Basic Information | |
---|---|
Family ID | F031433 |
Family Type | Metagenome |
Number of Sequences | 182 |
Average Sequence Length | 46 residues |
Representative Sequence | MRRGGMDGENPKQNEMAEDLDDIATLMNLLELHSRLRIETSHFENELD |
Number of Associated Samples | 99 |
Number of Associated Scaffolds | 182 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Archaea |
% of genes with valid RBS motifs | 67.03 % |
% of genes near scaffold ends (potentially truncated) | 19.78 % |
% of genes from short scaffolds (< 2000 bps) | 63.74 % |
Associated GOLD sequencing projects | 83 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.49 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Archaea (94.505 % of family members) |
NCBI Taxonomy ID | 2157 |
Taxonomy | All Organisms → cellular organisms → Archaea |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (51.648 % of family members) |
Environment Ontology (ENVO) | Unclassified (42.857 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (54.945 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 48.68% β-sheet: 0.00% Coil/Unstructured: 51.32% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 182 Family Scaffolds |
---|---|---|
PF06745 | ATPase | 35.71 |
PF13620 | CarboxypepD_reg | 28.02 |
PF00004 | AAA | 4.95 |
PF05569 | Peptidase_M56 | 3.85 |
PF03965 | Penicillinase_R | 2.75 |
PF02540 | NAD_synthase | 1.65 |
PF12172 | DUF35_N | 1.10 |
PF02803 | Thiolase_C | 1.10 |
PF07282 | OrfB_Zn_ribbon | 1.10 |
PF00171 | Aldedh | 1.10 |
PF07110 | EthD | 1.10 |
PF00230 | MIP | 0.55 |
PF00583 | Acetyltransf_1 | 0.55 |
PF12367 | PFO_beta_C | 0.55 |
COG ID | Name | Functional Category | % Frequency in 182 Family Scaffolds |
---|---|---|---|
COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 2.75 |
COG3682 | Transcriptional regulator, CopY/TcrY family | Transcription [K] | 2.75 |
COG0171 | NH3-dependent NAD+ synthetase | Coenzyme transport and metabolism [H] | 1.65 |
COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 1.10 |
COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 1.10 |
COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 1.10 |
COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 1.10 |
COG0580 | Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family) | Carbohydrate transport and metabolism [G] | 0.55 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 97.25 % |
Unclassified | root | N/A | 2.75 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002558|JGI25385J37094_10000020 | All Organisms → cellular organisms → Archaea | 24721 | Open in IMG/M |
3300002558|JGI25385J37094_10004482 | All Organisms → cellular organisms → Archaea | 4872 | Open in IMG/M |
3300002558|JGI25385J37094_10004713 | All Organisms → cellular organisms → Archaea | 4773 | Open in IMG/M |
3300002558|JGI25385J37094_10008586 | All Organisms → cellular organisms → Archaea | 3629 | Open in IMG/M |
3300002561|JGI25384J37096_10005850 | All Organisms → cellular organisms → Archaea | 4537 | Open in IMG/M |
3300002561|JGI25384J37096_10043199 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1736 | Open in IMG/M |
3300002561|JGI25384J37096_10077335 | All Organisms → cellular organisms → Archaea → TACK group | 1209 | Open in IMG/M |
3300002562|JGI25382J37095_10005049 | All Organisms → cellular organisms → Archaea | 4649 | Open in IMG/M |
3300005174|Ga0066680_10374928 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 906 | Open in IMG/M |
3300005174|Ga0066680_10755898 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 590 | Open in IMG/M |
3300005175|Ga0066673_10006694 | All Organisms → cellular organisms → Archaea | 4706 | Open in IMG/M |
3300005176|Ga0066679_10078704 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 1965 | Open in IMG/M |
3300005177|Ga0066690_10053534 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Thermococci → Thermococcales → Thermococcaceae | 2470 | Open in IMG/M |
3300005177|Ga0066690_10534537 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 786 | Open in IMG/M |
3300005179|Ga0066684_10006104 | All Organisms → cellular organisms → Archaea | 5466 | Open in IMG/M |
3300005180|Ga0066685_10292646 | All Organisms → cellular organisms → Archaea | 1126 | Open in IMG/M |
3300005181|Ga0066678_10082865 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1906 | Open in IMG/M |
3300005186|Ga0066676_10433753 | All Organisms → cellular organisms → Archaea → TACK group | 889 | Open in IMG/M |
3300005445|Ga0070708_100010180 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 7610 | Open in IMG/M |
3300005446|Ga0066686_10124631 | All Organisms → cellular organisms → Archaea → TACK group | 1683 | Open in IMG/M |
3300005447|Ga0066689_10457758 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 801 | Open in IMG/M |
3300005468|Ga0070707_100075897 | All Organisms → cellular organisms → Archaea | 3242 | Open in IMG/M |
3300005468|Ga0070707_100987569 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 807 | Open in IMG/M |
3300005518|Ga0070699_100042713 | All Organisms → cellular organisms → Archaea | 3923 | Open in IMG/M |
3300005536|Ga0070697_100005825 | All Organisms → cellular organisms → Archaea | 9510 | Open in IMG/M |
3300005554|Ga0066661_10003509 | All Organisms → cellular organisms → Archaea | 6984 | Open in IMG/M |
3300005554|Ga0066661_10155823 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1399 | Open in IMG/M |
3300005556|Ga0066707_10225163 | All Organisms → cellular organisms → Archaea → TACK group | 1217 | Open in IMG/M |
3300005558|Ga0066698_10416522 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 921 | Open in IMG/M |
3300005559|Ga0066700_10164460 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1513 | Open in IMG/M |
3300005568|Ga0066703_10573238 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 661 | Open in IMG/M |
3300005586|Ga0066691_10186063 | All Organisms → cellular organisms → Archaea → TACK group | 1206 | Open in IMG/M |
3300005586|Ga0066691_10453724 | All Organisms → cellular organisms → Archaea | 766 | Open in IMG/M |
3300005598|Ga0066706_11103027 | All Organisms → cellular organisms → Archaea | 606 | Open in IMG/M |
3300006034|Ga0066656_10211523 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1237 | Open in IMG/M |
3300006034|Ga0066656_10433808 | All Organisms → cellular organisms → Archaea → TACK group | 854 | Open in IMG/M |
3300006791|Ga0066653_10072431 | All Organisms → cellular organisms → Archaea → TACK group | 1496 | Open in IMG/M |
3300006794|Ga0066658_10025385 | All Organisms → cellular organisms → Archaea | 2357 | Open in IMG/M |
3300006797|Ga0066659_10171602 | All Organisms → cellular organisms → Archaea | 1562 | Open in IMG/M |
3300006804|Ga0079221_10643695 | All Organisms → cellular organisms → Archaea → TACK group | 725 | Open in IMG/M |
3300007255|Ga0099791_10002761 | All Organisms → cellular organisms → Archaea | 7137 | Open in IMG/M |
3300007255|Ga0099791_10065322 | All Organisms → cellular organisms → Archaea | 1644 | Open in IMG/M |
3300007255|Ga0099791_10538474 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 568 | Open in IMG/M |
3300007258|Ga0099793_10008142 | All Organisms → cellular organisms → Archaea | 3949 | Open in IMG/M |
3300007258|Ga0099793_10163021 | All Organisms → cellular organisms → Archaea | 1060 | Open in IMG/M |
3300007258|Ga0099793_10209156 | All Organisms → cellular organisms → Archaea → TACK group | 937 | Open in IMG/M |
3300007265|Ga0099794_10001544 | All Organisms → cellular organisms → Bacteria | 8110 | Open in IMG/M |
3300007265|Ga0099794_10034503 | All Organisms → cellular organisms → Archaea | 2384 | Open in IMG/M |
3300007265|Ga0099794_10175478 | All Organisms → cellular organisms → Archaea | 1093 | Open in IMG/M |
3300007265|Ga0099794_10592588 | All Organisms → cellular organisms → Archaea | 587 | Open in IMG/M |
3300009012|Ga0066710_103155951 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 635 | Open in IMG/M |
3300009012|Ga0066710_103387961 | All Organisms → cellular organisms → Archaea → TACK group | 606 | Open in IMG/M |
3300009038|Ga0099829_10024025 | All Organisms → cellular organisms → Archaea | 4240 | Open in IMG/M |
3300009038|Ga0099829_10050784 | All Organisms → cellular organisms → Archaea | 3072 | Open in IMG/M |
3300009038|Ga0099829_10106166 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 2191 | Open in IMG/M |
3300009038|Ga0099829_10173558 | All Organisms → cellular organisms → Archaea | 1732 | Open in IMG/M |
3300009038|Ga0099829_10575719 | All Organisms → cellular organisms → Archaea | 936 | Open in IMG/M |
3300009038|Ga0099829_10591997 | All Organisms → cellular organisms → Archaea → TACK group | 922 | Open in IMG/M |
3300009038|Ga0099829_10815089 | All Organisms → cellular organisms → Archaea → TACK group | 775 | Open in IMG/M |
3300009038|Ga0099829_11655298 | All Organisms → cellular organisms → Archaea → TACK group | 527 | Open in IMG/M |
3300009038|Ga0099829_11680393 | All Organisms → cellular organisms → Archaea | 522 | Open in IMG/M |
3300009088|Ga0099830_10079567 | All Organisms → cellular organisms → Archaea | 2399 | Open in IMG/M |
3300009088|Ga0099830_10789012 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 783 | Open in IMG/M |
3300009088|Ga0099830_11560770 | Not Available | 550 | Open in IMG/M |
3300009089|Ga0099828_10007282 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 8044 | Open in IMG/M |
3300009089|Ga0099828_10220761 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1694 | Open in IMG/M |
3300009089|Ga0099828_10502125 | All Organisms → cellular organisms → Archaea → TACK group | 1094 | Open in IMG/M |
3300009089|Ga0099828_10622736 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 971 | Open in IMG/M |
3300009089|Ga0099828_11718569 | All Organisms → cellular organisms → Archaea → TACK group | 552 | Open in IMG/M |
3300009090|Ga0099827_10010377 | All Organisms → cellular organisms → Archaea | 5984 | Open in IMG/M |
3300009090|Ga0099827_10108277 | All Organisms → cellular organisms → Archaea | 2220 | Open in IMG/M |
3300009090|Ga0099827_10206918 | All Organisms → cellular organisms → Archaea → TACK group | 1634 | Open in IMG/M |
3300009090|Ga0099827_10706040 | All Organisms → cellular organisms → Archaea → TACK group | 872 | Open in IMG/M |
3300009090|Ga0099827_10913092 | Not Available | 761 | Open in IMG/M |
3300009137|Ga0066709_101549044 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 953 | Open in IMG/M |
3300009137|Ga0066709_103196915 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 597 | Open in IMG/M |
3300010303|Ga0134082_10293313 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 680 | Open in IMG/M |
3300010303|Ga0134082_10430800 | All Organisms → cellular organisms → Archaea | 568 | Open in IMG/M |
3300010304|Ga0134088_10000046 | All Organisms → cellular organisms → Archaea | 28011 | Open in IMG/M |
3300010304|Ga0134088_10493539 | Not Available | 603 | Open in IMG/M |
3300010304|Ga0134088_10512709 | All Organisms → cellular organisms → Archaea → TACK group | 591 | Open in IMG/M |
3300010336|Ga0134071_10770614 | All Organisms → cellular organisms → Archaea | 513 | Open in IMG/M |
3300010398|Ga0126383_13504868 | All Organisms → cellular organisms → Archaea | 512 | Open in IMG/M |
3300011269|Ga0137392_10166067 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1790 | Open in IMG/M |
3300011269|Ga0137392_10749277 | All Organisms → cellular organisms → Archaea → TACK group | 808 | Open in IMG/M |
3300011270|Ga0137391_11441404 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 534 | Open in IMG/M |
3300011271|Ga0137393_10081779 | All Organisms → cellular organisms → Archaea | 2599 | Open in IMG/M |
3300012096|Ga0137389_10309959 | All Organisms → cellular organisms → Archaea | 1337 | Open in IMG/M |
3300012096|Ga0137389_10485496 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1059 | Open in IMG/M |
3300012189|Ga0137388_10266503 | All Organisms → cellular organisms → Archaea | 1563 | Open in IMG/M |
3300012189|Ga0137388_10740771 | All Organisms → cellular organisms → Archaea → TACK group | 912 | Open in IMG/M |
3300012189|Ga0137388_11030432 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 759 | Open in IMG/M |
3300012189|Ga0137388_11329436 | All Organisms → cellular organisms → Archaea → TACK group | 658 | Open in IMG/M |
3300012199|Ga0137383_10056734 | All Organisms → cellular organisms → Archaea | 2807 | Open in IMG/M |
3300012199|Ga0137383_10063300 | All Organisms → cellular organisms → Archaea | 2657 | Open in IMG/M |
3300012201|Ga0137365_10093268 | All Organisms → cellular organisms → Archaea | 2267 | Open in IMG/M |
3300012202|Ga0137363_10487472 | All Organisms → cellular organisms → Archaea → TACK group | 1034 | Open in IMG/M |
3300012203|Ga0137399_10087046 | All Organisms → cellular organisms → Archaea | 2387 | Open in IMG/M |
3300012203|Ga0137399_10208275 | All Organisms → cellular organisms → Archaea → TACK group | 1590 | Open in IMG/M |
3300012203|Ga0137399_10503447 | All Organisms → cellular organisms → Archaea → TACK group | 1016 | Open in IMG/M |
3300012203|Ga0137399_10886058 | All Organisms → cellular organisms → Archaea | 751 | Open in IMG/M |
3300012203|Ga0137399_10929438 | All Organisms → cellular organisms → Archaea → TACK group | 732 | Open in IMG/M |
3300012204|Ga0137374_10414244 | All Organisms → cellular organisms → Archaea | 1067 | Open in IMG/M |
3300012206|Ga0137380_10012469 | All Organisms → cellular organisms → Archaea | 7750 | Open in IMG/M |
3300012206|Ga0137380_10025865 | All Organisms → cellular organisms → Archaea | 5410 | Open in IMG/M |
3300012206|Ga0137380_10028314 | All Organisms → cellular organisms → Archaea | 5166 | Open in IMG/M |
3300012206|Ga0137380_10053024 | All Organisms → cellular organisms → Archaea | 3719 | Open in IMG/M |
3300012206|Ga0137380_10067372 | All Organisms → cellular organisms → Archaea | 3273 | Open in IMG/M |
3300012206|Ga0137380_11452627 | Not Available | 570 | Open in IMG/M |
3300012209|Ga0137379_11601051 | Not Available | 550 | Open in IMG/M |
3300012209|Ga0137379_11604811 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 549 | Open in IMG/M |
3300012211|Ga0137377_10126817 | All Organisms → cellular organisms → Archaea | 2436 | Open in IMG/M |
3300012351|Ga0137386_10228555 | All Organisms → cellular organisms → Archaea | 1337 | Open in IMG/M |
3300012358|Ga0137368_10129918 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1893 | Open in IMG/M |
3300012361|Ga0137360_10683851 | All Organisms → cellular organisms → Archaea → TACK group | 881 | Open in IMG/M |
3300012361|Ga0137360_11028764 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 711 | Open in IMG/M |
3300012918|Ga0137396_10021277 | All Organisms → cellular organisms → Archaea | 4167 | Open in IMG/M |
3300012918|Ga0137396_10050223 | All Organisms → cellular organisms → Archaea | 2857 | Open in IMG/M |
3300012918|Ga0137396_10121098 | All Organisms → cellular organisms → Archaea | 1886 | Open in IMG/M |
3300012918|Ga0137396_10567403 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 840 | Open in IMG/M |
3300012925|Ga0137419_10597748 | All Organisms → cellular organisms → Archaea | 886 | Open in IMG/M |
3300012927|Ga0137416_10048572 | All Organisms → cellular organisms → Archaea | 2959 | Open in IMG/M |
3300012927|Ga0137416_10760209 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 855 | Open in IMG/M |
3300012927|Ga0137416_11373681 | All Organisms → cellular organisms → Archaea → TACK group | 639 | Open in IMG/M |
3300012977|Ga0134087_10362384 | All Organisms → cellular organisms → Archaea → TACK group | 696 | Open in IMG/M |
3300015241|Ga0137418_10358540 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1201 | Open in IMG/M |
3300015357|Ga0134072_10110153 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 859 | Open in IMG/M |
3300015359|Ga0134085_10054853 | All Organisms → cellular organisms → Archaea | 1599 | Open in IMG/M |
3300017654|Ga0134069_1283809 | All Organisms → cellular organisms → Archaea → TACK group | 583 | Open in IMG/M |
3300017657|Ga0134074_1062943 | All Organisms → cellular organisms → Archaea → TACK group | 1257 | Open in IMG/M |
3300017659|Ga0134083_10025020 | All Organisms → cellular organisms → Archaea | 2140 | Open in IMG/M |
3300018431|Ga0066655_10182622 | All Organisms → cellular organisms → Archaea | 1280 | Open in IMG/M |
3300018431|Ga0066655_10194348 | All Organisms → cellular organisms → Archaea | 1249 | Open in IMG/M |
3300018431|Ga0066655_10273759 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1089 | Open in IMG/M |
3300018468|Ga0066662_10181961 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1636 | Open in IMG/M |
3300021046|Ga0215015_10763369 | All Organisms → cellular organisms → Archaea | 1447 | Open in IMG/M |
3300021088|Ga0210404_10042426 | All Organisms → cellular organisms → Archaea | 2101 | Open in IMG/M |
3300025922|Ga0207646_10161146 | All Organisms → cellular organisms → Archaea | 2024 | Open in IMG/M |
3300026296|Ga0209235_1000944 | All Organisms → cellular organisms → Bacteria | 15408 | Open in IMG/M |
3300026296|Ga0209235_1001543 | All Organisms → cellular organisms → Archaea | 12546 | Open in IMG/M |
3300026296|Ga0209235_1002455 | All Organisms → cellular organisms → Bacteria | 10313 | Open in IMG/M |
3300026296|Ga0209235_1003202 | All Organisms → cellular organisms → Archaea | 9139 | Open in IMG/M |
3300026297|Ga0209237_1002587 | All Organisms → cellular organisms → Archaea | 10890 | Open in IMG/M |
3300026297|Ga0209237_1012999 | All Organisms → cellular organisms → Archaea | 4921 | Open in IMG/M |
3300026298|Ga0209236_1211276 | All Organisms → cellular organisms → Archaea → TACK group | 703 | Open in IMG/M |
3300026301|Ga0209238_1009368 | All Organisms → cellular organisms → Archaea | 3857 | Open in IMG/M |
3300026313|Ga0209761_1012224 | All Organisms → cellular organisms → Archaea | 5563 | Open in IMG/M |
3300026323|Ga0209472_1017387 | All Organisms → cellular organisms → Archaea | 3489 | Open in IMG/M |
3300026325|Ga0209152_10000755 | All Organisms → cellular organisms → Archaea | 13738 | Open in IMG/M |
3300026326|Ga0209801_1209350 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 772 | Open in IMG/M |
3300026371|Ga0257179_1009730 | All Organisms → cellular organisms → Archaea | 989 | Open in IMG/M |
3300026480|Ga0257177_1004207 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1687 | Open in IMG/M |
3300026524|Ga0209690_1052387 | All Organisms → cellular organisms → Archaea | 1819 | Open in IMG/M |
3300026528|Ga0209378_1029247 | All Organisms → cellular organisms → Archaea | 2925 | Open in IMG/M |
3300026529|Ga0209806_1000575 | All Organisms → cellular organisms → Archaea | 25175 | Open in IMG/M |
3300026538|Ga0209056_10194442 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1493 | Open in IMG/M |
3300026540|Ga0209376_1180633 | All Organisms → cellular organisms → Archaea | 981 | Open in IMG/M |
3300026551|Ga0209648_10161181 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1759 | Open in IMG/M |
3300026551|Ga0209648_10762122 | All Organisms → cellular organisms → Archaea → TACK group | 528 | Open in IMG/M |
3300027643|Ga0209076_1010889 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 2329 | Open in IMG/M |
3300027643|Ga0209076_1015583 | All Organisms → cellular organisms → Archaea | 2013 | Open in IMG/M |
3300027655|Ga0209388_1182429 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 586 | Open in IMG/M |
3300027671|Ga0209588_1005592 | All Organisms → cellular organisms → Archaea | 3610 | Open in IMG/M |
3300027671|Ga0209588_1016316 | All Organisms → cellular organisms → Archaea | 2292 | Open in IMG/M |
3300027671|Ga0209588_1017243 | All Organisms → cellular organisms → Archaea | 2238 | Open in IMG/M |
3300027671|Ga0209588_1096389 | All Organisms → cellular organisms → Archaea | 953 | Open in IMG/M |
3300027846|Ga0209180_10007830 | All Organisms → cellular organisms → Archaea | 5461 | Open in IMG/M |
3300027846|Ga0209180_10068483 | All Organisms → cellular organisms → Archaea | 1986 | Open in IMG/M |
3300027846|Ga0209180_10138801 | All Organisms → cellular organisms → Archaea → TACK group | 1398 | Open in IMG/M |
3300027875|Ga0209283_10072816 | All Organisms → cellular organisms → Archaea | 2215 | Open in IMG/M |
3300027875|Ga0209283_10123196 | All Organisms → cellular organisms → Archaea → TACK group | 1709 | Open in IMG/M |
3300027875|Ga0209283_10217375 | All Organisms → cellular organisms → Archaea → TACK group | 1269 | Open in IMG/M |
3300027882|Ga0209590_10020975 | All Organisms → cellular organisms → Archaea | 3297 | Open in IMG/M |
3300027882|Ga0209590_10100641 | All Organisms → cellular organisms → Archaea → TACK group | 1726 | Open in IMG/M |
3300027882|Ga0209590_10115416 | All Organisms → cellular organisms → Archaea → TACK group | 1625 | Open in IMG/M |
3300028536|Ga0137415_10051259 | All Organisms → cellular organisms → Archaea | 4001 | Open in IMG/M |
3300028536|Ga0137415_10195692 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1842 | Open in IMG/M |
3300028536|Ga0137415_10458427 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1081 | Open in IMG/M |
3300028536|Ga0137415_10973842 | All Organisms → cellular organisms → Archaea → TACK group | 659 | Open in IMG/M |
3300028673|Ga0257175_1005005 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1779 | Open in IMG/M |
3300032180|Ga0307471_100106518 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 2564 | Open in IMG/M |
3300032205|Ga0307472_102363267 | All Organisms → cellular organisms → Archaea | 539 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 51.65% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 18.13% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 14.84% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 6.59% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.30% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.20% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.10% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.55% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.55% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.55% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.55% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
3300026371 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-B | Environmental | Open in IMG/M |
3300026480 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-B | Environmental | Open in IMG/M |
3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028673 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-B | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI25385J37094_100000206 | 3300002558 | Grasslands Soil | MRLAGMKGENPSQDDMAEDLDDISTLMNLLELHSRLKIETRHFENELD* |
JGI25385J37094_100044824 | 3300002558 | Grasslands Soil | MRRGAMEGENPKQNEMAEDLDDIATLMNLLELHARLRIETSHFETELD* |
JGI25385J37094_100047134 | 3300002558 | Grasslands Soil | MKGENPNQMDMAEDLDDITTLMNLLELRSRLKIETSHFENELD* |
JGI25385J37094_100085865 | 3300002558 | Grasslands Soil | MRRGGMDGENPKQNEMAEDLDDIATLMNLLELHSRMRIETSHFENELD* |
JGI25384J37096_100058505 | 3300002561 | Grasslands Soil | MRRGGMDGENPKQNEMAEDLDXIATXMNLLELHSRXRIETSHFENEXD* |
JGI25384J37096_100431992 | 3300002561 | Grasslands Soil | MRRAGMKGENPKQNDMAKDLDEIATLMNLLELHSLLKIETSHFENELD* |
JGI25384J37096_100773352 | 3300002561 | Grasslands Soil | MKGENPNQMDMAEDLDDITTLMNLLELRSRLKIEASHFENELD* |
JGI25382J37095_100050492 | 3300002562 | Grasslands Soil | MRRAGMKRENPSQDDMAEDLDDISTLMNLLELHSRLKIETRHFENELD* |
Ga0066680_103749282 | 3300005174 | Soil | MRRGDMEGENPKQVNMAEDLDDIATLMNLLELHFRLRNETGHFGNELD* |
Ga0066680_107558981 | 3300005174 | Soil | NPKQNEMAEDLDDIATLMNLLELHARLRIETSHFETELD* |
Ga0066673_100066946 | 3300005175 | Soil | MKGENPNLMDTAEDLDDIATLMKLLELHSRLKIETSHFESELD* |
Ga0066679_100787043 | 3300005176 | Soil | MRRGGMEGENPKQTEVAEDLDDIATLMNLLELHSRLRNETGHFENEID* |
Ga0066690_100535341 | 3300005177 | Soil | ASGRHGRGNPEQNDMAEDLDDIVTLMNLLELHSRLKVGTSHFENELD* |
Ga0066690_105345371 | 3300005177 | Soil | MKGENPNLMDTAEDLDDIATLMKLLELHSRLKIETSHFENELD* |
Ga0066684_100061045 | 3300005179 | Soil | VRRGEMKGENPNLMDTAEDLDDIATLMKLLELHSRLKIETSHFESELD* |
Ga0066685_102926461 | 3300005180 | Soil | MRRGGMKGETPNQMDMAEDLDDIATLMNLLELYSRLKVETSHFENELD* |
Ga0066678_100828652 | 3300005181 | Soil | MRRGDMERENPKQVNMAEDLDDIATLMNLLELHFRLRNETGHFGNELD* |
Ga0066676_104337532 | 3300005186 | Soil | MRRGTMQGENPNQMDMAEDLDDIATLMNLLDLHSRLKVETRHFENELD* |
Ga0070708_1000101802 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRGAMEGENPKQNEMAEDLDDIATLMNLLELHARLRIETSHFEPELD* |
Ga0066686_101246314 | 3300005446 | Soil | MRRGEMGENPNLVDTAEDLDDIAMLMKLLELHSRLKIETSH |
Ga0066689_104577581 | 3300005447 | Soil | RNRLCRGGMKGENPNQMDMAEDLDDITTLMNLLELRSRLKIETSHSENELD* |
Ga0070707_1000758973 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRGGMEGETPKQNEVAEDLDDISTLMNLLELHSRLRIETSHFENELD* |
Ga0070707_1009875691 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | AMEGENPKQNEMAEDLDDIATLMNLLELHARLRIETSHFETELD* |
Ga0070699_1000427133 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRGHMEGETPKQNEMAEDLDDIATLMNLLELHSRLRNETNHFASDLG* |
Ga0070697_1000058258 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MEGETPKQNEVDEDLDDIATLMNLLELHSRLRNETNHFASDLG* |
Ga0066661_100035092 | 3300005554 | Soil | MRRAGVKGENPQQNDMAEGLDDIATLMNLLELHSRLKVGTSHFENELD* |
Ga0066661_101558232 | 3300005554 | Soil | MRRGGMDGENPKQNEMAEDLDDIATLMNLLELHSRLRIETSHFENELD* |
Ga0066707_102251632 | 3300005556 | Soil | VSRRHEGENPNQMDMAEDLDDITTLMNLLELRSRLKIEASHFENELD* |
Ga0066698_104165222 | 3300005558 | Soil | MCRGGMKGENPNQMDMAEDLDDITTLMNLLELRSRLKIETSHFENELD* |
Ga0066700_101644602 | 3300005559 | Soil | MDNAEDFDEIATLMNLLELHFRLRVETSHFEGQLD* |
Ga0066703_105732382 | 3300005568 | Soil | MKGENPNQMDMAEDLDDITTLMNLLELRSHLKIETSHFENELD* |
Ga0066691_101860632 | 3300005586 | Soil | MRRAGMKGENPQQNDTAGLDDIATLMNLLELHSRLKIETGHFENELD* |
Ga0066691_104537242 | 3300005586 | Soil | FAAEDLDDIATLVNLLELHARLRSESSGLENDFD* |
Ga0066706_111030271 | 3300005598 | Soil | MRRAGVKGENPQQNDMAEDLDDIATLMNLLELHSRLKVGTSHFENELD* |
Ga0066656_102115232 | 3300006034 | Soil | MCRGGMKGENPNQMNMAEDLDDITTLMNLLELRSRLKIETSHFENELD* |
Ga0066656_104338081 | 3300006034 | Soil | MDMAEDLDDITTLMNLLELRSRLKIEASHFENELD* |
Ga0066653_100724312 | 3300006791 | Soil | MRRGEMGENPNLVDTAEDLDDIAMLMKLLELHSRLKIETSHFESELD* |
Ga0066658_100253851 | 3300006794 | Soil | MDNAEDLDEIATLMNLLELHFRLRVETSHFEGQLD* |
Ga0066659_101716022 | 3300006797 | Soil | MRRGGMKGENPKQNDMAEDLDDIATLMNLLELHSRLKVGTSHFENELD* |
Ga0079221_106436952 | 3300006804 | Agricultural Soil | MRRGGIEGENPKQFRMAEDLDDIATLMNLLDLHSRLRNETGQFENDLD* |
Ga0099791_100027613 | 3300007255 | Vadose Zone Soil | MRQGDMESENPKQVNTAEDLDDIATLMNLLELHSRLRNETGRFDNELD* |
Ga0099791_100653222 | 3300007255 | Vadose Zone Soil | MEGETPKQIQLAEDLDDIATLMNLLELHSRLRIATSSFETELE* |
Ga0099791_105384742 | 3300007255 | Vadose Zone Soil | GGMDGENPKQNEMAEDLDDIATLMNLLELHSRLRIETSHFENELD* |
Ga0099793_100081424 | 3300007258 | Vadose Zone Soil | MRRGDMEGENPKQVNVAEDLDDIATLMNLLELHSRLRIETGHFDNQLD* |
Ga0099793_101630212 | 3300007258 | Vadose Zone Soil | MRRGGVKGENPNQNDVAEDLDDIATLMNLLELHSRLKIETGHFENELD* |
Ga0099793_102091561 | 3300007258 | Vadose Zone Soil | MDRENPKQNETAEDLDDIATLTNLLELHSRLRIETSHFENELD* |
Ga0099794_100015444 | 3300007265 | Vadose Zone Soil | MRRGDMESENPKQVNTAEDLDDIATLMNLLELHSRLRNETGRFDNELD* |
Ga0099794_100345031 | 3300007265 | Vadose Zone Soil | GMEGETPKQIQLAEDLDDIATLMNLLELHSRLRIATSSFETQLD* |
Ga0099794_101754782 | 3300007265 | Vadose Zone Soil | MEGETPKPIEMAEDLDDIATLVNLLELRSRLRNGHFENDLD* |
Ga0099794_105925882 | 3300007265 | Vadose Zone Soil | GMEGETPKQIQLAEDLDDIATLMNLLELHSRLRIATSSFETELE* |
Ga0066710_1031559511 | 3300009012 | Grasslands Soil | ENPNQMDMAEDLDDITTLMNLLELRSRLKIETSHFENELD |
Ga0066710_1033879612 | 3300009012 | Grasslands Soil | MKGENPNQMDMAEDLDDITTLMNLLELRSRLKIET |
Ga0099829_100240252 | 3300009038 | Vadose Zone Soil | MEGENPKQNEMAEDLDDIATLMNLLELHARLRIETSHFETELD* |
Ga0099829_100507843 | 3300009038 | Vadose Zone Soil | MRRGMEGENPQQNEMAEDLDEIQTLMNLLELHSRLRIATSCFESELD* |
Ga0099829_101061662 | 3300009038 | Vadose Zone Soil | MRRGDMESENPKQVNTAEDIDDIATLMNLLELHSRLRNETGRFDNELD* |
Ga0099829_101735581 | 3300009038 | Vadose Zone Soil | MEGENPKQTQLAEDLDDIATLMNLLELHSRLRIATSS |
Ga0099829_105757192 | 3300009038 | Vadose Zone Soil | QPIRNVMRRGGMEGENPKQTQLAEDLDDIATLMNLLELHSRLRTATSSFETELD* |
Ga0099829_105919971 | 3300009038 | Vadose Zone Soil | MRRGGMEGETPKQIQLAEDLDDIATLMNLLELHSRLRIATSSFETELE* |
Ga0099829_108150891 | 3300009038 | Vadose Zone Soil | MRRAGLIGESLKQNDMVEDLDDIATLMNLLELHSRLKVETSHFENDLD* |
Ga0099829_116552982 | 3300009038 | Vadose Zone Soil | MRRGGMEGENPKQNEMAEDLDDIATLMNLLELHVRLRIE |
Ga0099829_116803932 | 3300009038 | Vadose Zone Soil | QTPAAEDLDEIDTLMNLLELRTRLRSETSRFENELE* |
Ga0099830_100795672 | 3300009088 | Vadose Zone Soil | MRRGGTRGQYPKQTPAAEDLDEIDTLMNLLELRTRLRSETSRFENELE* |
Ga0099830_107890122 | 3300009088 | Vadose Zone Soil | MRRGYMESENPKQVNTAEDLDDIATLMNLLELHSRLRNETGRFDNELD* |
Ga0099830_115607701 | 3300009088 | Vadose Zone Soil | MRRGGMEGENPNQTQLAEDLDDIATLMNLLELHSRLRIATSSFETELD* |
Ga0099828_100072828 | 3300009089 | Vadose Zone Soil | MRRAGMKWENPKQNDMAEDLDDIATLMNLLELHSRLKVETSHFESELD* |
Ga0099828_102207612 | 3300009089 | Vadose Zone Soil | MRRGGMEGENPKQNEMAEDLDDIATLVNLLELHVRLRIETAHFENELD* |
Ga0099828_105021251 | 3300009089 | Vadose Zone Soil | MRRAGIKGENPKQMDMAEDLDDIATLMNLLELHSRLKGEKGRFENELD* |
Ga0099828_106227362 | 3300009089 | Vadose Zone Soil | MRRGDMESENPRQANMAEDLDDIATLMNLLELHSRLRNETGRFDNELD* |
Ga0099828_117185691 | 3300009089 | Vadose Zone Soil | MEGENPKQTQLAEDLDDIATLMNLLELHSRLRIATSSFETELE* |
Ga0099827_100103776 | 3300009090 | Vadose Zone Soil | MRRGGTEGENHKQTQLAEDLDDIATLMNLLELHSRLRIATSSFETELD* |
Ga0099827_101082772 | 3300009090 | Vadose Zone Soil | MRRGGMEGENPKQNEMAEYSEDIDDIATLMNLLELHVRLRIETSHFENELD* |
Ga0099827_102069182 | 3300009090 | Vadose Zone Soil | MRRGDMEGENPKQVNMTEDLDDIATLMNLLELHSRLRNETGRFDNDLD* |
Ga0099827_107060401 | 3300009090 | Vadose Zone Soil | MRRAGLTGESPKQNDMAEDLDDIATLMNLLELHSRLKVETSHFENELD* |
Ga0099827_109130921 | 3300009090 | Vadose Zone Soil | MEGENPKQTQLAEDLDDIATLMNLLELHSRLRIATSSFETELD* |
Ga0066709_1015490442 | 3300009137 | Grasslands Soil | MRRAGMKGENPQQNDMAEDLDDIATLMKLLELHSRLKIETSDFENELD* |
Ga0066709_1031969152 | 3300009137 | Grasslands Soil | LCRGGMKGENPNQMDMAEDLDDITTLMNLLELRSRLKIETSHFENELD* |
Ga0134082_102933131 | 3300010303 | Grasslands Soil | MKGETPNQMDMAEDLDDIATLMNLLELYSRLKVETSHFENELD* |
Ga0134082_104308001 | 3300010303 | Grasslands Soil | MCRGGMKGENPNQMDMAEDLDDITTLMNLLELRSRLKIETSHFEGELD* |
Ga0134088_1000004614 | 3300010304 | Grasslands Soil | MDGENPKQNEMAEDLDDIATLMNLLELHSRMRIETSHFENELD* |
Ga0134088_104935392 | 3300010304 | Grasslands Soil | MCRGGMKGENPNHMDMAEDLDDITTLMNLLELRSRLKIETSHFENELD* |
Ga0134088_105127092 | 3300010304 | Grasslands Soil | MKGENPNQMDMAEDLDDIATLMNLLELHSRLKVETRHFENELD* |
Ga0134071_107706141 | 3300010336 | Grasslands Soil | QPIRNRLCRGGMKGENPNQMDMAEDLDDITTLMNLLELRSRLKIETSHFEGELD* |
Ga0126383_135048682 | 3300010398 | Tropical Forest Soil | RRASMEGEKPKRIQMAEDLDDISTLVNLLELRSSLRLENIHSDNDLD* |
Ga0137392_101660671 | 3300011269 | Vadose Zone Soil | MRRGDMEGENPKQVNTAEDLDDISTLMNLLELHSRLRNETGRFDNELD* |
Ga0137392_107492772 | 3300011269 | Vadose Zone Soil | MRRGGMEGENPKQVHMAEDLDDIATLMNLLELHSRLRNETGHFDNEL |
Ga0137391_114414042 | 3300011270 | Vadose Zone Soil | MRRGDMESENPKQVNTAEDLDDIATLMNLLELHSRLRNETGRFDNDLD* |
Ga0137393_100817793 | 3300011271 | Vadose Zone Soil | MESENPKQVNTAEDLDDIATLMNLLELHSRLRNETGRFDNELD* |
Ga0137389_103099592 | 3300012096 | Vadose Zone Soil | MRRAGLTGESHKQNDMAEDLDDIATLMNLLELHSRLKVETSHFESELD* |
Ga0137389_104854962 | 3300012096 | Vadose Zone Soil | MRRGDMEGENPKQVNTAEDLDDIATLMNLLELHSRLRNETGRFDNELD* |
Ga0137388_102665032 | 3300012189 | Vadose Zone Soil | MRRGDMEGENPKQNEMAEDLDDIATLMNLLELHSRLKVETSHFENDLD* |
Ga0137388_107407712 | 3300012189 | Vadose Zone Soil | MRRAGMKWENPKQNDMAEDLDDIATLMNLLELHSRLKVETSHFENELD* |
Ga0137388_110304321 | 3300012189 | Vadose Zone Soil | NPKQNEMAEDLDDIATLMNLLELHVRLRIETSHFENELD* |
Ga0137388_113294362 | 3300012189 | Vadose Zone Soil | MEGENPQQNEMAEDLDEIQTLMNLLELHSRLRIATSCFE |
Ga0137383_100567341 | 3300012199 | Vadose Zone Soil | MRRGGMERENPKQVNMAEDLDDIATLMNLLELHSRLRNETGHFDSELD* |
Ga0137383_100633002 | 3300012199 | Vadose Zone Soil | MRRGGMEGENTKQANMAEDLDDIATLMNLLVLHSRLRNETGHFENEID* |
Ga0137365_100932682 | 3300012201 | Vadose Zone Soil | MKGETPNQMDMAEDLDDIATLMNLLELHSRLKVETRHFENELD* |
Ga0137363_104874721 | 3300012202 | Vadose Zone Soil | MRRGDMESENPKQVNTAEDLDDIATLMNLLELHSRLRNETGRFD |
Ga0137399_100870462 | 3300012203 | Vadose Zone Soil | MEGETPKHIEMVEDLDDIATLVNLLELRSRLRIGHFENELD* |
Ga0137399_102082753 | 3300012203 | Vadose Zone Soil | MRRGGLEGENPKQVNMAEDLDDIATLMNLLELHSRLR |
Ga0137399_105034471 | 3300012203 | Vadose Zone Soil | MRRGDMESENPKQVNTTEDLDDIATLMNLLELHSRLRNETGRFDNELD* |
Ga0137399_108860582 | 3300012203 | Vadose Zone Soil | MRRGGLEGETPKHVEMAEDLDDIATLVNLLELRSRLRIGHFENELD* |
Ga0137399_109294382 | 3300012203 | Vadose Zone Soil | MEGETPKRIRLAEDLDDIATLMNLLELHSRLRIATSSFETELD* |
Ga0137374_104142442 | 3300012204 | Vadose Zone Soil | MQGENPNQMDMAEDLDDIATLMNLLDLHSRLKVETRHFENELD* |
Ga0137380_100124691 | 3300012206 | Vadose Zone Soil | MRRAGMKGENPQQNDMAEDLDDIATLMNLLELHSRLKIETSHFENELD* |
Ga0137380_100258652 | 3300012206 | Vadose Zone Soil | MEGENPKQVNMAEDLDDIATLMNLLELHSRLRNETGHFDSELD* |
Ga0137380_100283142 | 3300012206 | Vadose Zone Soil | MKGETPNQMDMAEDLDDIATLMNLLELHSRLRVETSHFENELD* |
Ga0137380_100530244 | 3300012206 | Vadose Zone Soil | MRRGDMEGENPKLVNIAEDLDDIATLMNLLELHSRLRNETGRFDNELD* |
Ga0137380_100673724 | 3300012206 | Vadose Zone Soil | MRRGGMEGENPKQANMAEDLDDIATLMNLLELHSRLRNETGHFENEID* |
Ga0137380_114526271 | 3300012206 | Vadose Zone Soil | MKGEDSKQNDMAEDLDEIATLMNLLELHSQLKIETSHFENELD* |
Ga0137379_116010512 | 3300012209 | Vadose Zone Soil | MRRAGMKGENPQNDMAEDLDEIATLMNLLELHSHLKIETSHFENELD* |
Ga0137379_116048111 | 3300012209 | Vadose Zone Soil | MKGENPQNDKAEDLDEIATLMNLLELHSRLKIETSHFENELD* |
Ga0137377_101268174 | 3300012211 | Vadose Zone Soil | MRRGGMEGENPKQVNMAEDLDDIATLMNLLELHSRLRNETGHFDSELD* |
Ga0137386_102285552 | 3300012351 | Vadose Zone Soil | MKGETPNQMDMVEDLDDIATLMNLLELHSRLKVETRHFENELD* |
Ga0137368_101299182 | 3300012358 | Vadose Zone Soil | MKGETPNQMDMAEDLDDIATLMNLLELHSRLKVETRHFENELN* |
Ga0137360_106838511 | 3300012361 | Vadose Zone Soil | MRRGDMESENPKQVNTAEDLDDIATLMNLLELHSRLRNEAGRFDNELD* |
Ga0137360_110287641 | 3300012361 | Vadose Zone Soil | MKGENPQNDMAEDLDEIATLMNLLELHSHLKIETSHFENELD* |
Ga0137396_100212775 | 3300012918 | Vadose Zone Soil | MRRGGMKGETLKQNDVAEDLDDIATLMNLLELHSHLKVETGHLENELD* |
Ga0137396_100502233 | 3300012918 | Vadose Zone Soil | MRRGAMEGENPKQNEMAEDLDDIATLMNLLELHARLRIETSHFKTELD* |
Ga0137396_101210982 | 3300012918 | Vadose Zone Soil | MRRGDMEGENPKQVNVAEDLDDIATLMNLLELHSRLRNETGHFDYELD* |
Ga0137396_105674032 | 3300012918 | Vadose Zone Soil | MRRGGLEGETPKHFEMAEDLDDIATLVNLLELRSRLRIGHFENELD* |
Ga0137419_105977482 | 3300012925 | Vadose Zone Soil | QVNTAEDLDDIATLMNLLELHSRLRNETGRFDNELD* |
Ga0137416_100485723 | 3300012927 | Vadose Zone Soil | MRRGSMEGENSKQTQLAEDLDDIATLMNLLELQSRLRIAASSFDTQLD* |
Ga0137416_107602092 | 3300012927 | Vadose Zone Soil | MRRGDMEAENPKQVSMAEDLDDIATLMNLLELHSRLRNETGHFDNELD* |
Ga0137416_113736811 | 3300012927 | Vadose Zone Soil | MRRGDMESENPKQVNTTEDLDDIATLMNLLELHSRLRN |
Ga0134087_103623841 | 3300012977 | Grasslands Soil | MKGENPNLMDTAEDLDDIATLMKLLELHSRLRIETSHFESELY* |
Ga0137418_103585402 | 3300015241 | Vadose Zone Soil | MRRGDMDRENPRQGNMAEDLDDIATLMNLLELHSRLRIETGHFDNQLD* |
Ga0134072_101101531 | 3300015357 | Grasslands Soil | PNQMDMAEDLDDITTLMNLLELRSRLKIETSHFENELD* |
Ga0134085_100548532 | 3300015359 | Grasslands Soil | MRRAGMKGENPNLMDVAEDLDDIVTLMNLLELRSRLKIETSHFENELD* |
Ga0134069_12838092 | 3300017654 | Grasslands Soil | MKGENPNQMNMAEDLDDITTLMNLLELRSRLKIETSHFENELD |
Ga0134074_10629431 | 3300017657 | Grasslands Soil | MKGENPNQMDMAEDLDDITTLMNLLELRSRLKIEASH |
Ga0134083_100250203 | 3300017659 | Grasslands Soil | MKGENPNQMDMAEDLDDITTLMNLLELRSRLKIETSHFEGELD |
Ga0066655_101826221 | 3300018431 | Grasslands Soil | MRRGGMKGETPNQMDMAEDLDDIATLMNLLELYSRLKVETSHFENELD |
Ga0066655_101943482 | 3300018431 | Grasslands Soil | MCRGGMKGENPNQMDMAEDLDDITTLMNLLELRSRLKIETSHFENELD |
Ga0066655_102737592 | 3300018431 | Grasslands Soil | MKGENPNLMDTAEDLDDIATLMKLLELHSRLKIETSHFESELD |
Ga0066662_101819613 | 3300018468 | Grasslands Soil | MRRGDMEGENPKQVNMAEDLDDIATLMNLLELHFRLRNETGHFGNELD |
Ga0215015_107633692 | 3300021046 | Soil | MRRGGMKGENPKQNEAAEDLDDIATLMNLLELHSRLKLETSHFGNELD |
Ga0210404_100424262 | 3300021088 | Soil | MRRGGMEGENPKQSKVAEDLDDIATLMNLLELHSRLRNETGHFDNELD |
Ga0207646_101611462 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRGGMEGETPKQNEVAEDLDDISTLMNLLELHSRLRIETSHFENELD |
Ga0209235_100094415 | 3300026296 | Grasslands Soil | MEGENPKQNEMAEDLDDIATLMNLLELHARLRIETSHFETELD |
Ga0209235_10015438 | 3300026296 | Grasslands Soil | MRLAGMKGENPSQDDMAEDLDDISTLMNLLELHSRLKIETRHFENELD |
Ga0209235_10024552 | 3300026296 | Grasslands Soil | MRRGGMDGENPKQNEMAEDLDDIATLMNLLELHSRMRIETSHFENELD |
Ga0209235_10032026 | 3300026296 | Grasslands Soil | MKGENPNQMDMAEDLDDITTLMNLLELRSRLKIETSHFENELD |
Ga0209237_10025877 | 3300026297 | Grasslands Soil | MRRAGMKRENPSQDDMAEDLDDISTLMNLLELHSRLKIETRHFENELD |
Ga0209237_10129994 | 3300026297 | Grasslands Soil | MRRAGMKGENPKQNDMAKDLDEIATLMNLLELHSLLKIETSHFENELD |
Ga0209236_12112761 | 3300026298 | Grasslands Soil | MRRGGMKGENPKQNDMAEDLDDIATLMNLLELHSRLKVGTSHFENELD |
Ga0209238_10093681 | 3300026301 | Grasslands Soil | ASGRHGRGNPEQNDMAEDLDDIATLMNLLELHSRLKVGTSHFENELD |
Ga0209761_10122242 | 3300026313 | Grasslands Soil | MKGENPNQMDMAEDLDDITTLMNLLELRSRLKIEASHFENELD |
Ga0209472_10173874 | 3300026323 | Soil | MKGENPNLMDTAEDLDDIATLMKLLELHFRLKIETSHFESELD |
Ga0209152_1000075512 | 3300026325 | Soil | MDNAEDLDEIATLMNLLELHFRLRVETSHFEGQLD |
Ga0209801_12093502 | 3300026326 | Soil | MRRGDMERENPKQVNMAEDLDDIATLMNLLELHFRLRNETGHFGNELD |
Ga0257179_10097302 | 3300026371 | Soil | MRRGGMEGETPKQIQLAEDLDDIATLMNLLELHSRLRIATSSFETELE |
Ga0257177_10042072 | 3300026480 | Soil | MRRGDMEGENPKRVNTAEDLDDIATLMNLLELHSRLRNETGRFDNELD |
Ga0209690_10523872 | 3300026524 | Soil | MKGENPNQMDMAEDLDDITTLMNLLELRSRLKIETSHSENELD |
Ga0209378_10292472 | 3300026528 | Soil | MDMAEDLDDITTLMNLLELRSRLKIEASHFENELD |
Ga0209806_100057514 | 3300026529 | Soil | MRRGGMDGENPKQNEMAEDLDDIATLMNLLELHSRLRIETSHFENELD |
Ga0209056_101944423 | 3300026538 | Soil | RGDMEGENPKQVNMAEDLDDIATLMNLLELHFRLRNETGHFGNELD |
Ga0209376_11806332 | 3300026540 | Soil | MRRGTMKGETPNQMDMAEDLDDIATLMNLLELHSRLKVETRHFENELD |
Ga0209648_101611811 | 3300026551 | Grasslands Soil | MRRGGMEGENPKQVNMAEDLDDIATLMNLLELRSHLRNETGCFDNELD |
Ga0209648_107621221 | 3300026551 | Grasslands Soil | MRRGGMDGENPKQNEIAEDLDDIATLMNLLELHSRLRNETGHFHNELD |
Ga0209076_10108892 | 3300027643 | Vadose Zone Soil | MRRGDMEGENPKQVNVAEDLDDIATLMNLLELHSRLRIETGHFDNQLD |
Ga0209076_10155833 | 3300027643 | Vadose Zone Soil | MRRGAMEGENPKQNEMAEDLDDIATLMNLLELHARLRIETSHFETELD |
Ga0209388_11824291 | 3300027655 | Vadose Zone Soil | MRQGDMESENPKQVNTAEDLDDIATLMNLLELHSRLRNETGRFDNELD |
Ga0209588_10055925 | 3300027671 | Vadose Zone Soil | MESENPKQVNTAEDLDDIATLMNLLELHSRLRNETGRFDN |
Ga0209588_10163161 | 3300027671 | Vadose Zone Soil | NVMRRGGMEGETPKQIQLAEDLDDIATLMNLLELHSRLRIATSSFETELE |
Ga0209588_10172433 | 3300027671 | Vadose Zone Soil | MRRGGMEGETPKQIQLAEDLDDIATLMNLLELHSRLRIATSSFETQLD |
Ga0209588_10963891 | 3300027671 | Vadose Zone Soil | MESENPKQVNTAEDLDDIATLMNLLELHSRLRNETGRFDNELD |
Ga0209180_100078304 | 3300027846 | Vadose Zone Soil | MRRGGMEGENPKQTQLAEDLDDIATLMNLLELHSRLRIATSSFETELD |
Ga0209180_100684833 | 3300027846 | Vadose Zone Soil | MRRGMEGENPQQNEMAEDLDEIQTLMNLLELHSRLRIATSCFESELD |
Ga0209180_101388011 | 3300027846 | Vadose Zone Soil | MRRGDMESENPKQVNTAEDIDDIATLMNLLELHSRLRNETGRFDNELD |
Ga0209283_100728162 | 3300027875 | Vadose Zone Soil | MRRAGIKGENPKQMDMAEDLDDIATLMNLLELHSRLKGEKGRFENELD |
Ga0209283_101231961 | 3300027875 | Vadose Zone Soil | MRRAGMKWENPKQNDMAEDLDDIATLMNLLELHSRLKVETSHFESELD |
Ga0209283_102173752 | 3300027875 | Vadose Zone Soil | MRRGDMESENPRQANMAEDLDDIATLMNLLELHSRLRNETGRFDNELD |
Ga0209590_100209752 | 3300027882 | Vadose Zone Soil | MRRGGMEGENPKQNEMAEYSEDIDDIATLMNLLELHVRLRIETSHFENELD |
Ga0209590_101006411 | 3300027882 | Vadose Zone Soil | MRRGDMEGENPKQVNMTEDLDDIATLMNLLELHSRLRNETGRFDNDLD |
Ga0209590_101154162 | 3300027882 | Vadose Zone Soil | MRRGGTEGENHKQTQLAEDLDDIATLMNLLELHSRLRIATSSFETELD |
Ga0137415_100512591 | 3300028536 | Vadose Zone Soil | MRRGDMESENPKQVNTAEDLDDIATLMNLLELHSRLRNETGRFDNELD |
Ga0137415_101956922 | 3300028536 | Vadose Zone Soil | MRRGSMEGENSKQTQLAEDLDDIATLMNLLELQSRLRIAASSFDTQLD |
Ga0137415_104584272 | 3300028536 | Vadose Zone Soil | MRRGGVKGENPNQNDVAEDLDDIATLMNLLELHSRLKIETGHFENELD |
Ga0137415_109738421 | 3300028536 | Vadose Zone Soil | MRRGGMEGETPKHIEMVEDLDDIATLVNLLELRSRLRIGHFENELD |
Ga0257175_10050051 | 3300028673 | Soil | MRRGGMEGENPKQNEMAEDLDDIATLMNLLELHVRLRIETSHFENELD |
Ga0307471_1001065182 | 3300032180 | Hardwood Forest Soil | MRRGDMEGENPKQVNRAEDLDDIATLMNLLELHSRLRTEAGHLDIELD |
Ga0307472_1023632672 | 3300032205 | Hardwood Forest Soil | MRRGDMDGKNPKQVNMAEDLDDIATLMNLLELHSRLRNETGHFDNELD |
⦗Top⦘ |