Basic Information | |
---|---|
Family ID | F031565 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 182 |
Average Sequence Length | 40 residues |
Representative Sequence | PFVALVTAYVYFDARVREELETEREPEVLPAEIELST |
Number of Associated Samples | 164 |
Number of Associated Scaffolds | 182 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.56 % |
% of genes near scaffold ends (potentially truncated) | 92.86 % |
% of genes from short scaffolds (< 2000 bps) | 92.31 % |
Associated GOLD sequencing projects | 155 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.43 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (57.143 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (12.637 % of family members) |
Environment Ontology (ENVO) | Unclassified (27.473 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (38.462 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 27.69% β-sheet: 0.00% Coil/Unstructured: 72.31% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 182 Family Scaffolds |
---|---|---|
PF00005 | ABC_tran | 9.34 |
PF07992 | Pyr_redox_2 | 4.95 |
PF13673 | Acetyltransf_10 | 4.95 |
PF00903 | Glyoxalase | 2.75 |
PF03631 | Virul_fac_BrkB | 2.75 |
PF00999 | Na_H_Exchanger | 2.75 |
PF07883 | Cupin_2 | 2.75 |
PF00664 | ABC_membrane | 2.20 |
PF08448 | PAS_4 | 2.20 |
PF04545 | Sigma70_r4 | 2.20 |
PF01042 | Ribonuc_L-PSP | 1.65 |
PF01658 | Inos-1-P_synth | 1.65 |
PF10009 | DUF2252 | 1.10 |
PF02148 | zf-UBP | 1.10 |
PF03176 | MMPL | 1.10 |
PF00496 | SBP_bac_5 | 1.10 |
PF11950 | DUF3467 | 1.10 |
PF08933 | DUF1864 | 0.55 |
PF05175 | MTS | 0.55 |
PF00528 | BPD_transp_1 | 0.55 |
PF01261 | AP_endonuc_2 | 0.55 |
PF13607 | Succ_CoA_lig | 0.55 |
PF02800 | Gp_dh_C | 0.55 |
PF01345 | DUF11 | 0.55 |
PF13632 | Glyco_trans_2_3 | 0.55 |
PF00069 | Pkinase | 0.55 |
PF07690 | MFS_1 | 0.55 |
PF04402 | SIMPL | 0.55 |
PF00070 | Pyr_redox | 0.55 |
PF00094 | VWD | 0.55 |
PF04020 | Phage_holin_4_2 | 0.55 |
PF06271 | RDD | 0.55 |
PF01566 | Nramp | 0.55 |
PF14559 | TPR_19 | 0.55 |
PF05738 | Cna_B | 0.55 |
PF14079 | DUF4260 | 0.55 |
PF01546 | Peptidase_M20 | 0.55 |
PF00440 | TetR_N | 0.55 |
PF04075 | F420H2_quin_red | 0.55 |
PF00400 | WD40 | 0.55 |
PF12680 | SnoaL_2 | 0.55 |
PF04851 | ResIII | 0.55 |
PF13432 | TPR_16 | 0.55 |
PF00196 | GerE | 0.55 |
PF00989 | PAS | 0.55 |
PF12847 | Methyltransf_18 | 0.55 |
COG ID | Name | Functional Category | % Frequency in 182 Family Scaffolds |
---|---|---|---|
COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 2.75 |
COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 2.75 |
COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 2.75 |
COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 2.75 |
COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 2.75 |
COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 2.75 |
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 2.20 |
COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 1.65 |
COG1260 | Myo-inositol-1-phosphate synthase | Lipid transport and metabolism [I] | 1.65 |
COG5207 | Uncharacterized Zn-finger protein, UBP-type | General function prediction only [R] | 1.10 |
COG1033 | Predicted exporter protein, RND superfamily | General function prediction only [R] | 1.10 |
COG2409 | Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamily | General function prediction only [R] | 1.10 |
COG1914 | Mn2+ or Fe2+ transporter, NRAMP family | Inorganic ion transport and metabolism [P] | 0.55 |
COG3471 | Predicted secreted (periplasmic) protein | Function unknown [S] | 0.55 |
COG2968 | Uncharacterized conserved protein YggE, contains kinase-interacting SIMPL domain | Function unknown [S] | 0.55 |
COG2859 | Outer membrane channel-forming protein BP26/OMP28, SIMPL family | Cell wall/membrane/envelope biogenesis [M] | 0.55 |
COG1950 | Uncharacterized membrane protein YvlD, DUF360 family | Function unknown [S] | 0.55 |
COG1714 | Uncharacterized membrane protein YckC, RDD family | Function unknown [S] | 0.55 |
COG0057 | Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase | Carbohydrate transport and metabolism [G] | 0.55 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 57.14 % |
Unclassified | root | N/A | 42.86 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2070309009|GPKNP_GG3DY5401EHW6N | Not Available | 500 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_105824476 | Not Available | 1112 | Open in IMG/M |
3300000858|JGI10213J12805_10169042 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 657 | Open in IMG/M |
3300000956|JGI10216J12902_109425964 | All Organisms → cellular organisms → Bacteria | 1147 | Open in IMG/M |
3300000956|JGI10216J12902_110599463 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
3300000956|JGI10216J12902_116727368 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 728 | Open in IMG/M |
3300000956|JGI10216J12902_119023328 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 645 | Open in IMG/M |
3300001686|C688J18823_11047061 | Not Available | 517 | Open in IMG/M |
3300003987|Ga0055471_10245807 | Not Available | 567 | Open in IMG/M |
3300003996|Ga0055467_10158935 | Not Available | 680 | Open in IMG/M |
3300004156|Ga0062589_101690032 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 631 | Open in IMG/M |
3300004463|Ga0063356_101487965 | All Organisms → cellular organisms → Bacteria | 1002 | Open in IMG/M |
3300004643|Ga0062591_100593432 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 977 | Open in IMG/M |
3300005045|Ga0071328_156069 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 4248 | Open in IMG/M |
3300005093|Ga0062594_101153320 | Not Available | 763 | Open in IMG/M |
3300005159|Ga0066808_1028213 | Not Available | 576 | Open in IMG/M |
3300005166|Ga0066674_10023636 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2677 | Open in IMG/M |
3300005168|Ga0066809_10223086 | Not Available | 517 | Open in IMG/M |
3300005332|Ga0066388_104482136 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 711 | Open in IMG/M |
3300005332|Ga0066388_106777075 | Not Available | 577 | Open in IMG/M |
3300005335|Ga0070666_11447242 | Not Available | 514 | Open in IMG/M |
3300005347|Ga0070668_102192080 | Not Available | 510 | Open in IMG/M |
3300005353|Ga0070669_100988589 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
3300005365|Ga0070688_101476917 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 553 | Open in IMG/M |
3300005434|Ga0070709_10752733 | Not Available | 761 | Open in IMG/M |
3300005436|Ga0070713_101212889 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 730 | Open in IMG/M |
3300005437|Ga0070710_10349215 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 979 | Open in IMG/M |
3300005437|Ga0070710_11363330 | Not Available | 529 | Open in IMG/M |
3300005440|Ga0070705_100511046 | All Organisms → cellular organisms → Bacteria | 914 | Open in IMG/M |
3300005441|Ga0070700_100283296 | Not Available | 1202 | Open in IMG/M |
3300005535|Ga0070684_101094985 | Not Available | 749 | Open in IMG/M |
3300005543|Ga0070672_101860702 | Not Available | 541 | Open in IMG/M |
3300005556|Ga0066707_10653374 | Not Available | 665 | Open in IMG/M |
3300005718|Ga0068866_11343441 | Not Available | 521 | Open in IMG/M |
3300005719|Ga0068861_102081115 | Not Available | 567 | Open in IMG/M |
3300005764|Ga0066903_101306589 | Not Available | 1355 | Open in IMG/M |
3300005841|Ga0068863_100480738 | Not Available | 1221 | Open in IMG/M |
3300006051|Ga0075364_11039892 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 556 | Open in IMG/M |
3300006177|Ga0075362_10480435 | Not Available | 634 | Open in IMG/M |
3300006573|Ga0074055_11646025 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1266 | Open in IMG/M |
3300006579|Ga0074054_11330395 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 616 | Open in IMG/M |
3300006581|Ga0074048_10119920 | All Organisms → cellular organisms → Bacteria | 1742 | Open in IMG/M |
3300006581|Ga0074048_13205623 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1275 | Open in IMG/M |
3300006845|Ga0075421_102600658 | Not Available | 525 | Open in IMG/M |
3300006846|Ga0075430_100813073 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 770 | Open in IMG/M |
3300006847|Ga0075431_101825110 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 564 | Open in IMG/M |
3300006854|Ga0075425_102486002 | Not Available | 574 | Open in IMG/M |
3300006881|Ga0068865_100745690 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
3300006904|Ga0075424_102007489 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 610 | Open in IMG/M |
3300006953|Ga0074063_10004008 | Not Available | 1208 | Open in IMG/M |
3300006954|Ga0079219_10373727 | Not Available | 929 | Open in IMG/M |
3300009098|Ga0105245_12086410 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 620 | Open in IMG/M |
3300009098|Ga0105245_12388931 | Not Available | 582 | Open in IMG/M |
3300009100|Ga0075418_10605594 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1179 | Open in IMG/M |
3300009101|Ga0105247_11629756 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 531 | Open in IMG/M |
3300009146|Ga0105091_10460129 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 641 | Open in IMG/M |
3300009168|Ga0105104_10410389 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 754 | Open in IMG/M |
3300009176|Ga0105242_10363340 | All Organisms → cellular organisms → Bacteria | 1340 | Open in IMG/M |
3300009176|Ga0105242_12278844 | Not Available | 588 | Open in IMG/M |
3300009177|Ga0105248_10168628 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2468 | Open in IMG/M |
3300009177|Ga0105248_12212708 | Not Available | 626 | Open in IMG/M |
3300009840|Ga0126313_11887162 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 501 | Open in IMG/M |
3300010037|Ga0126304_10976780 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 577 | Open in IMG/M |
3300010044|Ga0126310_11502891 | Not Available | 553 | Open in IMG/M |
3300010047|Ga0126382_10981840 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 738 | Open in IMG/M |
3300010359|Ga0126376_12614918 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 553 | Open in IMG/M |
3300010373|Ga0134128_11136734 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 862 | Open in IMG/M |
3300010397|Ga0134124_12481515 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 560 | Open in IMG/M |
3300010398|Ga0126383_11545793 | Not Available | 753 | Open in IMG/M |
3300010399|Ga0134127_13558226 | Not Available | 511 | Open in IMG/M |
3300011000|Ga0138513_100074735 | Not Available | 524 | Open in IMG/M |
3300012212|Ga0150985_121764298 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
3300012900|Ga0157292_10354786 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 543 | Open in IMG/M |
3300012911|Ga0157301_10013911 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1662 | Open in IMG/M |
3300012960|Ga0164301_10973104 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 665 | Open in IMG/M |
3300012985|Ga0164308_11867763 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
3300012985|Ga0164308_11929469 | Not Available | 551 | Open in IMG/M |
3300012987|Ga0164307_11572415 | Not Available | 556 | Open in IMG/M |
3300013296|Ga0157374_11493386 | Not Available | 699 | Open in IMG/M |
3300013307|Ga0157372_12598612 | Not Available | 581 | Open in IMG/M |
3300014301|Ga0075323_1174983 | Not Available | 506 | Open in IMG/M |
3300014304|Ga0075340_1143692 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 520 | Open in IMG/M |
3300014326|Ga0157380_10377402 | All Organisms → cellular organisms → Bacteria | 1337 | Open in IMG/M |
3300014745|Ga0157377_10199470 | All Organisms → cellular organisms → Bacteria | 1269 | Open in IMG/M |
3300015200|Ga0173480_10980761 | Not Available | 555 | Open in IMG/M |
3300015371|Ga0132258_10240563 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Cellulomonadaceae → Cellulomonas → Cellulomonas chitinilytica | 4417 | Open in IMG/M |
3300015371|Ga0132258_12381373 | Not Available | 1326 | Open in IMG/M |
3300015373|Ga0132257_100094227 | All Organisms → cellular organisms → Bacteria | 3436 | Open in IMG/M |
3300015373|Ga0132257_102191904 | Not Available | 715 | Open in IMG/M |
3300015374|Ga0132255_102024795 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 877 | Open in IMG/M |
3300017944|Ga0187786_10644361 | Not Available | 503 | Open in IMG/M |
3300017965|Ga0190266_10054601 | All Organisms → cellular organisms → Bacteria | 1433 | Open in IMG/M |
3300018027|Ga0184605_10099301 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1283 | Open in IMG/M |
3300018032|Ga0187788_10273560 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Miltoncostaeales → Miltoncostaeaceae → Miltoncostaea → Miltoncostaea oceani | 676 | Open in IMG/M |
3300018051|Ga0184620_10200162 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 663 | Open in IMG/M |
3300018054|Ga0184621_10363916 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 508 | Open in IMG/M |
3300018073|Ga0184624_10523778 | Not Available | 513 | Open in IMG/M |
3300018074|Ga0184640_10487889 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_68_9 | 544 | Open in IMG/M |
3300018076|Ga0184609_10400626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 638 | Open in IMG/M |
3300018079|Ga0184627_10420399 | Not Available | 695 | Open in IMG/M |
3300018422|Ga0190265_12973344 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 566 | Open in IMG/M |
3300018432|Ga0190275_11280201 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 809 | Open in IMG/M |
3300018466|Ga0190268_11424415 | Not Available | 596 | Open in IMG/M |
3300018469|Ga0190270_12141955 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 619 | Open in IMG/M |
3300018476|Ga0190274_11989866 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
3300018481|Ga0190271_10384070 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1494 | Open in IMG/M |
3300018920|Ga0190273_12037339 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 533 | Open in IMG/M |
3300019259|Ga0184646_1336916 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 501 | Open in IMG/M |
3300019787|Ga0182031_1342147 | All Organisms → cellular organisms → Bacteria | 2495 | Open in IMG/M |
3300019884|Ga0193741_1023969 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1571 | Open in IMG/M |
3300020020|Ga0193738_1133256 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 683 | Open in IMG/M |
3300020066|Ga0180108_1172032 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 569 | Open in IMG/M |
3300020195|Ga0163150_10136033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1444 | Open in IMG/M |
3300021081|Ga0210379_10540985 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300022756|Ga0222622_10668875 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 753 | Open in IMG/M |
3300022756|Ga0222622_10985448 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 619 | Open in IMG/M |
3300022892|Ga0247753_1037093 | Not Available | 596 | Open in IMG/M |
3300022894|Ga0247778_1244896 | Not Available | 509 | Open in IMG/M |
3300022910|Ga0247768_1111850 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
3300023263|Ga0247800_1070253 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 670 | Open in IMG/M |
3300024055|Ga0247794_10009945 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2186 | Open in IMG/M |
3300024186|Ga0247688_1014142 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1137 | Open in IMG/M |
3300024279|Ga0247692_1035528 | Not Available | 766 | Open in IMG/M |
3300025898|Ga0207692_10131426 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1414 | Open in IMG/M |
3300025898|Ga0207692_10353796 | Not Available | 906 | Open in IMG/M |
3300025907|Ga0207645_10095697 | Not Available | 1912 | Open in IMG/M |
3300025920|Ga0207649_10326882 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1128 | Open in IMG/M |
3300025923|Ga0207681_10859175 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
3300025927|Ga0207687_10438939 | Not Available | 1081 | Open in IMG/M |
3300025928|Ga0207700_10634301 | Not Available | 952 | Open in IMG/M |
3300025937|Ga0207669_11484094 | All Organisms → cellular organisms → Bacteria → FCB group | 578 | Open in IMG/M |
3300025939|Ga0207665_11203306 | Not Available | 604 | Open in IMG/M |
3300025961|Ga0207712_11202321 | Not Available | 676 | Open in IMG/M |
3300026067|Ga0207678_11421289 | Not Available | 613 | Open in IMG/M |
3300026075|Ga0207708_10331029 | Not Available | 1245 | Open in IMG/M |
3300026095|Ga0207676_10368804 | Not Available | 1333 | Open in IMG/M |
3300026827|Ga0207591_100665 | Not Available | 1099 | Open in IMG/M |
3300027277|Ga0209846_1054495 | Not Available | 611 | Open in IMG/M |
3300027577|Ga0209874_1119381 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
3300027636|Ga0214469_1020123 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2248 | Open in IMG/M |
3300027647|Ga0214468_1023977 | Not Available | 1652 | Open in IMG/M |
3300027821|Ga0209811_10345741 | Not Available | 575 | Open in IMG/M |
3300027907|Ga0207428_10149122 | All Organisms → cellular organisms → Bacteria | 1781 | Open in IMG/M |
3300027907|Ga0207428_11153616 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium RBG_16_68_12 | 540 | Open in IMG/M |
3300027952|Ga0209889_1014544 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces hainanensis | 1862 | Open in IMG/M |
3300027993|Ga0247749_1030105 | Not Available | 614 | Open in IMG/M |
3300028379|Ga0268266_10773302 | All Organisms → cellular organisms → Bacteria | 927 | Open in IMG/M |
3300028590|Ga0247823_10615357 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
3300028719|Ga0307301_10275866 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces acidiscabies | 550 | Open in IMG/M |
3300028722|Ga0307319_10294950 | Not Available | 536 | Open in IMG/M |
3300028755|Ga0307316_10031151 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1742 | Open in IMG/M |
3300028803|Ga0307281_10171718 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 769 | Open in IMG/M |
3300028872|Ga0307314_10216886 | Not Available | 582 | Open in IMG/M |
3300030336|Ga0247826_11276185 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 591 | Open in IMG/M |
3300030336|Ga0247826_11556728 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 537 | Open in IMG/M |
3300030943|Ga0311366_11609133 | Not Available | 556 | Open in IMG/M |
3300031228|Ga0299914_11322921 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 570 | Open in IMG/M |
3300031562|Ga0310886_10163343 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1184 | Open in IMG/M |
3300031740|Ga0307468_100365484 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1084 | Open in IMG/M |
3300031834|Ga0315290_10146863 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2026 | Open in IMG/M |
3300031834|Ga0315290_11604358 | Not Available | 525 | Open in IMG/M |
3300031873|Ga0315297_10298620 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1342 | Open in IMG/M |
3300031908|Ga0310900_11945387 | Not Available | 502 | Open in IMG/M |
3300032003|Ga0310897_10473385 | Not Available | 604 | Open in IMG/M |
3300032013|Ga0310906_11355684 | Not Available | 521 | Open in IMG/M |
3300032126|Ga0307415_102424916 | Not Available | 516 | Open in IMG/M |
3300032157|Ga0315912_11464855 | Not Available | 538 | Open in IMG/M |
3300032164|Ga0315283_12268309 | Not Available | 532 | Open in IMG/M |
3300032211|Ga0310896_10508693 | Not Available | 661 | Open in IMG/M |
3300032256|Ga0315271_11399172 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
3300032256|Ga0315271_11443220 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 593 | Open in IMG/M |
3300032516|Ga0315273_11080593 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 1020 | Open in IMG/M |
3300032893|Ga0335069_11302459 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 790 | Open in IMG/M |
3300033417|Ga0214471_10472992 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus hoagii | 1005 | Open in IMG/M |
3300034128|Ga0370490_0309347 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 525 | Open in IMG/M |
3300034150|Ga0364933_122159 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 666 | Open in IMG/M |
3300034151|Ga0364935_0226204 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 606 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 12.64% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.59% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.49% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.95% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.40% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 3.85% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.85% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.85% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.75% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.75% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.75% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.20% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.20% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 2.20% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.20% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.65% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.65% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.65% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.65% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.65% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.65% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.65% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.65% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.10% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.10% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.10% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.10% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.10% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.10% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 1.10% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.10% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.10% |
Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 1.10% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.10% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.10% |
Freshwater Microbial Mat | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat | 0.55% |
Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.55% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.55% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.55% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.55% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.55% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.55% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.55% |
Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.55% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.55% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.55% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.55% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.55% |
Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.55% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.55% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.55% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.55% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.55% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.55% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.55% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2070309009 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000858 | Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
3300003987 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2 | Environmental | Open in IMG/M |
3300003996 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2 | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300005045 | Permafrost microbial communities from Fox Tunnel, Fairbanks, Alaska, USA | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005159 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPB | Environmental | Open in IMG/M |
3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
3300005168 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006051 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Host-Associated | Open in IMG/M |
3300006177 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Host-Associated | Open in IMG/M |
3300006573 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006579 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006581 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009146 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300011000 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t6i015 | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012900 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S179-409R-1 | Environmental | Open in IMG/M |
3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300014301 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D1 | Environmental | Open in IMG/M |
3300014304 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D1 | Environmental | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
3300014965 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T2 | Environmental | Open in IMG/M |
3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
3300019259 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019787 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
3300019884 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s2 | Environmental | Open in IMG/M |
3300020020 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a1 | Environmental | Open in IMG/M |
3300020066 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT45_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300020195 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.P2.IB | Environmental | Open in IMG/M |
3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300022892 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S169-409R-5 | Environmental | Open in IMG/M |
3300022894 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L049-202B-5 | Environmental | Open in IMG/M |
3300022910 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L016-104C-6 | Environmental | Open in IMG/M |
3300023263 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S092-311B-6 | Environmental | Open in IMG/M |
3300024055 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6 | Environmental | Open in IMG/M |
3300024186 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK29 | Environmental | Open in IMG/M |
3300024279 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK33 | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026827 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G09A4-11 (SPAdes) | Environmental | Open in IMG/M |
3300027277 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 (SPAdes) | Environmental | Open in IMG/M |
3300027577 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 (SPAdes) | Environmental | Open in IMG/M |
3300027636 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 HiSeq | Environmental | Open in IMG/M |
3300027647 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 HiSeq | Environmental | Open in IMG/M |
3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027952 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 (SPAdes) | Environmental | Open in IMG/M |
3300027993 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S199-509C-5 | Environmental | Open in IMG/M |
3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300028590 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day30 | Environmental | Open in IMG/M |
3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
3300028803 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120 | Environmental | Open in IMG/M |
3300028872 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204 | Environmental | Open in IMG/M |
3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
3300030943 | III_Fen_N2 coassembly | Environmental | Open in IMG/M |
3300031228 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 | Environmental | Open in IMG/M |
3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
3300032157 | Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil | Environmental | Open in IMG/M |
3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
3300032256 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top | Environmental | Open in IMG/M |
3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300033417 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155 | Environmental | Open in IMG/M |
3300034128 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_06D_16 | Environmental | Open in IMG/M |
3300034150 | Sediment microbial communities from East River floodplain, Colorado, United States - 25_j17 | Environmental | Open in IMG/M |
3300034151 | Sediment microbial communities from East River floodplain, Colorado, United States - 2_s17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
GPKNP_00938100 | 2070309009 | Soil | VALVTSYVYFDARVREKLEPRDVRRELPAETSLRPA |
INPhiseqgaiiFebDRAFT_1058244762 | 3300000364 | Soil | VVYAVTMPFVALTTAYVYFDARARGELATDREPAELPAEIGLPA* |
JGI10213J12805_101690421 | 3300000858 | Soil | YALAMPFVALVAAYVYFDARARTELETEQRPDVLPAEIELSAR* |
JGI10216J12902_1094259641 | 3300000956 | Soil | LPFVALVTSYVYFDARTRHELEPRETVDELPAEIALES* |
JGI10216J12902_1105994632 | 3300000956 | Soil | VALVTCYVYFDARVREELEPADVRRELPAEISIRPT* |
JGI10216J12902_1167273681 | 3300000956 | Soil | LPFVALVTSYVYFDARTRHELEPAERPDQLPAEIALDS* |
JGI10216J12902_1190233281 | 3300000956 | Soil | VYALAMPFVALTTSYAYLDARVREELEPEPEAAMLPAEIALRG* |
C688J18823_110470612 | 3300001686 | Soil | MPFVALTTAYVYFDARVRRELAGECAALELPAEIELSRP* |
Ga0055471_102458071 | 3300003987 | Natural And Restored Wetlands | GVFYALAMPFVALVTSYVYFDARARHELAEETVSELPAEFELAT* |
Ga0055467_101589351 | 3300003996 | Natural And Restored Wetlands | LALAMPFVALATSYVYFDARTRAELDAIDEPCELPAEIALAP* |
Ga0062589_1016900321 | 3300004156 | Soil | SMPFVALVTAYVYFDARSRFELEPVERVSELPAEIAVETA* |
Ga0063356_1014879652 | 3300004463 | Arabidopsis Thaliana Rhizosphere | PFVALTTAYVYFDARVRSELEPVDRHQVLPAEIELPHPATP* |
Ga0062591_1005934321 | 3300004643 | Soil | IVYSLAMPFVALVTTYVYFDARTRQELPEPAHEPDVLPAEIAI* |
Ga0071328_1560695 | 3300005045 | Permafrost | VYALALPFIALVTAYVYFDARVRDELEPEPQTDVLPAEIQLSA* |
Ga0062594_1011533202 | 3300005093 | Soil | AMPFVALTTSYAYFDVRVRDELEREQAPAILPAEIALTS* |
Ga0066808_10282132 | 3300005159 | Soil | ALAMPFVALVTAYVYFDARVRKELETEQVPEVLPAEIELELST* |
Ga0066674_100236364 | 3300005166 | Soil | VVYALAMPFVALTTTYAYFDARVRHELADDVRPGVLPAEIELSV* |
Ga0066809_102230861 | 3300005168 | Soil | TMPFVALTTAYVYFDMRTRDELAPELESGELPAEINLSG* |
Ga0066388_1044821362 | 3300005332 | Tropical Forest Soil | AMPFVALTTAYAYFDARVRGELAGERASAELPAEIGLSA* |
Ga0066388_1067770751 | 3300005332 | Tropical Forest Soil | GVVYALAMPFVALVTAYVYFDARTRAELPREREPETLPAEIELST* |
Ga0070666_114472422 | 3300005335 | Switchgrass Rhizosphere | NVVSGVIYAVTMPFVAVTSVYVYFDARVSLELEGEREEVVLPAEITLAP* |
Ga0070668_1021920801 | 3300005347 | Switchgrass Rhizosphere | AMPFIALVTTYLYFDARVRQELPTESEPDVLPAEIVVSTS* |
Ga0070669_1009885892 | 3300005353 | Switchgrass Rhizosphere | ALPFVALVTAYVYFDARARLELEPRDVRTELPAEVAIEPV* |
Ga0070688_1014769171 | 3300005365 | Switchgrass Rhizosphere | MPFVALTTAYVYFDRRTRLELEPERESHPSELPAEIQLTS* |
Ga0070709_107527331 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | VSGVIYAVTMPFVAVTSVYVYFDARVSLELEGEREEVVLPAEITLAP* |
Ga0070713_1012128892 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | LVAGVVYAVTMPFLALVTSYAYFDARVRVELEGERDPSVRPAEIALA* |
Ga0070710_103492151 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | TMPFVALTTAYVYVDARVGDAQRPPPAPAELPAQAELWAG* |
Ga0070710_113633301 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | VTMPYVALTTAYVYFDARVRTELAGEGAPAQLPAEISLSG* |
Ga0070705_1005110462 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | ALPFVALVTAYVYFDARTRLELEPRDVRTELPAEVAIEPV* |
Ga0070700_1002832961 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | IALPFVALVTAYVYFDARARLELEPRDVRTELPAEVAIEPV* |
Ga0070684_1010949852 | 3300005535 | Corn Rhizosphere | GVVYVVAMPFIALTTAYLYFDARAREEVADEVEPAELPAEYGLSA* |
Ga0070672_1018607021 | 3300005543 | Miscanthus Rhizosphere | AIALPFVALVTAYVYFDARTRLELEPRDVRTELPAEVAIEPV* |
Ga0066707_106533742 | 3300005556 | Soil | IAGVVYAVTMPFVALTTAYVYFDARVRNELVDERDAAELPAEIGLSV* |
Ga0068866_113434411 | 3300005718 | Miscanthus Rhizosphere | LPFVALVTAYVYFDARARLELEPRDVRTELPAEVAIEPA* |
Ga0068861_1020811151 | 3300005719 | Switchgrass Rhizosphere | AMPFVALTTAYAYFDARTRRELEGESESSALPAEIELSPATEG* |
Ga0066903_1013065891 | 3300005764 | Tropical Forest Soil | MPFVALTTAYVYFDARVRVELAPDRESVELPAEIGLSA* |
Ga0068863_1004807381 | 3300005841 | Switchgrass Rhizosphere | FVALVTAYVYFDARARLELEPRDVRTELPAEVAIEPA* |
Ga0070717_107544952 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VTMPFVALTTAYVYFDMRVRDELAAEAGPDRLPPEIGLGGAFATGRSAP* |
Ga0075364_110398921 | 3300006051 | Populus Endosphere | VVYALTMPFVALVTAYMYFDARTQHELEPADEPDELPAEIEVRPAT* |
Ga0075362_104804352 | 3300006177 | Populus Endosphere | PFVALVTTYVYVDARARGELEPTTEPGPLPAEIRLAGR* |
Ga0074055_116460251 | 3300006573 | Soil | PFVALVTAYVYFDARARMELERVERPSELPAEIQLEPS* |
Ga0074054_113303951 | 3300006579 | Soil | YAVTMPFVALTTAYVYFDARTRGELGAESEHVVLPAEIELSA* |
Ga0074048_101199203 | 3300006581 | Soil | AMPFVALVTSYVYFDARTRVELEAVERPDVLPAEIQLAG* |
Ga0074048_132056231 | 3300006581 | Soil | PFVALVTAYVYFDARVREELETEREPEVLPAEIELST* |
Ga0075421_1026006582 | 3300006845 | Populus Rhizosphere | PFVAITTAYVYFDARTRDELAAELEPAELPAEIGFSV* |
Ga0075430_1008130732 | 3300006846 | Populus Rhizosphere | MPFVAIATTYVYFDARVRAELEPDEAPVNLPAEIEIA* |
Ga0075431_1018251101 | 3300006847 | Populus Rhizosphere | AVAMPFVALTTSYVYFDSRARVQLEPRDDPAELPAEIKLSTS* |
Ga0075425_1024860021 | 3300006854 | Populus Rhizosphere | VALATAYAYFDARVRVELEGEHHPTELPAEIGLSA* |
Ga0068865_1007456901 | 3300006881 | Miscanthus Rhizosphere | FVALVTAYVYFDARARIELEPRDVRTELPAEVAIEPI* |
Ga0075424_1020074891 | 3300006904 | Populus Rhizosphere | IAGLIYAVAMPFVALTTAYVYFDARVRYELAGEQEPAELPAEIALG* |
Ga0074063_100040081 | 3300006953 | Soil | AMPLVAVTTAYVYFDRRVDEELEGESKPDVLPAEIGLSS* |
Ga0079219_103737272 | 3300006954 | Agricultural Soil | VTMPFVAVTTVYVYFDARVRTELEVEHDEVVLPAEITLAP* |
Ga0075435_1017118531 | 3300007076 | Populus Rhizosphere | LAMPFVALTTAYLYFDARARHEVADETEPTELPAEYGLSV* |
Ga0111539_103690191 | 3300009094 | Populus Rhizosphere | TAYAYFDARARGELEADSGLAELPAEFELSVPMR* |
Ga0105245_120864102 | 3300009098 | Miscanthus Rhizosphere | PFVALTSSYVYFDARVREELEHEEAPPALPAEIALG* |
Ga0105245_123889311 | 3300009098 | Miscanthus Rhizosphere | ALVTAYVYFDARARLELEPRDVRTELPAEVAIEPA* |
Ga0075418_106055943 | 3300009100 | Populus Rhizosphere | ALTMPFVALVTAYMYFDARTQHELEPADEPDELPAEIEVRPAT* |
Ga0105247_116297562 | 3300009101 | Switchgrass Rhizosphere | LVTGAPFWLVNVISGVIYAVTMPFVAVTSLYVYFDARASYELEDEQEGVVLPAEIAL* |
Ga0105091_104601291 | 3300009146 | Freshwater Sediment | TMPFVALVTAYVYFDARTRHELEPADEPGELPAEIEVRPAT* |
Ga0105104_104103892 | 3300009168 | Freshwater Sediment | VYAAAMPFVALTTTYVYFDARTRHELEPEEESDELPAELGTLTA* |
Ga0105241_106497002 | 3300009174 | Corn Rhizosphere | AMPFVALTTAYAYFDARARGELEADSGLAELPAEFELSVPMR* |
Ga0105242_103633401 | 3300009176 | Miscanthus Rhizosphere | VYALAMPFIALVTTYPYFDARARQELPTASEPAVLPAEIVISTS* |
Ga0105242_122788442 | 3300009176 | Miscanthus Rhizosphere | PFVALTTAYVYFDARVRQELASEHEVAELPAEIQLSG* |
Ga0105248_101686283 | 3300009177 | Switchgrass Rhizosphere | LVTAYVYFDARARLELEPRDARTELPAEISVEPV* |
Ga0105248_122127081 | 3300009177 | Switchgrass Rhizosphere | MPFVALTTAYVYFDTRARQELVDERSAAELPAEIELGASSG* |
Ga0126313_118871623 | 3300009840 | Serpentine Soil | NAVTMPFVALTTAYVYFDARARVELEPVDQAAELPAEFQLSG* |
Ga0126304_109767803 | 3300010037 | Serpentine Soil | ALTTAYVYFDARARVELEPVDQAAELPAEFQLSG* |
Ga0126310_115028912 | 3300010044 | Serpentine Soil | AGVVYAVTMPFVALTTAYVYFDARVRTELEGDRQPVELPGEIELSA* |
Ga0126382_109818402 | 3300010047 | Tropical Forest Soil | VYALAMPFVALVTAYVYFDGRARVELEPREQVAELPAEIALEA* |
Ga0126376_126149182 | 3300010359 | Tropical Forest Soil | LSMPFVALVTAYVYFDCRTRLELEPHEEVAELPAEIALEA* |
Ga0134128_111367341 | 3300010373 | Terrestrial Soil | LAMPFVALTATFVYFDVRARAELEPRETPTELPAEIELSRA* |
Ga0134124_124815151 | 3300010397 | Terrestrial Soil | LVTAYVYFDARARFELEPVERVDELPSEIALDGV* |
Ga0126383_115457931 | 3300010398 | Tropical Forest Soil | TGAPFWLVNVISGFIYAVTMPFVAVTTVYVYFDARVSHELEPEHREVVLPAEVTLAP* |
Ga0134127_135582262 | 3300010399 | Terrestrial Soil | VPIVALVTAYVYFDARTRGELESAQPSELPAEIELAAPGAL* |
Ga0138513_1000747352 | 3300011000 | Soil | AMPFVALVTMYVYFDMRVRDELALEGDSGPLPAEVEFSA* |
Ga0150985_1217642981 | 3300012212 | Avena Fatua Rhizosphere | PFVAIVTAYVYFDARTRGELEPVQPAELPAEIELSPS* |
Ga0157292_103547862 | 3300012900 | Soil | PFVALVTAYVYFDARARFELEPVERVDELPSEIALDSA* |
Ga0157301_100139115 | 3300012911 | Soil | AGIVYALAMPFVALVTTFLYFDARVRQELPAEGDPDELPAEIAI* |
Ga0164301_109731043 | 3300012960 | Soil | ALVTAYVYSDARTRCELEPVQPSELPAEIELTTA* |
Ga0164308_118677631 | 3300012985 | Soil | ALVTAYVYFDGRARFELEPRERVSELPAEIALGGVGQASSASSG* |
Ga0164308_119294692 | 3300012985 | Soil | LVTAYVYFDARARLELEPRDVRTELPAEVAIEPV* |
Ga0164307_115724151 | 3300012987 | Soil | VTMPFLALTTTYVYFDLRVRNELAPANEPDELPAEIGLPA* |
Ga0157374_114933862 | 3300013296 | Miscanthus Rhizosphere | PFVALTTAYVYFDARARQELVDERSPAELPAEIELGASSG* |
Ga0157372_125986122 | 3300013307 | Corn Rhizosphere | ALAMPFIALVTTYLYFDARVRQELPTESEPDVLPAEIVVSTS* |
Ga0075323_11749831 | 3300014301 | Natural And Restored Wetlands | AISLPFVALVTAYVYFDARARLELEPRDVRSELPAEVSIEPV* |
Ga0075340_11436922 | 3300014304 | Natural And Restored Wetlands | PYVALVTTYVYADAATRRQLDTADEPSHLPAEIELRRSSA* |
Ga0157380_103774023 | 3300014326 | Switchgrass Rhizosphere | FVALTTAYVYFDARARVELEPAEEPDQLPAEFQLSG* |
Ga0157377_101994701 | 3300014745 | Miscanthus Rhizosphere | MPFVALTTAYVYFDRRTRSELEPERESHPSELPAEIQLSG* |
Ga0120193_100071381 | 3300014965 | Terrestrial | QVMPFVALLSSYLYFDARVREQLDPVEEPHELPAEIELEGA* |
Ga0173480_109807612 | 3300015200 | Soil | FVALTTAYVYFDRRTRLELEPERESHPSELPAEIQLTG* |
Ga0132258_102405632 | 3300015371 | Arabidopsis Rhizosphere | AIVTAYVYFDARTRVELEPAEEPGELPAEIELGPA* |
Ga0132258_123813733 | 3300015371 | Arabidopsis Rhizosphere | VVALTAAYVYFDARVRTELVDDASPDRLPAEISLSGRA* |
Ga0132257_1000942274 | 3300015373 | Arabidopsis Rhizosphere | MPFVALVTGYTYFDTRARHELEPVTRVTELPAEISLEQL* |
Ga0132257_1021919042 | 3300015373 | Arabidopsis Rhizosphere | ALTTAYVYFDARTRGELAGESELAALPAEIDLSA* |
Ga0132255_1020247951 | 3300015374 | Arabidopsis Rhizosphere | FVALTTTYVYFDARTRHELEPEEEPDELPAELGTLTA* |
Ga0187786_106443612 | 3300017944 | Tropical Peatland | MPFVALVTAHVYFDGRTRVELVPGEQVSELPAEISVSS |
Ga0190266_100546011 | 3300017965 | Soil | VALVTSYVYFDARARHELEWEEAPEELPAELVLPPS |
Ga0184605_100993011 | 3300018027 | Groundwater Sediment | GVVNAVTIPFVALTTAYVYFDARARFELEPADDADELPAEFQLSG |
Ga0187788_102735602 | 3300018032 | Tropical Peatland | MPFVALTTSYVYFDTRTRIDRPAVHEPETLPAEIELAT |
Ga0184620_102001622 | 3300018051 | Groundwater Sediment | LAGIVYALAMPFVALVTTFLYFDARVRQELPAEDDPDELPAEIAI |
Ga0184621_103639162 | 3300018054 | Groundwater Sediment | ALPFVALTTCYVYFDARTRRELEAADEPRELPAEIQI |
Ga0184624_105237782 | 3300018073 | Groundwater Sediment | PFVALTTVYVYFDTVVRERLEGDSAPDELPAEIPLPAGS |
Ga0184640_104878891 | 3300018074 | Groundwater Sediment | AVTMPFVALTTAYVYSDVRVRHALEPEDAPAELPAEIEFAH |
Ga0184609_104006261 | 3300018076 | Groundwater Sediment | YALAMPFVALVTTFLYFAARVRQELPAEGDPDELPAEIAI |
Ga0184627_104203991 | 3300018079 | Groundwater Sediment | VAIATTFVYFDTRVRDELAPEHEPGELPAEIQLSA |
Ga0190265_129733441 | 3300018422 | Soil | ALAMPFVALTTAYVYFDARVRNELEPELERDELPAEIQLSG |
Ga0190275_112802011 | 3300018432 | Soil | LAMPYVALVTSYVYFDSRARLELEPVERVSELPAEIQLTTAG |
Ga0190268_114244152 | 3300018466 | Soil | VALVTSYVYFDARTRHELEPAERPDQLPAEIALES |
Ga0190270_121419552 | 3300018469 | Soil | ALAMPFVALTTAYVYFDRRTRLELEPERESHPSELPAEIRLTS |
Ga0190274_119898661 | 3300018476 | Soil | AVALPFVALVTSYVYFDARTRHELEPAERPDELPAELALES |
Ga0190271_103840701 | 3300018481 | Soil | ALLMPFVALVTSYVYFDARARVELEPVERVSELPAEFELAR |
Ga0190273_120373392 | 3300018920 | Soil | LAMPFVALVTSYVYFDSRARVELEPVERVSELPAEIQLTTAG |
Ga0184646_13369162 | 3300019259 | Groundwater Sediment | YAVVMPFVALTTVYLYFDMRVRDELAPEPDSDRLPAEIDFSA |
Ga0182031_13421473 | 3300019787 | Bog | MPFVALTTMYVYFDTRVRDERQRESAPVELPAQIEVSPGH |
Ga0193741_10239691 | 3300019884 | Soil | FVGLVTAYAYFDARARLELEPAERPAELPAEISLEMP |
Ga0193738_11332562 | 3300020020 | Soil | FVALVTSYVYFDARTREELEPFQRVSELPAEIQLTTTG |
Ga0180108_11720322 | 3300020066 | Groundwater Sediment | VALATTYVYFDTRVRDELAPEHEPNELPAEIQVSG |
Ga0163150_101360331 | 3300020195 | Freshwater Microbial Mat | ALVTAYVYFDARACGELEPADERKELPAEIELGASS |
Ga0210379_105409851 | 3300021081 | Groundwater Sediment | FVAIATTYVYFDTRVREELASVPASDELPAEIQLSV |
Ga0222622_106688751 | 3300022756 | Groundwater Sediment | VYALAMPFVALVTTYLYFDARVRQELPAEGDPDELPAEIAI |
Ga0222622_109854481 | 3300022756 | Groundwater Sediment | YAAALPFVALVTAYVYFDARTHVELEPAVEQGELPAEIELSRA |
Ga0247753_10370932 | 3300022892 | Soil | VVYAVTMPIVALATAYAYFDARVRVELEGEHHPVELPAEIGLSA |
Ga0247778_12448962 | 3300022894 | Plant Litter | ALVTAYVYFDARTRGELEPVQPSELPAEIELQASS |
Ga0247768_11118502 | 3300022910 | Plant Litter | YAIALPFVALVTAYVYFDARTRLELEPRDVRTELPAEVAIEPV |
Ga0247800_10702531 | 3300023263 | Soil | ALVTAYVYFDARARFELEPVERVDQLPSEIALDGV |
Ga0247794_100099451 | 3300024055 | Soil | AGIVYALAMPFVALVTTFLYFDARVRQELPAEGDPDELPAEIAI |
Ga0247688_10141423 | 3300024186 | Soil | GIVIYAVTMPFVAVTSVYVYFDARVSFELEGEREEVVLPAEITLAP |
Ga0247692_10355281 | 3300024279 | Soil | IYAVTMPFVAVTSVYVYFDARVSFELEGEREEVVLPAEITLAP |
Ga0207692_101314261 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | FVAVTSVYVYFDARVSFELEGEREEVVLPAEITLAP |
Ga0207692_103537961 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | VTMPYVALTTAYVYFDARVRTELAGEGAPAQLPAEISLSG |
Ga0207645_100956972 | 3300025907 | Miscanthus Rhizosphere | VVYALAMPFVALVTAYVYFDARARFELEPVERVDELPSEIALDGV |
Ga0207649_103268821 | 3300025920 | Corn Rhizosphere | VIYALAMPFVALVTAYVYFDARARFELEPVERIDELPSEIALDGV |
Ga0207681_108591751 | 3300025923 | Switchgrass Rhizosphere | LPFVALVTAYVYFDARTRLELEPREDVDELPAEIALDPA |
Ga0207687_104389391 | 3300025927 | Miscanthus Rhizosphere | AMPFVALTTAYAYFDARTRRELEGESESSALPAEIELSPATEG |
Ga0207700_106343011 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | AVTMPFVAVTSVYVYFDARVSLELEGEHEEVVLPAEITLAP |
Ga0207669_114840942 | 3300025937 | Miscanthus Rhizosphere | VALTTAYVYFDARVRAELAGEGTPARLPAEINLSARGA |
Ga0207665_112033061 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | LDLVSGVVYAVTMPFVALTTAYVYFDMRTRDELAIGHEPGELPAEIPLST |
Ga0207712_112023211 | 3300025961 | Switchgrass Rhizosphere | ALPFVALVTAYVYFDARTRGELESAQPSELPAEIELAAPGAL |
Ga0207678_114212892 | 3300026067 | Corn Rhizosphere | GVVCAVAMPFVALTTAYDYFDARARGELEADSGLAELPAEFELSVPMR |
Ga0207708_103310291 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | ALPFVALVTAYVYFDARTRLELEPRDVRTELPAEVAIEPV |
Ga0207676_103688041 | 3300026095 | Switchgrass Rhizosphere | FVALVTAYVYFDARARLELEPRDVRTELPAEVAIEPA |
Ga0207591_1006651 | 3300026827 | Soil | YAVTMPIVALATAYAYFDARVRVELEGEHHPVELPAEIGLSA |
Ga0209846_10544951 | 3300027277 | Groundwater Sand | TMPFVALTTAYVYFDTRVRDELASEPDPDELPAEIELST |
Ga0209874_11193812 | 3300027577 | Groundwater Sand | YVVAMPFVAITTAYVYFDTRARDELESERETAELPAEI |
Ga0214469_10201235 | 3300027636 | Soil | VTMPFVALTTAYLYFDARTRDELAPEQDPDELPAEIELARAATTRT |
Ga0214468_10239771 | 3300027647 | Soil | PFVALTTSYVYFDARTRAELDAIDEPGELPAEIALAP |
Ga0209811_103457411 | 3300027821 | Surface Soil | MPFVALTTAYVYFDARTRLELEPADEPDRLPAEIQLNPS |
Ga0207428_101491221 | 3300027907 | Populus Rhizosphere | ALVTSYVYFDARARHELEWEEAPEELPAEFVLRPS |
Ga0207428_111536161 | 3300027907 | Populus Rhizosphere | GIVYALAMPFVALVTTYLYFDARVRQELPGESDPDELPAEIAI |
Ga0209889_10145442 | 3300027952 | Groundwater Sand | ALTMPFVALTTAYVYFDTRVRDELASEPDPDELPAEIELST |
Ga0247749_10301052 | 3300027993 | Soil | PFVALVTCYVYFDARVREELEPADVRRELPAEISIRPT |
Ga0268266_107733021 | 3300028379 | Switchgrass Rhizosphere | LPFVALVTAYVYFDARTRLELEPRDVRTELPAEVAIEPI |
Ga0247823_106153571 | 3300028590 | Soil | ALPFVALVTAYVYFDARARLELEPRDVRTELPAEVAIEPA |
Ga0307301_102758662 | 3300028719 | Soil | LVTGYVYFDARARVELEPVEHLSELPAEIQLQPTL |
Ga0307319_102949501 | 3300028722 | Soil | VALTTAYVYFDARVRTELAGEGAPARLPAEISFSA |
Ga0307316_100311515 | 3300028755 | Soil | VYALAMPFVALVTTFLYFDARVRQELPAEDDPDELPAEIAI |
Ga0307281_101717181 | 3300028803 | Soil | VYALAMPFVALVTAYVYFDARVREELETEQVPEVLPAEIELST |
Ga0307314_102168862 | 3300028872 | Soil | AVAMPLVALVTAYVYFDARTRGELEAESELTELPAEIELSA |
Ga0247826_112761851 | 3300030336 | Soil | MPFVALVTSYVYFDSRARLELEPIERVSELPAEIELAR |
Ga0247826_115567282 | 3300030336 | Soil | YTMPFVALVTSYVYFDARARLELEPVEHVSELPAEIQLTTAG |
Ga0311366_116091332 | 3300030943 | Fen | LLPFVALVTSYVYVDARVHGELEPADTPSDLPAEIDLGRA |
Ga0299914_113229213 | 3300031228 | Soil | IPFVALVTAYVYFDARTRAELAPRTPDELPAEIELRTG |
Ga0310886_101633431 | 3300031562 | Soil | VNVVSGVIYAVTMPFVAVTSVYVYFDARVSLELEGEREEVVLPAEITLAP |
Ga0307468_1003654841 | 3300031740 | Hardwood Forest Soil | FVGLVTAYVYFDARTRVELEPVVDERELPAEIELSRA |
Ga0315290_101468631 | 3300031834 | Sediment | VYALALPYVALVTSYVYFDARTRGELDPADDRRELPAEIELRPS |
Ga0315290_116043582 | 3300031834 | Sediment | ALVTSYVYFDARARGELEPADDRRELPAEIELRPS |
Ga0315297_102986203 | 3300031873 | Sediment | YALALPYVALVTSYVYFDARTRGELEPVERPSQLPAEIELRPS |
Ga0310900_119453871 | 3300031908 | Soil | FIALVTTYLYFDARVRQELPAESEPDVLPAEIVISTS |
Ga0310897_104733851 | 3300032003 | Soil | VYSLALPFVALVTSYVYFDARARHELEWEEAPEELPAEFALRPS |
Ga0310906_113556841 | 3300032013 | Soil | MPFVALTTAYVYFDARARVELEPAEEPDQLQAEFQLSG |
Ga0307415_1024249161 | 3300032126 | Rhizosphere | ALAMPFVALTTAYVYFDARVRTELEGEHPAQLPAELELSA |
Ga0315912_114648551 | 3300032157 | Soil | AMPFVALVTAYVYFDARVRVEVAEEVPDELPAEIELGEA |
Ga0315283_122683091 | 3300032164 | Sediment | VVYALALPYVALVTSYVYFDARTRGELEPTERPSQLPAEIELRPS |
Ga0310896_105086931 | 3300032211 | Soil | VYAVAMPFVALPTAYAYFDARARGELEADSGLAELPAEFELSVPMR |
Ga0315271_113991721 | 3300032256 | Sediment | YALALPYVALVTSYVYFDARARGELEPADERRELPAEIELRPS |
Ga0315271_114432201 | 3300032256 | Sediment | FVALVTSYVYFDARARGELEPADDRRELPAEIELVPPAV |
Ga0315273_110805931 | 3300032516 | Sediment | ALPYVALVTSYVYFDARTRGELEPVERPSQLPAEIELRPS |
Ga0335069_113024591 | 3300032893 | Soil | FVALATTYVYFDMRVRDELAREHGPEQLPAEIEFSG |
Ga0214471_104729921 | 3300033417 | Soil | FVALVTSYVYFDARSRVELEPFEKVSELPAEIELAPSA |
Ga0370490_0309347_3_116 | 3300034128 | Untreated Peat Soil | PYVALVTSYVYFDARTRGELEPADGRSVLPAEIELQP |
Ga0364933_122159_13_123 | 3300034150 | Sediment | LPFVALTTCYVYFDARTRRELEAADEPRELPAEIQL |
Ga0364935_0226204_17_133 | 3300034151 | Sediment | MPYVAIVASYVYFDSRARLELEPFERVSELPAEIELAR |
⦗Top⦘ |