga0318515_101891811 | 3300031572 | Soil | VVSQGSGDLAVVRVRTNFLVTMVPVGTRPRDLAVKLYGNK |
| Ga0307483_10068081 | 3300031590 | Hardwood Forest Soil | ETLLLAVSQGSGDLAVVRVRTNFLVTMIPVGDHPQDLAVKLF |
| Ga0318560_102562981 | 3300031682 | Soil | PGALRFDPNETLLLVVSQGSGDLAVVRVRTNFLVTMVAVGTRPRDLAVKLYGNK |
| Ga0307476_103271251 | 3300031715 | Hardwood Forest Soil | NRGSGDLSVIRARLENQSLLTMIPVGDHPQELAVKLF |
| Ga0307476_104550392 | 3300031715 | Hardwood Forest Soil | VKPNLLLVVNQGSGDLSVIGLRAGSQSLLTMIPVGSQPGDLAVKMF |
| Ga0318492_103472331 | 3300031748 | Soil | PNETLLLVVSQGSGDLAVVRVRTNFLVTMVAVGTRPRDLAVKLYGNK |
| Ga0307475_101834271 | 3300031754 | Hardwood Forest Soil | LLLVVNEGSGDLAVIGLRAGSESLLTMIPVGPRPQDLAVKLF |
| Ga0307475_115096521 | 3300031754 | Hardwood Forest Soil | VNGGSGDLSVIGLRAGSQSLLTMIPVGPQPGDLAVKMF |
| Ga0318552_101542732 | 3300031782 | Soil | GDEPGALRFDPNETLLLVVSQGSGDLAVVRVRTNFLVTMVAVGTRPRDLAVKLYGNK |
| Ga0318503_102680952 | 3300031794 | Soil | ALRFDPNETLLLVVSQGSGDLAVVRVRTNFLVTMVAVGTRPRDLAVKLYGNK |
| Ga0307478_102604741 | 3300031823 | Hardwood Forest Soil | LVVCQGSNDVAVIRVRTNFLVTMVPVGARPQELAVKLYGDKEEAK |
| Ga0307478_108359311 | 3300031823 | Hardwood Forest Soil | PDVKPSLLLVVNQGSGDLAVIGLRAGSQSLLTMIPVGSQPQDLAVKLF |
| Ga0318495_103402571 | 3300031860 | Soil | PNETLLLVVSQGSGDLAVVRVRTNFLVTMVPVGTRPRDLAVKLYGNK |
| Ga0307479_101366621 | 3300031962 | Hardwood Forest Soil | FDPAENLLLVVSAGSGDLAVIRVRTNFLLTMIPVGDHPQDLAVKLF |
| Ga0307479_110987461 | 3300031962 | Hardwood Forest Soil | EPNENLLVVVNEGSSDVAVIRVRTNSLLTMIPVGNTPQDLAVKLF |
| Ga0306924_105731432 | 3300032076 | Soil | PAGDEPGALRFDPNETLLLVVSQGSGDLAVVRVRTNFLVTMVPVGTRPRDLAVKLYGNK |
| Ga0307471_1008783252 | 3300032180 | Hardwood Forest Soil | LRFDPAESLLLVVSQGSGDLAVIRVRTNFLVTMIPVGDHPQDLAVKLF |
| Ga0307471_1018382592 | 3300032180 | Hardwood Forest Soil | RFDPEENLLLVVSQGSGDLAVIRVRTNFLVTMIPVGDHPQDLAVKLF |
| Ga0307472_1000753502 | 3300032205 | Hardwood Forest Soil | LLVANQGSGDISVIRVRSDGQSLLTMIPVGDRPQDIAVKLF |
| Ga0306920_1012935681 | 3300032261 | Soil | VSQGSGDLAVVRVRTNFLVTMVAVGTRPRDLAVKLYGNK |
| ⦗Top⦘ |