| Basic Information | |
|---|---|
| Family ID | F031469 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 182 |
| Average Sequence Length | 38 residues |
| Representative Sequence | MFKKIKQKLCELVCKVFGITQCLCNHECNCKKEKK |
| Number of Associated Samples | 96 |
| Number of Associated Scaffolds | 182 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 35.16 % |
| % of genes near scaffold ends (potentially truncated) | 25.82 % |
| % of genes from short scaffolds (< 2000 bps) | 40.11 % |
| Associated GOLD sequencing projects | 74 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (55.495 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (45.604 % of family members) |
| Environment Ontology (ENVO) | Unclassified (54.945 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (59.341 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 25.40% β-sheet: 0.00% Coil/Unstructured: 74.60% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 182 Family Scaffolds |
|---|---|---|
| PF00166 | Cpn10 | 30.22 |
| PF11351 | GTA_holin_3TM | 4.40 |
| PF08291 | Peptidase_M15_3 | 3.85 |
| PF03237 | Terminase_6N | 3.85 |
| PF13578 | Methyltransf_24 | 1.10 |
| PF00961 | LAGLIDADG_1 | 0.55 |
| PF10518 | TAT_signal | 0.55 |
| PF13759 | 2OG-FeII_Oxy_5 | 0.55 |
| PF16861 | Carbam_trans_C | 0.55 |
| COG ID | Name | Functional Category | % Frequency in 182 Family Scaffolds |
|---|---|---|---|
| COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 30.22 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 55.49 % |
| All Organisms | root | All Organisms | 42.86 % |
| unclassified Hyphomonas | no rank | unclassified Hyphomonas | 1.65 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 45.60% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 8.79% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 6.04% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 5.49% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 4.40% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment | 3.85% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 3.30% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 3.30% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment | 3.30% |
| Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 2.75% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.20% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 1.65% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 1.10% |
| Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 1.10% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 1.10% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water And Sediment | 1.10% |
| Meromictic Pond | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond | 1.10% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 0.55% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.55% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 0.55% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 0.55% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.55% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 0.55% |
| Marine Methane Seep Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Methane Seep Sediment | 0.55% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300001748 | Saline surface water microbial communities from Etoliko Lagoon, Greece - surface water (0 m) | Environmental | Open in IMG/M |
| 3300001752 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-1-36_30 | Environmental | Open in IMG/M |
| 3300001855 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 | Environmental | Open in IMG/M |
| 3300002052 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-1-36_30 | Environmental | Open in IMG/M |
| 3300005512 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline_water | Environmental | Open in IMG/M |
| 3300005611 | Saline surface water microbial communities from Etoliko Lagoon, Greece | Environmental | Open in IMG/M |
| 3300005613 | Saline sediment microbial communities from Etoliko Lagoon, Greece - sediment | Environmental | Open in IMG/M |
| 3300005913 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK1 | Environmental | Open in IMG/M |
| 3300005914 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKJ | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006637 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006867 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006869 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300007234 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007236 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
| 3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300008517 | Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 175 cmbsf. Combined Assembly of Gp0128389 and Gp0131431 MM4PM4 | Environmental | Open in IMG/M |
| 3300009000 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG | Environmental | Open in IMG/M |
| 3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
| 3300009466 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 2m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
| 3300009470 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, surface; DNA IDBA-UD | Environmental | Open in IMG/M |
| 3300009529 | Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG | Environmental | Open in IMG/M |
| 3300010234 | Freshwater aquifer microbial community from Bangor, North Wales, UK, before enrichment, replicate 2 | Environmental | Open in IMG/M |
| 3300010299 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010316 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010389 | Marine sediment microbial communities from methane seeps within Baltimore Canyon, US Atlantic Margin - Baltimore Canyon MUC-11 12-14 cmbsf | Environmental | Open in IMG/M |
| 3300013010 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNA | Environmental | Open in IMG/M |
| 3300017960 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_S_1 metaG | Environmental | Open in IMG/M |
| 3300017963 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_1 metaG | Environmental | Open in IMG/M |
| 3300017967 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018036 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041406US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018080 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_1 metaG | Environmental | Open in IMG/M |
| 3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018421 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018424 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018682 | Metatranscriptome of marine microbial communities from Baltic Sea - GS680_0p1 | Environmental | Open in IMG/M |
| 3300020440 | Marine microbial communities from Tara Oceans - TARA_E500000178 (ERX555952-ERR599043) | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300022053 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022176 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022843 | Saline water microbial communities from Ace Lake, Antarctica - #5 | Environmental | Open in IMG/M |
| 3300023210 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MG | Environmental | Open in IMG/M |
| 3300023239 | Saline water microbial communities from Ace Lake, Antarctica - #549 | Environmental | Open in IMG/M |
| 3300024262 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024433 | Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024520 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_1 | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025137 | Marine viral communities from the Pacific Ocean - LP-32 (SPAdes) | Environmental | Open in IMG/M |
| 3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025647 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025655 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025671 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025687 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
| 3300025828 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025840 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025853 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300027814 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-3-8_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027888 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-30_32 (SPAdes) | Environmental | Open in IMG/M |
| 3300027901 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-1-36_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300028045 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_10_MG | Environmental | Open in IMG/M |
| 3300029448 | Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082 | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
| 3300031565 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-2 | Environmental | Open in IMG/M |
| 3300031566 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-1 | Environmental | Open in IMG/M |
| 3300031669 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-1 | Environmental | Open in IMG/M |
| 3300031673 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-3 | Environmental | Open in IMG/M |
| 3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
| 3300034418 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSpr2010_100014519 | 3300000116 | Marine | MFKKIKRKLCELMCKVFGITQCLCNHECACKKEAKK* |
| JGI24006J15134_101923572 | 3300001450 | Marine | MFKKIKQKLCELVCKLFGITQCLCAHECDCKKGEK* |
| JGI24006J15134_102395901 | 3300001450 | Marine | KIMFKKIKQKLCELVCKLFGITQCLCAHECDCKKVKK* |
| JGI24003J15210_1000630711 | 3300001460 | Marine | MLKKIKEKICELFCKLFGITQCLCDHECECKKDKK* |
| JGI11772J19994_10022478 | 3300001748 | Saline Water And Sediment | MLKKIKQKICEVVCKIFGITQCLCXHECNCKKESKK* |
| JGI2173J19968_101904991 | 3300001752 | Marine Sediment | MIKKIKKKICELVCKIFGITQCICSHECNCKKEAKK* |
| JGI2160J19893_100221862 | 3300001855 | Marine Sediment | MIKKIKKKICELVCKIFGITQCICSHECNCKKEQKNNDERLS* |
| SMTZ1_1002789710 | 3300002052 | Marine Sediment | MESWKDLFKFIKRKSCELVCKIFGITQCLCNHECNCKKEAKK* |
| Ga0074648_100436415 | 3300005512 | Saline Water And Sediment | MLKKIKQKICEVVCKIFGITQCLCNHECNCKKESKK* |
| Ga0074648_10341016 | 3300005512 | Saline Water And Sediment | MLKKIKNKVCELVCKILGITPCLCDHECNCKKEKK* |
| Ga0074648_10395525 | 3300005512 | Saline Water And Sediment | MLKKIKNKICELVCKILGITPCLCDHECNCKKEKK* |
| Ga0074648_10518252 | 3300005512 | Saline Water And Sediment | MFKKIKNKVCELVCKILGITPCMCDHECNCKKEKK* |
| Ga0074648_10726872 | 3300005512 | Saline Water And Sediment | MFKKIKNKVCELVCKILGITPCLCDHECNCKKEKK* |
| Ga0074648_11550671 | 3300005512 | Saline Water And Sediment | EKIMFKKIKNKLCELVCKILGITPCMCDHECNCKKEKK* |
| Ga0074647_10044875 | 3300005611 | Saline Water And Sediment | MLKKIKNKICELVCKVLGITPCLCDHECSCKKEKK* |
| Ga0074647_10057125 | 3300005611 | Saline Water And Sediment | MFKKIKNKICELVCKILGITPCLCDHECNCKKEKK* |
| Ga0074649_100459420 | 3300005613 | Saline Water And Sediment | MIKKIKQKVCELICKVFGITQCLCSHECNCKKEAKNG* |
| Ga0074649_10064567 | 3300005613 | Saline Water And Sediment | MFKKIKSTLCELVCKILGITPCLCDHECNCKKEKK* |
| Ga0074649_10087909 | 3300005613 | Saline Water And Sediment | MLKKIKNKLCEVVCKILGITPCLCNHECNCKKEKK* |
| Ga0074649_10247056 | 3300005613 | Saline Water And Sediment | MLKKIKNKICEVICKILGITPCLCDHECNCKKEKK* |
| Ga0074649_10255272 | 3300005613 | Saline Water And Sediment | MLKKIKNKLCELVCKALGITPCLCKHECGCKKGKK* |
| Ga0074649_10299413 | 3300005613 | Saline Water And Sediment | MLKKIKQKLCEIVCKIFGITQCLCNHECNCKKEKK* |
| Ga0075108_100060795 | 3300005913 | Saline Lake | MFKKIKRKLCELVCKVFGITQCLCNHECNCKKEAKK* |
| Ga0075117_10090661 | 3300005914 | Saline Lake | MFKKIKRKLCELVCKVFGITQCVCAHECNCKKEAKK* |
| Ga0075474_100226305 | 3300006025 | Aqueous | MIKKIKQKVCELICKVFGITQCLCSHECKCKKEAKNG* |
| Ga0075462_100168963 | 3300006027 | Aqueous | MFKKIKQKLCELVCKVLGITQCLCNHECNCKKENK* |
| Ga0075461_100059791 | 3300006637 | Aqueous | LKVGGKREKDNMETWSGLFKKIKQKVCELVCKIFGITQCLCNHECNCKKEKK* |
| Ga0070749_100265932 | 3300006802 | Aqueous | MESWKDLFKFIKRKSCKLVCKIFGITQCMCNHECNCKKEAKK* |
| Ga0070749_100430722 | 3300006802 | Aqueous | MESWKDLFKYIKRKSCELVCKVLGITQCLCNHECNCKKEKK* |
| Ga0070749_100627615 | 3300006802 | Aqueous | MLKKIKQKLCELVCKVFGITQCLCNHECNCKKEKK* |
| Ga0070749_103511631 | 3300006802 | Aqueous | ETWSGLFKKIKQKVCELVCKIFGITQCLCNHECNCKKEKK* |
| Ga0070749_104649141 | 3300006802 | Aqueous | PILLTLKKVNKMETWKDLFKYIKSKSCELVCKLFGITQCLCNHECNCKKEKK* |
| Ga0070749_106955602 | 3300006802 | Aqueous | METWKDLFKYIKRKSCELVCKIFGITQCLCNHECNCKKEAKK* |
| Ga0070749_107043542 | 3300006802 | Aqueous | METWKDVLKYLKRKSCELVCKIFGITQCLCDHECNCKKDKK* |
| Ga0070754_100203385 | 3300006810 | Aqueous | MFKKIKRKVCELICKIFSITQCLCDHECDCKKEKK* |
| Ga0070754_100223923 | 3300006810 | Aqueous | MESWKDLFKFIKRKSCELVCKLFGITQCMCNHECNCKKEAKK* |
| Ga0070754_100496126 | 3300006810 | Aqueous | MFKKIKQKVCELICKVLGITQCLCSHECNCKKEQNK* |
| Ga0070754_101758622 | 3300006810 | Aqueous | MLKKIKQKVCELICKVLGITQCLCDHECNCKKDKK* |
| Ga0075476_100385415 | 3300006867 | Aqueous | MIKKIKQKVCELICKVFGITQCLCSHECNCKKEAKNGK* |
| Ga0075477_100385171 | 3300006869 | Aqueous | KESNMIKKIKQKLCELVCKILGITQCLCSHECNCKKDKK* |
| Ga0070750_100065914 | 3300006916 | Aqueous | MFKKIKRKVCELVCKIFGITQCLCDHECGCKKEKK* |
| Ga0070750_100181384 | 3300006916 | Aqueous | MFKKIKQKLCELFCKVFGITQCVCDHECNCKKEKK* |
| Ga0070746_100168989 | 3300006919 | Aqueous | MLKKIKQKVCELICKVFGITQCLCDHECNCKKDKK* |
| Ga0070746_103115811 | 3300006919 | Aqueous | METWSGLFKKIKQKVCELVCKIFGITQCLCNHECNCKKEKK* |
| Ga0075460_100048545 | 3300007234 | Aqueous | MFKKIKRKVCELICKVFGITQCLCDHECDCKKEKK* |
| Ga0075460_100386875 | 3300007234 | Aqueous | MFKKIKQKVCELICKVLGITQCLCDHECNCKKDKK* |
| Ga0075460_103116912 | 3300007234 | Aqueous | MFKKIKNKLCELVCKVFGITRCICDHDCNCKKVK* |
| Ga0075463_100283364 | 3300007236 | Aqueous | MIKKIKQKVCELICKVFGITQCLCDHECNCKKDKK* |
| Ga0070752_11782781 | 3300007345 | Aqueous | LKKVNKMETWKDLFKYIKSKSCELVCKLFGITQCLCNHECNCKKEKK* |
| Ga0070752_12844354 | 3300007345 | Aqueous | NMIKKIKQKLCELVCKIFGITQCLCSHECNCKKDKK* |
| Ga0070753_10131653 | 3300007346 | Aqueous | MESWKDLFKFIKRKSCELVCKIFGITQCMCNHECNCKKEAKK* |
| Ga0070753_11292124 | 3300007346 | Aqueous | NNMIKKIKQKLCELICKIFGITQCLCDHECDCKKKENK* |
| Ga0099851_10020856 | 3300007538 | Aqueous | MFKKIKQKLCELVCKVFGITQCLCNHECNCKKEKK* |
| Ga0099851_10171505 | 3300007538 | Aqueous | MESWKDLFKFIKRKSCELVCKIFGITQCLCNHECNCKKESKK* |
| Ga0099849_10040996 | 3300007539 | Aqueous | MESWKDLFKFIKRKSCELVCKLFGITQCLCNHECNCKKEAKK* |
| Ga0099849_10146603 | 3300007539 | Aqueous | MFKKIKNKICELACKILGITPCLCDHECNCKKEKK* |
| Ga0099849_10248148 | 3300007539 | Aqueous | MLKKIKNKLCELVCKVLGITPCICKHECGCKKGKK* |
| Ga0099849_10778361 | 3300007539 | Aqueous | KKIKQKVCELICKVFGITQCLCSHECNCKKEAKNGK* |
| Ga0099847_10025735 | 3300007540 | Aqueous | MESWKDVLKYLKRKSCELVCKVFGITQCLCSHECNCKKEKK* |
| Ga0099847_10067523 | 3300007540 | Aqueous | MFKKIKRKVCELICKVFGITQCLCDHECDCKKKKK* |
| Ga0099847_10124524 | 3300007540 | Aqueous | MIKKIKQKVCELICKVFGITQCLCSHECKCKKEEKNG* |
| Ga0099847_11567354 | 3300007540 | Aqueous | GDKMIKKIKQKVCELICKVFGITQCLCSHECKCKKEAKNG* |
| Ga0099846_10247361 | 3300007542 | Aqueous | NMETWSGLFKKIKQKVCELVCKIFGITQCLCNHECNCKKEKK* |
| Ga0099846_10326413 | 3300007542 | Aqueous | MLKKIKNKICKLVCKIFKITPCICSHECDCKKEAKK* |
| Ga0099846_11790714 | 3300007542 | Aqueous | QKKDGDKMIKKIKQKVCELICKVFGITQCLCSHECKCKKEAKNG* |
| Ga0099846_12273424 | 3300007542 | Aqueous | GDKMIKKIKQKVCELICKVFGITQCLCSHECKCKKEEKNG* |
| Ga0099850_10183987 | 3300007960 | Aqueous | MIKKIKQKLCELVCKIFGITQCLCNHECNCKKENKK* |
| Ga0099850_10259228 | 3300007960 | Aqueous | MLKKIKQKFCEIFCKILGITQCLCDHECNCKKEKK* |
| Ga0099850_10523485 | 3300007960 | Aqueous | MLKKIKNKLCELVCKVLGITPCLCKHECGCKKGKK* |
| Ga0099850_11145761 | 3300007960 | Aqueous | KINKGNNMIKKIKQKLCELVCKVFGITQCLCSHECNCKKENK* |
| Ga0099850_12976634 | 3300007960 | Aqueous | EKDNMETWSGLFKKIKQKVCELVCKIFGITQCLCNHECNCKKEKK* |
| Ga0075480_100694916 | 3300008012 | Aqueous | MFKKIKQKLCELVCKLFGITQCLCAHECDCKKREK* |
| Ga0111034_11188234 | 3300008517 | Marine Sediment | MLKKIKNKLCQLVCKLLNITPCLCNHECDCKKEKK* |
| Ga0102960_13149612 | 3300009000 | Pond Water | MEIMLKKIKNKICEIACKILGITPCLCDHECNCKKEKK* |
| Ga0114918_100439981 | 3300009149 | Deep Subsurface | KKKICEAVCKLFNIVPCICDHECDCKKEAKKGEQ* |
| Ga0114918_103442983 | 3300009149 | Deep Subsurface | MFKKIKKKICEAVCKLFNIVPCICDHECGCKKEVKKGK* |
| Ga0114918_105136831 | 3300009149 | Deep Subsurface | KKEKNSMLKKIKNKICEIICKVFKITPCVCDHECNCKKENK* |
| Ga0114918_105519483 | 3300009149 | Deep Subsurface | LPKKENNNMLKKLKTKICEIICKIFKITPCVCDHECNCKKENK* |
| Ga0114918_106653411 | 3300009149 | Deep Subsurface | EKSNMLKKLKNKICEIICKIFKITPCVCDHECNCKKENK* |
| Ga0114918_107223341 | 3300009149 | Deep Subsurface | LQERLLRREKNNMFKKIKTKICEIVCKIFKITPCVCDHECNCKKGKK* |
| Ga0126448_10114252 | 3300009466 | Meromictic Pond | MIKKIKKKLCELICKIFGITQCICSHECNCKKEAKK* |
| Ga0126447_10072017 | 3300009470 | Meromictic Pond | MFKKIKTKICEIVCKIFKITPCVCDHECNCKKGKK* |
| Ga0114919_1000876811 | 3300009529 | Deep Subsurface | MLKKIKQKLCEMVCKIFGITQCLCSHDCNCKGEK* |
| Ga0114919_100160066 | 3300009529 | Deep Subsurface | MLKKIKNKLCELVCKVLGITPCLCDHECNCKKKK* |
| Ga0114919_100204182 | 3300009529 | Deep Subsurface | MFKKIKNKICELVCKILEITPCLCDHECNCKKEKK* |
| Ga0136261_10021977 | 3300010234 | Freshwater | MFKKIKRKLCELMCKVFGITQCLCNHECSCKKEAKK* |
| Ga0129342_12131231 | 3300010299 | Freshwater To Marine Saline Gradient | MIKKIKQKLCELVCKIFGITQCLCSHECNCKKENK* |
| Ga0136655_10626323 | 3300010316 | Freshwater To Marine Saline Gradient | MIKKIKQKVCELICKVFGITQCLCSHECKCKKEEKNGK* |
| Ga0129324_100910305 | 3300010368 | Freshwater To Marine Saline Gradient | MLKKIKQKVCEIVCKIFGITQCLCNHECNCKKEQK* |
| Ga0136549_100148863 | 3300010389 | Marine Methane Seep Sediment | MIKKIXXXXNKICEIACKILGITPCLCDHECNCKKEKK* |
| Ga0129327_106527284 | 3300013010 | Freshwater To Marine Saline Gradient | GGDKMIKKIKQKLCELVCTIFGITQCLCSHECNCKKEKK* |
| Ga0180429_112293931 | 3300017960 | Hypersaline Lake Sediment | KKMIKKIKNKICEIVCKIFGIVPCMCDHECNCKKEKK |
| Ga0180437_102495145 | 3300017963 | Hypersaline Lake Sediment | MLKKIKNKICEVICKILGITPCMCDHECNCKKEKK |
| Ga0180437_103990101 | 3300017963 | Hypersaline Lake Sediment | MLKKIKNKICELVCKILGITPCLCDHECNCKKEKK |
| Ga0181590_101017073 | 3300017967 | Salt Marsh | MIKKIKQKLCEIVCKIFGITQCLCDHECNCKKEQK |
| Ga0181600_105187232 | 3300018036 | Salt Marsh | MESWKDLFKFIKRKSCELVCKLLGITQCMCNHECNCKK |
| Ga0180433_104441533 | 3300018080 | Hypersaline Lake Sediment | MEIMLKKIKNKICELVCKILGITPCICDHECNCKKEKK |
| Ga0180433_111816681 | 3300018080 | Hypersaline Lake Sediment | RKKMIKKIKNKICEIVCKIFGIVPCMCDHECNCKKEKK |
| Ga0181553_100711056 | 3300018416 | Salt Marsh | METWKDVLKYLKRKSCELVCKIFGITQCLCSHECNCKKEK |
| Ga0181592_100904324 | 3300018421 | Salt Marsh | MIKKIKQKLCEIVCKIFGITQGLCDHECNCKKEQK |
| Ga0181592_101317172 | 3300018421 | Salt Marsh | MIKKIKQKLCELVCKILGITQCLCSHECNCKKDKK |
| Ga0181591_100858602 | 3300018424 | Salt Marsh | MKTWKDLFKYIKRKSCELVCKIFGITQCLCNHECNCKKDAKK |
| Ga0188851_10334412 | 3300018682 | Freshwater Lake | MFKKIKKKICEAVCKLFNIVPCICDHECGCKKEVKKGK |
| Ga0211518_100148139 | 3300020440 | Marine | MLSKLKNKICEIICRVLGITPCMCDHECDCKKKKKNEN |
| Ga0222716_100662567 | 3300021959 | Estuarine Water | MFKKIKRKLCELVCKVFGITQCLCNHECNCKKEKK |
| Ga0222715_100190325 | 3300021960 | Estuarine Water | MIKKIKQKLCELVCKIFGITQCLCNHECNCKKENK |
| Ga0222715_100424892 | 3300021960 | Estuarine Water | MFKKIKQKLCELVCKVLGITQCLCNHECNCKKEKK |
| Ga0222715_100459118 | 3300021960 | Estuarine Water | MLKKIKQKFCEIFCKILGITQCLCDHECNCKKEKK |
| Ga0222715_100528462 | 3300021960 | Estuarine Water | MFKKIKRKVCELVCKIFGITQCLCNYECDCKKEKK |
| Ga0222715_100842903 | 3300021960 | Estuarine Water | MESWKDLFKCIKRKSCELVCKLFGITQCLCNHECNCKKEAKK |
| Ga0222715_101452162 | 3300021960 | Estuarine Water | MEIMLKKIKNKLCKLVCKIFGITPCICSHECDCKKEAKK |
| Ga0222714_1000852213 | 3300021961 | Estuarine Water | MFKKIKQKLCELFCKVFGITQCVCDHECNCKKEKK |
| Ga0222714_100465877 | 3300021961 | Estuarine Water | MLKKIKQKLCELVCKVFNITQCLCNHECNCKKEKK |
| Ga0222714_105102903 | 3300021961 | Estuarine Water | LKKEIINMFKKIKTKICELVCKLFKITPCVCDHECNCKKEAKK |
| Ga0212030_10007696 | 3300022053 | Aqueous | MFKKIKRKVCELICKVFGITQCLCDHECDCKKKKK |
| Ga0212031_10546171 | 3300022176 | Aqueous | KKENNMFKKIKQKLCELVCKVFGITQCLCNHECNCKKEKK |
| Ga0196899_100329417 | 3300022187 | Aqueous | NNMETWSGLFKKIKQKVCELVCKIFGITQCLCNHECNCKKEKK |
| Ga0196905_10007587 | 3300022198 | Aqueous | MIKKIKQKLCELVCKIFGITQCLCNHECNCKKEKK |
| Ga0196905_100216312 | 3300022198 | Aqueous | MFKKIKQKLCELVCKVFGITQCLCNHECNCKKEKK |
| Ga0196901_10051193 | 3300022200 | Aqueous | MESWKDVLKYLKRKSCELVCKVFGITQCLCSHECNCKKEKK |
| Ga0196901_10547725 | 3300022200 | Aqueous | NLMFKKIKQKVCELVCKIFGITQCLCSHECNCKKEKNK |
| Ga0222631_10004556 | 3300022843 | Saline Water | MIKKIKQKLCELVCKLFGITQCVCAHECNCKKEAKK |
| (restricted) Ga0233412_100140118 | 3300023210 | Seawater | MFKKIKRKLCELVCKVFGITQCLCNHECNCKKGTKK |
| Ga0222660_10375433 | 3300023239 | Saline Water | MFKKIKRKLCELVCKVFGITQCVCAHECNCKKEAKK |
| Ga0210003_10121614 | 3300024262 | Deep Subsurface | MFKKIKTKICEIVCKIFKITPCVCDHECNCKKGKK |
| Ga0210003_10319937 | 3300024262 | Deep Subsurface | MFKKIKKKICEAVCKLFNIVPCICDHECDCKKEAKKGEQ |
| Ga0210003_10839485 | 3300024262 | Deep Subsurface | MESWKDLFKFIKRKSCELVCKLFGITQCLCNHECNCKKEAKK |
| Ga0210003_11097357 | 3300024262 | Deep Subsurface | KKEKNSMLKKIKNKICEIICKVFKITPCVCDHECNCKKENK |
| Ga0210003_13418171 | 3300024262 | Deep Subsurface | MIKKIKQKVCELICKVFGITQCLCSHECNCKKEAKNG |
| Ga0209986_1000858910 | 3300024433 | Deep Subsurface | MFKKIKNKVCELVCKILGITPCLCDHECNCKKEKK |
| Ga0209986_100715754 | 3300024433 | Deep Subsurface | MFKKIKNKLCELVCKILGITPCLCDHECNCKKEKK |
| (restricted) Ga0255047_100274734 | 3300024520 | Seawater | MFKKIKRKLCELVCKVFGITQCLCNHECNCKKGAKK |
| Ga0209535_100167323 | 3300025120 | Marine | MLKKIKEKICELFCKLFGITQCLCDHECECKKDKK |
| Ga0209535_10364892 | 3300025120 | Marine | MFKKIKQKLCELVCKLFGITQCLCAHECDCKKGEK |
| Ga0209336_101905392 | 3300025137 | Marine | IMFKKIKQKLCELVCKLFGITQCLCAHECDCKKREK |
| Ga0208303_10008322 | 3300025543 | Aqueous | MIKKIKQKVCELICKVFGITQCLCSHECKCKKEEKNG |
| Ga0208303_100524910 | 3300025543 | Aqueous | MIKKIKQKLCELVCTIFGITQCLCSHECNCKKEKK |
| Ga0208161_10144075 | 3300025646 | Aqueous | MLKKIKNKICKLVCKIFKITPCICSHECDCKKEAKK |
| Ga0208161_10211983 | 3300025646 | Aqueous | MESWKDLFKFIKRKSCELVCKIFGITQCLCNHECNCKKESKK |
| Ga0208161_10509065 | 3300025646 | Aqueous | MFKKIKRKVCELICKVFGITQCLCDHECDCKKEKK |
| Ga0208160_100095813 | 3300025647 | Aqueous | MIKKIKKKICELVCKIFGITQCICSHECNCKKENK |
| Ga0208160_10142007 | 3300025647 | Aqueous | MIKKIKQKLCELVCTIFGITQCLCNHECNCKKEKK |
| Ga0208160_11061321 | 3300025647 | Aqueous | QKKDGDKMIKKIKQKVCELICKVFGITQCLCSHECKCKKEAKNG |
| Ga0208795_10818201 | 3300025655 | Aqueous | LKKVNKMETWKDLFKYIKRKSCELLCKLFGITQCLCNHECNCKKEKK |
| Ga0208898_10370766 | 3300025671 | Aqueous | MESWKDLFKFIKRKSCKLVCKIFGITQCMCNHECNCKKEAKK |
| Ga0208162_11583944 | 3300025674 | Aqueous | GETMFKKIKNKICELACKILGITPCLCDHECNCKKEKK |
| Ga0208019_10092297 | 3300025687 | Aqueous | MLKKIKNKLCELVCKVLGITPCICKHECGCKKGKK |
| Ga0208019_10177285 | 3300025687 | Aqueous | MIKKIKQKLCELVCKIFGITQCLCNHECNCKKENKK |
| Ga0208899_100061738 | 3300025759 | Aqueous | MFKKIKQKLCELVCKVLGITQCLCNHECNCKKENK |
| Ga0208899_10162299 | 3300025759 | Aqueous | MFKKIKQKVCELICKVLGITQCLCSHECNCKKEQNK |
| Ga0208899_10187109 | 3300025759 | Aqueous | ILKKENNMLKKIKQKVCELICKVFGITQCLCDHECNCKKDKK |
| Ga0208899_10211425 | 3300025759 | Aqueous | MIKKIKQKVCELICKVFGITQCLCSHECNCKKEAKNGK |
| Ga0208767_10231574 | 3300025769 | Aqueous | MLKKIKQKVCELICKVFGITQCLCDHECNCKKDKK |
| Ga0208547_10460645 | 3300025828 | Aqueous | MIKKIKQKVCELICKVFGITQCLCSHECKCKKEAKNG |
| Ga0208917_10616605 | 3300025840 | Aqueous | MLKKIKNKLCKLVCKIFGITQCICSHECDCKKEAKK |
| Ga0208645_10068946 | 3300025853 | Aqueous | MFKKIKRKLCELMCKVFGITQCLCNHECACKKEAKK |
| Ga0208644_10216445 | 3300025889 | Aqueous | MIKKIKQKLCELVCKIFGITQCLCSHECNCKKDKK |
| Ga0208644_10349033 | 3300025889 | Aqueous | MESWKDLFKYIKRKSCELVCKVLGITQCLCNHECNCKKEKK |
| Ga0209742_100045013 | 3300027814 | Marine Sediment | MESWKDLFKFIKRKSCELVCKIFGITQCLCNHECNCKKEAKK |
| Ga0209635_106711891 | 3300027888 | Marine Sediment | MESWKDLFKFIKRKSCELVCKIFGITQCMCNHECSCKK |
| Ga0209427_100400623 | 3300027901 | Marine Sediment | MESWKDLFKFIKRKSCELVCKIFGITQCMCNHECNCKKEAKK |
| Ga0209536_1001644404 | 3300027917 | Marine Sediment | MFKKIKQKLCELVCKVLGITQCLCSHECNCKKENK |
| Ga0209536_1005153022 | 3300027917 | Marine Sediment | MFKKIKQKICELVCKIFGITQCLCDHECDCKKEKK |
| (restricted) Ga0233414_105346532 | 3300028045 | Seawater | MEIMLKKIKQKLCEVVCKIFGITQCVCAHECNCKKEAKK |
| Ga0183755_10307948 | 3300029448 | Marine | IMFKKIKNKLCELVCKILGITPCMCDHECNCKKEKK |
| Ga0307488_100128153 | 3300031519 | Sackhole Brine | MFKKIKRKLCELVCKVFGITQCLCNHECNCKKEAKK |
| Ga0307380_114730191 | 3300031539 | Soil | MIKAIKNKLCELVCKLFGITRCICDHECGCKEEAKKDK |
| Ga0307379_102929672 | 3300031565 | Soil | MFKKIKQKVCELVCKIFGITQCLCSHECNCKKEAKK |
| Ga0307378_102079476 | 3300031566 | Soil | MFKKIKKKICEAVCKLFNIVPCICDHECDCKKEAK |
| Ga0307375_100484908 | 3300031669 | Soil | FKKIKKKICEAVCKLFNIVPCICDHECDCKKEAKKGEQ |
| Ga0307375_100911353 | 3300031669 | Soil | METWKDLFKYIKRKSCEIVCKLFGITQCLCNHECNCKKEAKK |
| Ga0307375_101070334 | 3300031669 | Soil | MLKKLKTKICEIVCKIFKITPCVCDHECNCKKENK |
| Ga0307375_101387003 | 3300031669 | Soil | MFKKIKQKLCELVCKVFGITQCLCNHECNCKKENKK |
| Ga0307377_100694625 | 3300031673 | Soil | MFKKIKQKVCELVCKIFGITQCLCSHECNCKKEQNK |
| Ga0307377_104468991 | 3300031673 | Soil | VLQERLPRREKNNMFKKIKTKICEIVCKIFKITPCVCDHECNCKKGKK |
| Ga0307377_105021732 | 3300031673 | Soil | MLKKIKNKLCELVCKALGITPCLCKHECGCKKGKK |
| Ga0307377_106083455 | 3300031673 | Soil | QKKESNMIKKIKQKLCELVCKIFGITQCLCNHECNCKKEKK |
| Ga0348335_024987_619_735 | 3300034374 | Aqueous | MIKKIKQKVCELICKVFGITQCLCSHECNCKKEEKNGK |
| Ga0348335_026133_1800_1907 | 3300034374 | Aqueous | MFKKIKRKVCELICKIFSITQCLCDHECDCKKEKK |
| Ga0348335_072681_1063_1194 | 3300034374 | Aqueous | IKINKGNNMIKKIKKKICELVCKIFGITQCLCNHECNCKKENK |
| Ga0348337_009163_3481_3588 | 3300034418 | Aqueous | MFKKIKQKLCELVCKVFGITQCLCNHECNCKKENK |
| Ga0348337_033180_1636_1761 | 3300034418 | Aqueous | METWKDVLKYLKRKSCELVCKIFGITQCLCDHECNCKKDKK |
| ⦗Top⦘ |